blastx_gbnr_files/1176818_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1176818
        (407 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|e329378      (AJ000079) glycosylphosphatidylin... +2   558  2.9e-53   1
A sp|P09194|PHLC_TRYBB VARIANT-SURFACE-GLYCOPROTEIN PHOS... +2   314  2.1e-27   1
A pir||A31254          variant-surface-glycoprotein phos... +2   310  5.5e-27   1
A bbs|83340            glycosylphosphatidylinositol-spec... +2   112  5.2e-06   1
A sp|P45723|PLC_STAAU  1-PHOSPHATIDYLINOSITOL PHOSPHODIE... +2    77  0.99      1
A gnl|PID|e1247231     (Z92839) T08D2.g [Caenorhabditis ... +3    58  0.99      1
A pir||S22148          hypothetical protein - white lupine  -1    56  0.9995    1
A gnl|PID|e40678       (X61713) hypothetical protein [Lu... -1    56  0.9995    1



>gnl|PID|e329378 (AJ000079) glycosylphosphatidylinositol-specific phospholipase
            C [Trypanosoma cruzi]
            Length = 380

  Plus Strand HSPs:

 Score = 558 (196.4 bits), Expect = 2.9e-53, P = 2.9e-53
 Identities = 109/133 (81%), Positives = 117/133 (87%), Frame = +2

Query:     5 RFFFRGICASWSKCQGMSVRAQLDYGVRYLDLRVGTXP*DASRLYISHTQISVPLADVIE 184
             RF FRGICASWS+CQ MSVRAQL++GVRYLD+RV T P DASRLY  H QISVPLADV+E
Sbjct:    72 RFLFRGICASWSRCQWMSVRAQLNHGVRYLDMRVATNPEDASRLYTLHHQISVPLADVLE 131

Query:   185 DVKAFLNDPSSANEFIVLDFQHLYLTDDSDGKGKFLGELDRLSDRFILVNVPLTTPXEIL 364
             DVKAFLNDP SA+EFIVLDFQHLYLTDDSDGKGKF  ELDRLSDRFI V+VPLTTP E L
Sbjct:   132 DVKAFLNDPLSADEFIVLDFQHLYLTDDSDGKGKFFRELDRLSDRFIPVDVPLTTPLEFL 191

Query:   365 WKVSSRRXIFLVV 403
             W+ SSRR IFLVV
Sbjct:   192 WRASSRRRIFLVV 204


>sp|P09194|PHLC_TRYBB VARIANT-SURFACE-GLYCOPROTEIN PHOSPHOLIPASE C (VSG LIPASE)
            >pir||S03389 phospholipase C (EC 3.1.4.3) - Trypanosoma brucei
            >gi|10433 (X13292) GPI-phospholipase C (AA 1 - 358) [Trypanosoma
            brucei] >gnl|PID|e329381 (AJ000080)
            glycosylphosphatidylinositol-specific phospholipase C [Trypanosoma
            brucei]
            Length = 358

  Plus Strand HSPs:

 Score = 314 (110.5 bits), Expect = 2.1e-27, P = 2.1e-27
 Identities = 64/133 (48%), Positives = 89/133 (66%), Frame = +2

Query:     5 RFFFRGICASWSKCQGMSVRAQLDYGVRYLDLRVGTXP*DASRLYISHTQISVPLADVIE 184
             RF   G+ + W +CQ +S+R  LD+GVRYLDLR+   P   +++Y +H  ISVPL +V++
Sbjct:    67 RFLTVGVSSRWGRCQNLSIRQLLDHGVRYLDLRMNISPDQENKIYTTHFHISVPLQEVLK 126

Query:   185 DVKAFLNDPSSANEFIVLDFQHLYLTDDSDGKGKFLGELDRLSDRFILVNVPLTTPXEIL 364
             DVK FL  P+SANEF++LDF H Y  ++S    +F+ EL  L + +I   V LTTP   L
Sbjct:   127 DVKDFLTTPASANEFVILDFLHFYGFNESHTMKRFVEELQALEEFYIPTTVSLTTPLCNL 186

Query:   365 WKVSSRRXIFLVV 403
             W+ S+RR IFLVV
Sbjct:   187 WQ-STRR-IFLVV 197


>pir||A31254 variant-surface-glycoprotein phospholipase C (EC 3.1.4.47) -
            Trypanosoma brucei >gi|162217 (J04124) phospholipase C [Trypanosoma
            brucei]
            Length = 358

  Plus Strand HSPs:

 Score = 310 (109.1 bits), Expect = 5.5e-27, P = 5.5e-27
 Identities = 63/133 (47%), Positives = 88/133 (66%), Frame = +2

Query:     5 RFFFRGICASWSKCQGMSVRAQLDYGVRYLDLRVGTXP*DASRLYISHTQISVPLADVIE 184
             RF   G+ + W +CQ +S+R  LD+GVRYLDLR+   P   +++Y +H  ISVPL +V++
Sbjct:    67 RFLTVGVSSRWGRCQNLSIRQLLDHGVRYLDLRMNVSPDQENKIYTTHFHISVPLQEVLK 126

Query:   185 DVKAFLNDPSSANEFIVLDFQHLYLTDDSDGKGKFLGELDRLSDRFILVNVPLTTPXEIL 364
             DVK FL  P+SANEF++LDF H Y  ++     +F+ EL  L + +I   V LTTP   L
Sbjct:   127 DVKDFLTTPASANEFVILDFLHFYGFNERHTMKRFVEELQALEEFYIPTTVSLTTPLCNL 186

Query:   365 WKVSSRRXIFLVV 403
             W+ S+RR IFLVV
Sbjct:   187 WQ-SNRR-IFLVV 197


>bbs|83340 glycosylphosphatidylinositol-specific phospholipase C, GPI-PLC
           [Trypanosoma brucei, Peptide Partial, 107 aa, segment 1 of 2]
           Length = 107

  Plus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 5.2e-06, P = 5.2e-06
 Identities = 19/38 (50%), Positives = 26/38 (68%), Frame = +2

Query:     5 RFFFRGICASWSKCQGMSVRAQLDYGVRYLDLRVGTXP 118
             RF   G+ + W +CQ +S+R  LD+GVRYLDLR+   P
Sbjct:    67 RFLTVGVSSRWGRCQNLSIRQLLDHGVRYLDLRMNISP 104


>sp|P45723|PLC_STAAU 1-PHOSPHATIDYLINOSITOL PHOSPHODIESTERASE PRECURSOR
            (PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C) (PI-PLC) >gi|425478
            (L19298) phosphatidylinositol-specific phospholipase C
            [Staphylococcus aureus]
            Length = 311

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 4.5, P = 0.99
 Identities = 25/82 (30%), Positives = 41/82 (50%), Frame = +2

Query:    35 WSKCQGMSVRAQLDYGVRYLDLRVGTXP*DASRLYISHTQISV--PLADVIEDVKAFLND 208
             W+K Q      Q+  GVR+ D+R G    D + + + H  + +   L   ++D K +L+ 
Sbjct:    55 WAKTQDKDYLTQMKSGVRFFDIR-GRASAD-NMISVHHGMVYLHHELGKFLDDAKYYLS- 111

Query:   209 PSSANEFIVLDFQHLYLTDDSDGK 280
              +  NE IV+  +  Y   DSD K
Sbjct:   112 -AYPNETIVMSMKKDY---DSDSK 131


>gnl|PID|e1247231 (Z92839) T08D2.g [Caenorhabditis elegans]
            Length = 78

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 4.5, P = 0.99
 Identities = 11/23 (47%), Positives = 16/23 (69%), Frame = +3

Query:   243 FNTYISRMTVTGRVSFLGSWTAF 311
             F+ Y++R+  TGR  F G+ TAF
Sbjct:     7 FDEYVNRIGRTGRAGFTGTSTAF 29


>pir||S22148 hypothetical protein - white lupine
            Length = 60

  Minus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 7.5, P = 1.0
 Identities = 14/37 (37%), Positives = 19/37 (51%), Frame = -1

Query:   107 PRAGPDSAHRSPAARVQTSLDTLTKM--HRSREKRSV 3
             P  GP +  R  A+R QTSL     +  H  R+ RS+
Sbjct:    16 PLRGPHNVRRCSASRCQTSLVPFNSLMVHECRDLRSL 52


>gnl|PID|e40678 (X61713) hypothetical protein [Lupinus albus]
            Length = 60

  Minus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 7.5, P = 1.0
 Identities = 14/37 (37%), Positives = 19/37 (51%), Frame = -1

Query:   107 PRAGPDSAHRSPAARVQTSLDTLTKM--HRSREKRSV 3
             P  GP +  R  A+R QTSL     +  H  R+ RS+
Sbjct:    16 PLRGPHNVRRCSASRCQTSLVPFNSLMVHECRDLRSL 52


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.98
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.345   0.144   0.572  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.329   0.144   0.440  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.350   0.156   0.566  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.341   0.147   0.522  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.351   0.157   0.533  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.336   0.141   0.438  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      135       133       10.  70 3 1000 22  0.11    33
                                                     30  0.097   36
   +2      0      135       132       10.  70 3 1000 22  0.11    33
                                                     30  0.096   36
   +1      0      135       133       10.  70 3 1000 22  0.11    33
                                                     30  0.097   36
   -1      0      135       132       10.  70 3 1000 22  0.11    33
                                                     30  0.096   36
   -2      0      135       132       10.  70 3 1000 22  0.11    33
                                                     30  0.096   36
   -3      0      135       133       10.  70 3 1000 22  0.11    33
                                                     30  0.097   36


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  8
  No. of states in DFA:  369 (37 KB)
  Total size of DFA:  46 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.01s 0.01t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  29.31u 1.13s 30.44t  Elapsed: 00:00:06
  Total cpu time:  29.34u 1.86s 31.20t  Elapsed: 00:00:07
  Start:  Thu Sep 24 15:15:32 1998   End:  Thu Sep 24 15:15:39 1998

Date: 17:22:38 on Mon 18 Dec 117.