MAST - Output

MAST -- Motif Alignment and Search Tool

Motif search tool


MAST sends you two e-mail messages:
  • a confirmation message and
  • your search results.
  • The e-mail messages and how MAST computes match scores and their statistical significance (p-values) are explained in the following sections. A sample search results file is also provided.

    Return to MAST introduction.


  • Confirmation message

    The first e-mail message you receive should be a confirmation message to let you know that your search request has been received. You should receive an e-mail message that looks something like this:
    Subject: MAST confirmation: alcohol dehydrogenase motifs
     
    Your MAST search request 14019 is being processed:
    Motif file: adh
    Database to search: SwissProt
    
    If you fail to receive the confirmation message, check your e-mail address and try resubmitting your MAST request.

  • Search Results

    The second e-mail message you should receive contains the results of the MAST search. It contains:

    Each section of the results file contains an explanation of how to interpret them.

  • Match Scores

    The match score of a motif to a position in a sequence is the sum of the score from each row of the position-dependent scoring matrix corresponding to the letter at that position in the sequence. For example, if the sequence is
    TAATGTTGGTGCTGGTTTTTGTGGCATCGGGCGAGAATAGCGC
       ========
    
    and the motif is represented by the position-dependent scoring matrix (where each row of the matrix corresponds to a position in the motif)
    =========|=================================
    POSITION |   A        C        G        T
    =========|=================================
      1	 | 1.447    0.188   -4.025   -4.095 
      2	 | 0.739    1.339   -3.945   -2.325 
      3	 | 1.764   -3.562   -4.197   -3.895 
      4	 | 1.574   -3.784   -1.594   -1.994 
      5	 | 1.602   -3.935   -4.054   -1.370 
      6	 | 0.797   -3.647   -0.814    0.215 
      7	 |-1.280    1.873   -0.607   -1.933 
      8	 |-3.076    1.035    1.414   -3.913 
    =========|=================================
    
    then the match score of the fourth position in the sequence (underlined) would be found by summing the score for T in position 1, G in position 2 and so on until G in position 8. So the match score would be
      score = -4.095 + -3.945 + -3.895 + -1.994
    	  + -4.054 + -0.814 + -1.933 + 1.414 
    	= -19.316
    
    The match scores for other positions in the sequence are calculated in the same way. Match scores are only calculated if the match completely fits within the sequence. Match scores are not calculated if the motif would overhang either end of the sequence.

  • P-values

    MAST reports all matches of a sequence to a motif or group of motifs in terms of the p-value of the match. MAST considers the p-values of four types of events: All p-values are based on a random sequence model that assumes each position in a random sequence is generated according to the average letter frequencies of all sequences in the the appropriate (peptide or nucleotide) non-redundant database (ftp://ncbi.nlm.nih.gov/blast/db/) on September 22, 1996.

  • Database and Motifs

    This section shows information on the database that was searched and the motifs in the search query. The database section gives the date the database was last updated as well as the number of sequences and total sequence characters in it. The motifs are listed by motif number. The width and subsequence which would be given the best possible score for each motif is shown. If there is more than one motif in the query, all pairwise correlations between the motifs are shown. The correlations can range from -1 to +1, with +1 meaning that the shorter motif is exactly identical to part or all of the longer motif. High correlations can cause some combined p-values and e-values to be inaccurate (too low). It may be advisable to remove enough motifs from the query to insure that no pairs of motifs have high correlations. Any high correlations are indicated along with the suggestion that one of the motifs be removed from the query.

  • High-scoring Sequences

    MAST lists the names and part of the descriptive text of all sequences whose e-value is less than E. Sequences shorter than one or more of the motifs are skipped. The sequences are sorted by increasing e-value. The value of E is set to 10 for the WEB server but is user-selectable in the down-loadable version of MAST.

  • Motif Diagrams

    Motif diagrams show the order and spacing of non-overlapping matches to the motifs in each high-scoring sequence. Motif occurrences are determined based on the position p-value of matches to the motif. Strong matches (p-value < M) are shown in square brackets (`[ ]'), weak matches (M < p-value < M × 10) are shown in angle brackets (`< >') and the length of non-motif sequence ("spacer") is shown between dashes (`-'). For example,
            27-[3]-44-<4>-99-[1]-7
    
    shows an initial spacer of length 27, followed by a strong match to motif 3, a spacer of length 44, a weak match to motif 4, a spacer of length 99, a strong match to motif 1 and a final non-motif sequence of length 7. The value of M is 0.0001 for the WEB server but is user-selectable in the down-loadable version of MAST.

  • Annotated Sequences

    MAST annotates each high-scoring sequence by printing the sequence along with the position and strength of all the non-overlapping motif occurrences. The four lines above each motif occurrence contain, respectively, The best possible match to a motif is the sequence of letters which would acheive the highest match score.

  • Sample MAST Search Results

    Here is an actual MAST search results file. It has been edited slightly to reduce its size by removing most of the 205 sequences which matched the motifs.


    
    ********************************************************************************
    MAST - Motif Alignment and Search Tool
    ********************************************************************************
    	MAST version 2.0 (Release date: 1996/10/08 22:59:45)
    
    	For further information on how to interpret these results or to get
    	a copy of the MAST software please access http://www.sdsc.edu/MEME.
    ********************************************************************************
    
    
    
    ********************************************************************************
    REFERENCE
    ********************************************************************************
    	If you use this program in your research, please cite:
    
    	Timothy L. Bailey and Charles Elkan,
    	"Fitting a mixture model by expectation maximization to discover
    	motifs in biopolymers", Proceedings of the Second International
    	Conference on Intelligent Systems for Molecular Biology, pp. 28-36,
    	AAAI Press, Menlo Park, California, 1994.
    ********************************************************************************
    
    
    
    ********************************************************************************
    DATABASE AND MOTIFS
    ********************************************************************************
    	DATABASE /users/app/tbailey/mast_databases/swissprot
    	Last updated on Wed Oct 16 01:36:08 1996
    	Database contains 52724 sequences, 18538780 residues
    
    	MOTIFS website/meme-output.html
    	MOTIF WIDTH BEST POSSIBLE MATCH
    	----- ----- -------------------
    	  1     9   VDVLVNNAG
    	  2    10   LITGCSSGIG
    	  3    13   YSASKFAVRMLTR
              3    13   YSASKFAVRMLTR
     
            PAIRWISE MOTIF CORRELATIONS:
            MOTIF     1     2
            ----- ----- -----
               2   0.39
               3   0.26  0.23
            No overly similar pairs (correlation > 0.60) found.
    ********************************************************************************
     
    
    
    
    ********************************************************************************
    EXPLANATION OF RESULTS
    ********************************************************************************
    	SECTION I:   HIGH-SCORING SEQUENCES
    			- the names of sequences containing occurrences of the
    			  motif(s)
    	SECTION II:  MOTIF DIAGRAMS
    			- the order and spacing of non-overlapping occurrences
    			  of the motif(s) in each of the high-scoring sequences
    	SECTION III: ANNOTATED SEQUENCES
    			- the high-scoring sequences annotated with the
    			  positions and strengths of the motif occurrences
    ********************************************************************************
    
    
    
    ********************************************************************************
    SECTION I: HIGH-SCORING SEQUENCES
    ********************************************************************************
    	- Each of the following 233 sequences has e-value of less than 10.
    	- The e-value of a sequence is the expected number of sequences
    	  in a random database of the same size that would match the motifs as
    	  well as the sequence does and is equal to the combined p-value of the
    	  sequence times the number of sequences in the database.
    	- The combined p-value of a sequence measures the strength of the
    	  match of the sequence to all the motifs and is calculated by
    	    o finding the score of the single best match of each motif
    	      to the sequence (best matches may overlap),
    	    o calculating the sequence p-value of each score,
    	    o forming the product of the p-values,
    	    o taking the p-value of the product.
    	- The sequence p-value of a score is defined as the
    	  probability of a random sequence of the same length containing
    	  some match with as good or better a score.
    	- The score for the match of a position in a sequence to a motif
    	  is computed by by summing the appropriate entry from each column of
    	  the position-dependent scoring matrix that represents the motif.
    	- Sequences shorter than one or more of the motifs are skipped.
    	- The table is sorted by increasing e-value.
    ********************************************************************************
    
    SEQUENCE NAME            DESCRIPTION                             E-VALUE  LENGTH
    -------------            -----------                             -------- ------
    sp|P14802|YOXD_BACSU     HYPOTHETICAL 25.3 KD PROTEIN IN RTP...   3.5e-18    238
    sp|P14061|DHB1_HUMAN     ESTRADIOL 17 BETA-DEHYDROGENASE 1 (...   7.5e-18    328
    sp|P16544|ACT3_STRCO     PUTATIVE KETOACYL REDUCTASE.             1.3e-16    261
    sp|P16542|DHK1_STRVN     GRANATICIN POLYKETIDE SYNTHASE PUTA...   1.9e-16    272
    sp|P41177|DHKR_STRCM     MONENSIN POLYKETIDE SYNTHASE PUTATI...   5.1e-16    261
    
    ...
    223 sequences omitted
    ...
    
    sp|P38786|YHM2_YEAST     HYPOTHETICAL 32.2 KD PROTEIN IN VMA...       8.5    293
    sp|P29003|BLP2_BOMOR     BOMBININ-LIKE PEPTIDE 2 (BLP-2).             8.6     27
    sp|P40397|YHXC_BACSU     HYPOTHETICAL PROTEIN IN COMK 5'REGI...         9    114
    sp|P16122|URE1_PROVU     UREASE ALPHA SUBUNIT (UREA AMIDOHYD...       9.4    567
    sp|P22716|RFBJ_SALTY     CDP-ABEQUOSE SYNTHASE (O4 ANTIGEN).          9.6    299
    
    
    
    ********************************************************************************
    SECTION II: MOTIF DIAGRAMS
    ********************************************************************************
    	- The ordering and spacing of all non-overlapping motif occurrences
    	  are shown for each high-scoring sequence listed in Section I.
    	- A motif occurrence is defined as a position in the sequence whose
    	  match to the motif has position p-value less than the value
    	  given below in the legend.
    	- The position p-value of a match is the probability of a single
    	  random subsequence of the length of the motif scoring at least as well
    	  as the observed match.
    	- For each sequence, all motif occurrences are shown unless there
    	  are overlaps.  In that case, a motif occurrence is shown only if its
    	  p-value is less than the product of the p-values of the other
    	  (lower-numbered) motif occurrences that it overlaps.
    	- The table also shows the e-value of each sequence.
    
    	LEGEND
    	----------------------------------------------------------------------
    	-d-   `d' residues separate the end of the preceding motif occurrence
    	       and the start of the following motif occurrence
    	[n]   occurrence of motif `n' with p-value less than 0.0001
    ********************************************************************************
    
    SEQUENCE NAME            E-VALUE   MOTIF DIAGRAM
    -------------            --------  -------------
    sp|P14802|YOXD_BACSU      3.5e-18  9-[2]-64-[1]-62-[3]-71
    sp|P14061|DHB1_HUMAN      7.5e-18  6-[2]-68-[1]-45-[2]-7-[3]-160
    sp|P16544|ACT3_STRCO      1.3e-16  9-[2]-64-[1]-64-[3]-92
    sp|P16542|DHK1_STRVN      1.9e-16  20-[2]-64-[1]-64-[3]-92
    sp|P41177|DHKR_STRCM      5.1e-16  9-[2]-64-[1]-64-[3]-92
    
    ...
    223 sequences omitted
    ...
    
    sp|P38786|YHM2_YEAST          8.5  246-[2]-37
    sp|P29003|BLP2_BOMOR          8.6  6-[3]-8
    sp|P40397|YHXC_BACSU            9  18-[3]-83
    sp|P16122|URE1_PROVU          9.4  65-[1]-72-[2]-411
    sp|P22716|RFBJ_SALTY          9.6  8-[2]-281
    
    
    
    ********************************************************************************
    SECTION III: ANNOTATED SEQUENCES
    ********************************************************************************
    	- The positions and p-values of the non-overlapping motif occurrences
    	  are shown above the actual sequence for each of the high-scoring
    	  sequences from Section I.
    	- A motif occurrence is defined as a position in the sequence whose
    	  match to the motif has position p-value less than 0.0001 as 
    	  defined in Section II.
    	- For each sequence, the first line specifies the name of the sequence.
    	- The second (and possibly more) lines give a description of the 
    	  sequence.
    	- Following the description line(s) is a line giving the length, 
    	  combined p-value, and e-value of the sequence as defined in Section I.
    	- The next line reproduces the motif diagram from Section II.
    	- The entire sequence is printed on the following lines.
    	- Motif occurrences are indicated directly above their positions in the
    	  sequence on four lines showing
    	   o the motif number of the occurrence,
    	   o the position p-value of the occurrence,
    	   o the best possible match to the motif, and
    	   o columns whose match to the motif has a positive score (indicated by
    	     a plus sign).
    ********************************************************************************
    
    
    sp|P14802|YOXD_BACSU    
      HYPOTHETICAL 25.3 KD PROTEIN IN RTP 5'REGION (ORF238).
      LENGTH = 238  COMBINED P-VALUE = 6.56e-23  E-VALUE =  3.5e-18
      DIAGRAM: 9-[2]-64-[1]-62-[3]-71
    
                  [2]                                                               
                  6.1e-11                                                           
                  LITGCSSGIG                                                        
                  ++++++++++                                                        
       1 MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFAAADVKDADQVNQAVA
    
                 [1]                                                                
                 3.7e-10                                                            
                 VDVLVNNAG                                                          
                 +++++++++                                                          
      76 QVKEQLGDIDILINNAGISKFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMIERKAGDIINISSTAGQRGAA
    
             [3]                                                                    
             1.4e-13                                                                
             YSASKFAVRMLTR                                                          
             ++++++++ ++++                                                          
     151 VTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKLDPR
    
     226 IFIKTAGLWSTNP
    
    
    sp|P14061|DHB1_HUMAN    
      ESTRADIOL 17 BETA-DEHYDROGENASE 1 (17-BETA-HSD 1) (PLACENTAL
      17-BETA-HYDROXYSTEROID DEHYDROGENASE) (20 ALPHA-HYDROXYSTEROID DEHYDROGENASE)
      (20-ALPHA-HSD) (E2DH).
      LENGTH = 328  COMBINED P-VALUE = 1.43e-22  E-VALUE =  7.5e-18
      DIAGRAM: 6-[2]-68-[1]-45-[2]-7-[3]-160
    
               [2]                                                                  
               5.6e-13                                                              
               LITGCSSGIG                                                           
               ++++++++++                                                           
       1 MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDSKSVAA
    
                  [1]                                                   [2]         
                  1.8e-09                                               3.7e-05     
                  VDVLVNNAG                                             LITGCSSGIG  
                  +++++ +++                                             +++++ +++   
      76 ARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGL
    
              [3]                                                                   
              2.5e-12                                                               
              YSASKFAVRMLTR                                                         
              +++++++++++++                                                         
     151 PFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQ
    
     226 VFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
     301 GAGPGAEDEAGRSAVGDPELGDPPAAPQ
    
    
    sp|P16544|ACT3_STRCO    
      PUTATIVE KETOACYL REDUCTASE.
      LENGTH = 261  COMBINED P-VALUE = 2.46e-21  E-VALUE =  1.3e-16
      DIAGRAM: 9-[2]-64-[1]-64-[3]-92
    
                  [2]                                                               
                  5.2e-10                                                           
                  LITGCSSGIG                                                        
                  +++++ ++++                                                        
       1 MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVA
    
                 [1]                                                                
                 1.4e-11                                                            
                 VDVLVNNAG                                                          
                 +++++++++                                                          
      76 AVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGTGRIVNIASTGGKQG
    
               [3]                                                                  
               1.4e-11                                                              
               YSASKFAVRMLTR                                                        
               +++++++++++++                                                        
     151 VVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEVSTEEAFDRITARVPIGR
    
     226 YVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGNY
    
    
    sp|P16542|DHK1_STRVN    
      GRANATICIN POLYKETIDE SYNTHASE PUTATIVE KETOACYL REDUCTASE 1 (ORF5).
      LENGTH = 272  COMBINED P-VALUE = 3.69e-21  E-VALUE =  1.9e-16
      DIAGRAM: 20-[2]-64-[1]-64-[3]-92
    
                             [2]                                                    
                             5.2e-10                                                
                             LITGCSSGIG                                             
                             +++++ ++++                                             
       1 MTTATATATATPGTAAKPVALVTGATSGIGLAIARRLAALGARTFLCARDEERLAQTVKELRGEGFDVDGTVCDV
    
                            [1]                                                     
                            4.5e-11                                                 
                            VDVLVNNAG                                               
                            +++++++++                                               
      76 ADPAQIRAYVAAAVQRYGTVDILVNNAGRSGGGATAEIADELWLDVITTNLTSVFLMTKEVLNAGGMLAKKRGRI
    
                          [3]                                                       
                          5.8e-12                                                   
                          YSASKFAVRMLTR                                             
                          +++++++++++++                                             
     151 INIASTGGKQGVVHAVPYSASKHGVVGLTKALGLELARTGITVNAVCPGFVETPMAERVREHYAGIWQVSEEETF
    
     226 DRITNRVPLGRYVETREVAAMVEYLVADDAAAVTAQALNVCGGLGNY
    
    
    sp|P41177|DHKR_STRCM
      MONENSIN POLYKETIDE SYNTHASE PUTATIVE KETOACYL REDUCTASE (ORF5).
      LENGTH = 261  COMBINED P-VALUE = 9.75e-21  E-VALUE =  5.1e-16
      DIAGRAM: 9-[2]-64-[1]-64-[3]-92
     
                  [2]
                  5.2e-10
                  LITGCSSGIG
                  +++++ ++++
       1 MTQSTSRVALVTGATSGIGLATARLLAAQGHLVFLGARTESDVIATVKALRNDGLEAEGQVLDVRDGASVTAFVQ
     
                 [1]
                 5.6e-11
                 VDVLVNNAG
                 +++++++++
      76 AAVDRYGRIDVLVNNAGRSGGGVTADLTDELWDDVIDTNLNSVFRMTRAVLTTGGMRTRERGRIINVASTAGKQG
     
               [3]
               1.4e-11
               YSASKFAVRMLTR
               +++++++++++++
     151 VVLGAPYSASKHGVVGFTKALGNELAPTGITVNAVCPGYVETPMAQRVRQGYAAAYDTTEEAILTKFQAKIPLGR
     
     226 YSTPEEVAGLIGYLASDTAASITSQALNVCGGLGNF
    
    ...
    223 sequences omitted
    ...
    
    sp|P38786|YHM2_YEAST    
      HYPOTHETICAL 32.2 KD PROTEIN IN VMA22-SSF1 INTERGENIC REGION.
      LENGTH = 293  COMBINED P-VALUE = 1.60e-04  E-VALUE =      8.5
      DIAGRAM: 246-[2]-37
    
       1 MLVDLNVPWPQNSYADKVTSQAVNNLIKTLSTLHMLGYTHIAINFTVNHSEKFPNDVKLLNPIDIKRRFGELMDR
      76 TGLKLYSRITLIIDDPSKGQSLSKISQAFDIVAALPISEKGLTLSTTNLDIDLLTFQYGSRLPTFLKHKSICSCV
     151 NRGVKLEIVYGYALRDVQARRQFVSNVRSVIRSSRSRGIVIGSGAMSPLECRNILGVTSLIKNLGLPSDRCSKAM
    
                              [2]                                            
                              4.5e-08                                        
                              LITGCSSGIG                                     
                              ++++++++ +                                     
     226 GDLASLVLLNGRLRNKSHKQTIVTGGGSGNGDDVVNDVQGIDDVQTIKVVKRSMDAEQLGHASKRHKP
    
    
    sp|P29003|BLP2_BOMOR    
      BOMBININ-LIKE PEPTIDE 2 (BLP-2).
      LENGTH = 27  COMBINED P-VALUE = 1.62e-04  E-VALUE =      8.6
      DIAGRAM: 6-[3]-8
    
               [3]                  
               1.9e-05              
               YSASKFAVRMLTR        
                ++ + +++++ +        
       1 GIGSAILSAGKSALKGLAKGLAEHFAN
    
    
    sp|P40397|YHXC_BACSU    
      HYPOTHETICAL PROTEIN IN COMK 5'REGION (ORFX).
      LENGTH = 114  COMBINED P-VALUE = 1.70e-04  E-VALUE =        9
      DIAGRAM: 18-[3]-83
    
                           [3]                                                      
                           4.3e-08                                                  
                           YSASKFAVRMLTR                                            
                           ++++++ ++ +++                                            
       1 IINTASITAYKGNKTLIDYSATKGRIVTFTRSLSQSLVQQGIRVNAVAPGPIWTPLIPASFAAKDVEVFGSDVPM
    
      76 ERPGQPVEVAPSYLYLASDDSTYVTGQTIHVNGGTIVNG
    
    
    sp|P16122|URE1_PROVU    
      UREASE ALPHA SUBUNIT (UREA AMIDOHYDROLASE).
      LENGTH = 567  COMBINED P-VALUE = 1.79e-04  E-VALUE =      9.4
      DIAGRAM: 65-[1]-72-[2]-411
    
                                                                          [1]       
                                                                          2.0e-06   
                                                                          VDVLVNNAG 
                                                                          +++++ ++  
       1 MKTISRQAYADMFGPTTGDRLRLADTELFLEIEQDFTTYGEEVKFGGGKVIRDGMGQSQVVSAECVDVLITNAII
    
                                                                                [2] 
                                                                                4.4e
                                                                                LITG
                                                                                ++ +
      76 IDHWGIVKADIGIKDGRITGIGKAGNPDVQPNVDIVIGPGTEVVAGEGKIITAGGVDTHIHFICPQQAEEGLISG
    
                                                                                    
         -06                                                                        
         CSSGIG                                                                     
             ++                                                                     
     151 VTTFIGGGTGPVAGTNATTVTPGIWNMHRMLEAVDELPINVGLFGKGCVSQPEAIREQIEAGAIGLKIHEDWGAT
    
     226 PMAIHNCLNVADEMDVQVAIHSDTLNEGGFYEETVKAIAGRVIHVFHTEGAGGGHAPDVIKSVGEPNILPASTNP
     301 TMPYTINTVDEHLDMLMVCHHLDPSIPEDVAFAESRIRRETIAAEDILHDMGAISVMSSDSQAMGRVGEVVMRTW
     376 QCAHKMKLQRGSLAGDTAENDNNRIKRYIAKYTINPALAHGIAHEVGSIEKGKLADIVLWDPAFFGVKPALIMKG
     451 GMVAYAPMGDINAAIPTPQPVHYRPMYACLGKAKYQTSMIFMSKAGIDAGVPEKLGLQSLIGRVEGCRKVTKASM
     526 IHNSYVPHIELEPQTYIVKADGVPLVCEPATELPMAQRYFLF
    
    
    sp|P22716|RFBJ_SALTY    
      CDP-ABEQUOSE SYNTHASE (O4 ANTIGEN).
      LENGTH = 299  COMBINED P-VALUE = 1.83e-04  E-VALUE =      9.6
      DIAGRAM: 8-[2]-281
    
                 [2]                                                                
                 1.8e-07                                                            
                 LITGCSSGIG                                                         
                 ++ ++++ ++                                                         
       1 MTFLKEYVIVSGASGFIGKHLLEALKKSGISVVAITRDVIKNNSNALANVRWCSWDNIELLVEELSIDSALIGII
    
      76 HLATEYGHKTSSLINIEDANVIKPLKLLDLAIKYRADIFLNTDSFFAKKDFNYQHMRPYIITKRHFDEIGHYYAN
     151 MHDISFVNMRLEHVYGPGDGENKFIPYIIDCLNKKQSCVKCTTGEQIRDFIFVDDVVNAYLTILENRKEVPSYTE
     226 YQVGTGAGVSLKDFLVYLQNTMMPGSSSIFEFGAIEQRDNEIMFSVANNKNLKAMGWKPNFDYKKGIEELLKRL
    
    CPU: tomten
    Time 53.747613 secs.
    
    /misc/www/projects/MEME/dev/meme.2.0.d/bin/sunsparcsolaris/mast mast.logodds.13734.tmp /users/app/tbailey/mast_databases/swissprot ACDEFGHIKLMNPQRSTVWY -mf website/meme-output.html