blastx_gbnr_files/1200243_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1200243
        (607 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A sp|Q07785|CC2H_PLAFK CELL DIVISION CONTROL PROTEIN 2 H... +3   436  3.0e-68   2
A gnl|PID|e251152      (X98768) cdc2-like kinase [Theile... +3   375  1.3e-57   2
A gnl|PID|e251627      (X98824) cdec2-related kinase [Th... +3   370  4.3e-57   2
A gnl|PID|e333558      (AJ001085) putative 34kDa cdc2-re... +3   345  6.2e-54   2
A sp|P34117|CC2H_DICDI CDC2-LIKE SERINE/THREONINE-PROTEI... +3   343  3.0e-52   2
A gi|1658064           (U74762) cdc2-related protein kin... +3   339  3.0e-48   2
A gnl|PID|d1022523     (AB006033) cdc2 kinase [Allium cepa] +3   340  3.8e-48   2
A pir||A40444          protein kinase (EC 2.7.1.37) cdc2... +3   344  1.3e-47   2
A sp|P23111|CC2_MAIZE  CELL DIVISION CONTROL PROTEIN 2 H... +3   344  1.3e-47   2
A pir||S42049          protein kinase (EC 2.7.1.37) cdc2... +3   343  1.3e-47   2
A gi|530748            (X80845) cdc2Pnc gene product [Pi... +3   343  1.3e-47   2
A sp|P29618|CC21_ORYSA CELL DIVISION CONTROL PROTEIN 2 H... +3   344  1.6e-47   2
A pir||B40444          protein kinase (EC 2.7.1.37) cdc2... +3   342  2.1e-47   2
A sp|P54664|CC21_TRYCO CELL DIVISION CONTROL PROTEIN 2 H... +3   337  2.6e-47   2
A pir||JQ2243          protein kinase (EC 2.7.1.37) cdc2... +3   344  3.3e-47   2
A gnl|PID|e242615      (X97637) cyclin-dependent kinase ... +3   341  4.2e-47   2
A gnl|PID|e290217      (Y10160) cyclin dependent kinase ... +3   339  4.2e-47   2
A pir||S57928          protein kinase (EC 2.7.1.37) cdc2... +3   342  5.4e-47   2
A sp|P52389|CC2_VIGUN  CELL DIVISION CONTROL PROTEIN 2 H... +3   342  5.4e-47   2
A pir||A37871          protein kinase (EC 2.7.1.37) cdk2... +3   317  6.9e-47   2
A sp|P23437|CDK2_XENLA CELL DIVISION PROTEIN KINASE 2 (C... +3   317  6.9e-47   2
A gnl|PID|e251272      (Z75661) cdc2 kinase homologue [S... +3   340  8.8e-47   2
A gi|2564701           (AF026546) Cdc2 cyclin-dependent ... +3   325  8.8e-47   2
A gi|2564703           (AF026545) Cdc2 cyclin-dependent ... +3   325  8.8e-47   2
A gi|1196796           (L34206) protein kinase p34cdc2 [... +3   337  1.1e-46   2
A sp|P29619|CC22_ORYSA CELL DIVISION CONTROL PROTEIN 2 H... +3   331  1.1e-46   2
A sp|P04551|CC2_SCHPO  CELL DIVISION CONTROL PROTEIN 2 (... +3   327  2.3e-46   2
A sp|Q05006|CC22_MEDSA CELL DIVISION CONTROL PROTEIN 2 H... +3   338  2.9e-46   2
A gnl|PID|e242658      (X97638) cyclin-dependent kinase ... +3   336  2.9e-46   2
A gnl|PID|d1010011     (D50738) cdc2 homolog [Nicotiana ... +3   333  2.9e-46   2
A sp|Q06309|CRK1_LEIME CELL DIVISION PROTEIN KINASE 2 HO... +3   322  2.9e-46   2
A pdb|1JST|A           Homo sapiens >pdb|1JST|C Homo sap... +3   314  2.9e-46   2
A sp|P38973|CC21_TRYBB CELL DIVISION CONTROL PROTEIN 2 H... +3   321  4.8e-46   2
A gi|1377888           (L77082) cdc2 gene product [Nicot... +3   330  6.1e-46   2
A sp|P24923|CC21_MEDSA CELL DIVISION CONTROL PROTEIN 2 H... +3   330  9.9e-46   2
A gi|1236190           (U18365) cyclin dependent protein... +3   329  2.6e-45   2
A gi|1377890           (L77083) cdc2 gene product [Nicot... +3   322  4.2e-45   2
A sp|P24100|CC2A_ARATH CELL DIVISION CONTROL PROTEIN 2 H... +3   320  6.8e-45   2
A gnl|PID|e321536      (Y13646) cyclin dependent kinase ... +3   333  1.4e-44   2
A gi|727249            (U15802) CDC2 [Paramecium tetraur... +3   300  9.8e-44   2
A pir||S53538          protein kinase (EC 2.7.1.37) cdc2... +3   300  9.8e-44   2
A gnl|PID|e325272      (Z82059) T27E9.3 [Caenorhabditis ... +3   289  4.2e-43   2
A pir||S23384          protein kinase (EC 2.7.1.37) cdc2... +3   280  9.6e-42   2
A sp|Q07002|KPT3_HUMAN SERINE/THREONINE PROTEIN KINASE P... +3   258  9.7e-42   2
A sp|Q04899|KPT3_MOUSE SERINE/THREONINE-PROTEIN KINASE P... +3   268  1.2e-41   2
A dbj||AB005540_1      (AB005540) PCTAIRE2 [Rattus rattus]  +3   280  1.2e-41   2
A gnl|PID|e255553      (X99512) serine/threonine protein... +3   281  1.2e-41   2
A gnl|PID|d1022319     (AB005541) PCTAIRE3 [Rattus rattus]  +3   268  1.5e-41   2
A sp|Q00537|KPT2_HUMAN SERINE/THREONINE-PROTEIN KINASE P... +3   274  4.6e-41   2
A sp|Q00536|KPT1_HUMAN SERINE/THREONINE-PROTEIN KINASE P... +3   275  8.0e-41   2
A sp|Q04735|KPT1_MOUSE SERINE/THREONINE-PROTEIN KINASE P... +3   275  8.0e-41   2
A gi|2392814           (U62391) PFTAIRE kinase [Mus musc... +3   269  5.3e-40   2
A pir||JC5111          cyclin-dependent kinase-related p... +3   259  7.9e-39   2
A pir||JC5110          cyclin-dependent kinase-related p... +3   259  1.4e-38   2
A gi|1326380           (U58751) coded for by C. elegans ... +3   237  9.8e-37   2
A pir||A38282          p58 galactosyltransferase-associa... +3   279  2.3e-36   2
A gi|189481            (M37712) p58/GTA protein kinase [... +3   279  2.7e-36   2
A gi|507158            (U04815) PITSLRE alpha 1 [Homo sa... +3   279  5.0e-36   2
A sp|P21127|KP58_HUMAN GALACTOSYLTRANSFERASE ASSOCIATED ... +3   273  1.3e-35   2
A pir||A42823          cell division control-related pro... +3   273  1.5e-35   2
A gi|189496            (M88565) p58 protein kinase [Homo... +3   273  1.8e-35   2
A gi|507166            (U04819) PITSLRE beta 1 [Homo sap... +3   272  2.0e-35   2
A sp|P46892|KP58_RAT   GALACTOSYLTRANSFERASE ASSOCIATED ... +3   271  2.4e-35   2
A gi|507164            (U04818) PITSLRE alpha 2-4 [Homo ... +3   279  2.4e-35   2
A pir||S47430          protein kinase (EC 2.7.1.37) cdc2... +3   343  2.5e-35   2
A gi|1129065           (L24388) galactosyltransferase-as... +3   271  2.5e-35   2
A sp|P24788|KP58_MOUSE GALACTOSYLTRANSFERASE ASSOCIATED ... +3   269  4.0e-35   2
A pir||A53227          galactosyltransferase-associated ... +3   269  4.2e-35   2
A pir||A54024          protein kinase (EC 2.7.1.37) cdc2... +3   270  5.8e-35   2
A pir||I50463          protein kinase - chicken >gi|5714... +3   280  6.8e-35   2
A gi|507162            (U04817) PITSLRE alpha 2-3 [Homo ... +3   279  1.1e-34   2
A gi|507160            (U04816) PITSLRE alpha 2-2 [Homo ... +3   279  1.1e-34   2
A gi|507168            (U04824) PITSLRE alpha 2-1 [Homo ... +3   279  1.1e-34   2
A sp|P29620|KC47_ORYSA CDC2+/CDC28-RELATED PROTEIN KINAS... +3   242  1.2e-34   2
A sp|P50613|CDK7_HUMAN CELL DIVISION PROTEIN KINASE 7 (C... +3   255  1.3e-34   2
A sp|Q03147|CDK7_MOUSE CELL DIVISION PROTEIN KINASE 7 (C... +3   255  1.3e-34   2
A gnl|PID|e318801      (Y13120) serine/threonine protein... +3   255  1.3e-34   2
A pir||A55817          cyclin-dependent kinase p130-PITS... +3   277  1.5e-34   2
A pir||S34652          cell division cycle-2-related pro... +3   255  1.7e-34   2
A bbs|171000           (S79590) Mo15=putative protein ki... +3   242  3.5e-34   2
A sp|P54685|CDK7_DICDI CELL DIVISION PROTEIN KINASE 7 (C... +3   242  3.5e-34   2
A pir||F54024          protein kinase (EC 2.7.1.37) cdc2... +3   273  5.0e-34   2
A pir||G54024          protein kinase (EC 2.7.1.37) cdc2... +3   272  6.1e-34   2
A pir||H54024          protein kinase (EC 2.7.1.37) cdc2... +3   272  6.2e-34   2
A gi|507429            (U07705) PITSLRE isoform PBETA22 ... +3   272  6.4e-34   2
A gi|507427            (U07704) PITSLRE isoform PBETA21 ... +3   272  6.5e-34   2
A pir||S51085          CdK-activating kinase Cdk7 - rat ... +3   247  9.2e-34   2
A sp|P51952|CDK7_RAT   CELL DIVISION PROTEIN KINASE 7 (C... +3   247  9.2e-34   2
A pir||E54024          protein kinase (EC 2.7.1.37) cdc2... +3   270  1.1e-33   2
A pir||B54024          protein kinase (EC 2.7.1.37) cdc2... +3   269  1.4e-33   2
A gnl|PID|e330421      (Z92847) H01G02.2 [Caenorhabditis... +3   255  1.9e-33   2
A gi|1303658           (L77991) cyclin-dependent kinase ... +3   224  2.4e-33   2
A gi|1695919           (U73195) MO15-related protein kin... +3   246  1.3e-32   2
A gnl|PID|e292745      (X97314) cdc2MsC [Medicago sativa]   +3   234  2.3e-32   2
A sp|Q00534|CDK6_HUMAN CELL DIVISION PROTEIN KINASE 6 (K... +3   213  4.2e-32   2
A pir||S66145          Cdk-activating protein kinase (EC... +3   224  7.1e-32   2
A sp|P06242|KI28_YEAST SERINE/THREONINE-PROTEIN KINASE K... +3   219  2.4e-31   2
A gnl|PID|e255552      (X99510) CDK4/6 kinase [Drosophil... +3   213  3.0e-31   2
A gi|496090            (L33264) CDC2-related kinase [Hom... +3   240  6.2e-31   2
A sp|Q09437|YP62_CAEEL PUTATIVE SERINE/THREONINE-PROTEIN... +3   246  6.3e-31   2
A pir||S49330          serine/threonine kinase pisslre -... +3   240  6.5e-31   2
A pir||S57926          protein kinase (EC 2.7.1.37) cdk4... +3   222  1.0e-30   2
A sp|Q01917|CC2H_CRIFA CELL DIVISION CONTROL PROTEIN 2 H... +3   250  2.0e-30   3
A sp|P11802|CDK4_HUMAN CELL DIVISION PROTEIN KINASE 4 (P... +3   216  3.4e-30   2
A sp|P35426|CDK4_RAT   CELL DIVISION PROTEIN KINASE 4 (P... +3   216  3.4e-30   2
A sp|P30285|CDK4_MOUSE CELL DIVISION PROTEIN KINASE 4 (P... +3   216  3.4e-30   2
A pir||S52841          protein kinase (EC 2.7.1.37) cdk4... +3   216  3.4e-30   2
A gi|1710234           (U79269) cyclin dependent protein... +3   216  3.4e-30   2
A gi|2209290           (U81031) CDK4 [Homo sapiens]         +3   216  3.4e-30   2
A gi|1763059           (U68478) cyclin-dependent kinase ... +3   216  6.9e-30   2
A sp|P43063|CC28_CANAL CELL DIVISION CONTROL PROTEIN 28 ... +3   336  8.0e-30   1
A gnl|PID|d1022237     (AB004534) cdc2 kinase homologue ... +3   225  2.1e-29   2
A sp||ERK1_MOUSE_2     [Segment 2 of 2] EXTRACELLULAR SI... +3   197  4.4e-29   2
A dbj||D87271_1        (D87271) ERK2 [Mus musculus]         +3   197  6.1e-29   2
A sp|Q00526|CDK3_HUMAN CELL DIVISION PROTEIN KINASE 3 >p... +3   325  1.2e-28   1
A gi|29849             (X61622) cell division kinase. CD... +3   324  1.5e-28   1
A gnl|PID|d1012143     (D79982) cdc2 [Asterina pectinifera] +3   324  1.5e-28   1
A gnl|PID|e49056       (Z11696) 44kDa protein kinase [Ho... +3   197  2.5e-28   2
A pir||PQ0270          extracellular signal-regulated ki... +3   197  3.2e-28   2
A gi|515499            (U12008) microtubule-associated p... +3   197  3.2e-28   2
A pir||A60041          Ca2+/calmodulin-dependent protein... +3   197  3.4e-28   2
A gi|23879             (Z11695) 40kDa protein kinase [Ho... +3   197  3.4e-28   2
A gi|204054            (M61177) extracellular-signal-reg... +3   197  3.7e-28   2
A pir||S28184          Ca2+/calmodulin-dependent protein... +3   197  3.9e-28   2
A sp|P43450|CDK2_CARAU CELL DIVISION PROTEIN KINASE 2 >p... +3   320  3.9e-28   1
A sp|P00546|CC28_YEAST CELL DIVISION CONTROL PROTEIN 28 ... +3   320  3.9e-28   1
A sp|P27361|ERK1_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +3   197  4.1e-28   2
A sp|P21708|ERK1_RAT   EXTRACELLULAR SIGNAL-REGULATED KI... +3   197  4.1e-28   2
A sp|Q03957|CTK1_YEAST CTD KINASE ALPHA SUBUNIT (CTD KIN... +3   210  4.5e-28   2
A sp|P46196|ERK2_BOVIN EXTRACELLULAR SIGNAL-REGULATED KI... +3   197  4.5e-28   2
A pir||S23427          protein kinase, 41K (EC 2.7.1.-) ... +3   197  4.5e-28   2
A sp|P28482|ERK2_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +3   197  4.5e-28   2
A pir||A39754          mitogen-activated protein kinase ... +3   197  4.6e-28   2
A sp|P26696|ERK2_XENLA MITOGEN-ACTIVATED PROTEIN KINASE ... +3   197  4.6e-28   2
A gi|64894             (X59813) MAP kinase [Xenopus laevis] +3   197  4.6e-28   2
A pdb|1GOL|            Coordinates Of Rat Map Kinase Erk... +3   197  4.9e-28   2
A pdb|1ERK|            Structure Of Signal-Regulated Kin... +3   197  4.9e-28   2
A gnl|PID|d1006498     (D28753) cyclin dependent kinase ... +3   319  5.0e-28   1
A sp|P48963|CDK2_MESAU CELL DIVISION PROTEIN KINASE 2 >g... +3   319  5.0e-28   1
A gi|1695880           (U63337) cyclin-dependent kinase-... +3   319  5.0e-28   1
A sp|P24941|CDK2_HUMAN CELL DIVISION PROTEIN KINASE 2 (P... +3   319  5.0e-28   1
A gi|312803            (X62071) cdk2 gene product [Homo ... +3   319  5.0e-28   1
A gi|1517820           (U35146) p56 KKIAMRE protein kina... +3   193  5.2e-28   2
A sp|P40417|ERKA_DROME MITOGEN-ACTIVATED PROTEIN KINASE ... +3   194  6.8e-28   2
A pir||A38197          protein kinase (EC 2.7.1.37) cdc2... +3   190  8.3e-28   2
A gi|180492            (M80629) cdc2-related protein kin... +3   190  8.3e-28   2
A gi|1110512           (U40484) MAP kinase [Aplysia cali... +3   194  8.5e-28   2
A pir||S56638          mitogen-activated protein kinase ... +3   194  9.7e-28   2
A gnl|PID|d1010243     (D61377) WIPK [Nicotiana tabacum]    +3   181  1.1e-27   2
A sp|P23293|SGV1_YEAST SERINE/THREONINE PROTEIN KINASE S... +3   212  1.3e-27   2
A gi|2465400           (AF020316) MAP kinase Mps1 [Magna... +3   191  1.6e-27   2
A pir||A48082          mitogen-activated protein kinase ... +3   197  1.7e-27   2
A pir||JX0296          protein kinase (EC 2.7.1.37) cdc2... +3   210  1.9e-27   2
A pir||A36978          MAP kinase mpk-1 (EC 2.7.1.-) - C... +3   192  2.3e-27   2
A sp|Q40532|NTF4_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE ... +3   187  2.7e-27   2
A sp|P35567|CC21_XENLA CELL DIVISION CONTROL PROTEIN 2 H... +3   312  2.8e-27   1
A prf||2005165A        cdc2 protein [Xenopus laevis]        +3   312  2.8e-27   1
A sp|P51958|CC2_CARAU  CELL DIVISION CONTROL PROTEIN 2 H... +3   312  2.8e-27   1
A sp|P24033|CC22_XENLA CELL DIVISION CONTROL PROTEIN 2 H... +3   312  2.8e-27   1
A gi|2589145           (D82878) p34cdc2 [Hemicentrotus p... +3   312  2.8e-27   1
A sp|Q39023|MPK3_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +3   191  2.8e-27   2
A gi|1136798           (U19775) Mxi2 [Homo sapiens] >prf... +3   191  2.9e-27   2
A gnl|PID|e286194      (Z83731) M04C9.5 [Caenorhabditis ... +3   220  3.5e-27   2
A sp|P39951|CC2_RAT    CELL DIVISION CONTROL PROTEIN 2 H... +3   311  3.6e-27   1
A sp|P06493|CC2_HUMAN  CELL DIVISION CONTROL PROTEIN 2 H... +3   311  3.6e-27   1
A sp|P11440|CC2_MOUSE  CELL DIVISION CONTROL PROTEIN 2 H... +3   311  3.6e-27   1
A gi|1575290           (U58633) p34 cdc2 kinase [Mus mus... +3   311  3.6e-27   1
A pir||A47211          protein kinase ERK (EC 2.7.1.-) C... +3   207  5.0e-27   2
A sp|Q39025|MPK5_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +3   188  5.3e-27   2
A gi|1067075           (Z50029) ZC504.3 [Caenorhabditis ... +3   210  5.7e-27   2
A gnl|PID|e122949      (X82270) protein kinase [Medicago... +3   191  5.8e-27   2
A gi|2138340           (U94192) salicylic acid-activated... +3   184  5.8e-27   2
A sp|P39745|SUR1_CAEEL MITOGEN-ACTIVATED PROTEIN KINASE ... +3   192  5.9e-27   2
A gnl|PID|e354277      (Y15075) stress-activated protein... +3   197  6.8e-27   2
A sp|Q39026|MPK6_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +3   188  7.1e-27   2
A gi|50360             (X16461) CDC2 kinase [Mus musculus]  +3   308  7.4e-27   1
A gnl|PID|d1022330     (D85134) Bm cdc2 [Bombyx mori]       +3   308  7.4e-27   1
A sp|Q07176|MMK1_MEDSA MITOGEN-ACTIVATED PROTEIN KINASE ... +3   187  8.2e-27   2
A sp|P28869|ERK1_CANAL EXTRACELLULAR SIGNAL-REGULATED KI... +3   207  8.6e-27   2
A sp|Q06060|MAPK_PEA   MITOGEN-ACTIVATED PROTEIN KINASE ... +3   187  9.1e-27   2
A sp|P48734|CC2_BOVIN  CELL DIVISION CONTROL PROTEIN 2 H... +3   307  9.4e-27   1
A gi|295932            (Y00867) PHO85 [Saccharomyces cer... +3   307  9.4e-27   1
A gi|4170              (Y00867) PHO85 [Saccharomyces cer... +3   307  9.4e-27   1
A pir||OKBY85          protein kinase (EC 2.7.1.37) PHO8... +3   307  9.4e-27   1
A sp|P17157|PH85_YEAST NEGATIVE REGULATOR OF THE PHO SYS... +3   307  9.4e-27   1
A sp|P13863|CC2_CHICK  CELL DIVISION CONTROL PROTEIN 2 H... +3   307  9.4e-27   1
A gnl|PID|e292746      (X97315) cdc2MsD [Medicago sativa]   +3   307  9.4e-27   1
A gnl|PID|d1022331     (D85135) cdc2-related kinase [Bom... +3   203  9.7e-27   2
A sp|P54119|CC2_AJECA  CELL DIVISION CONTROL PROTEIN 2 (... +3   306  1.2e-26   1
A pir||A36074          protein kinase (EC 2.7.1.37) cdc2... +3   306  1.2e-26   1
A sp|P23573|CC2C_DROME CELL DIVISION CONTROL PROTEIN 2 C... +3   306  1.2e-26   1
A gnl|PID|d1020329     (D64036) protein cdc2 kinase [Ory... +3   306  1.2e-26   1
A gi|170869            (M76585) protein kinase [Candida ... +3   207  1.4e-26   2
A sp|Q02399|CDK5_BOVIN CELL DIVISION PROTEIN KINASE 5 (T... +3   305  1.5e-26   1
A sp|P34112|CC2_DICDI  CELL DIVISION CONTROL PROTEIN 2 H... +3   305  1.5e-26   1
A sp|P25859|CC2B_ARATH CELL DIVISION CONTROL PROTEIN 2 H... +3   305  1.5e-26   1
A gi|36621             (X66364) serine/threonine protein... +3   304  2.0e-26   1
A sp|Q00535|CDK5_HUMAN CELL DIVISION PROTEIN KINASE 5 (T... +3   304  2.0e-26   1
A sp|Q16539|MP38_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE ... +3   191  2.0e-26   2
A sp|P70618|MP38_RAT   MITOGEN-ACTIVATED PROTEIN KINASE ... +3   191  2.0e-26   2
A gi|1916984           (U91847) p38 mitogen activated pr... +3   191  2.0e-26   2
A gnl|PID|e353227      (Z99708) mitogen-activated protei... +3   178  2.2e-26   2
A pdb|1WFC|            Structure Of Apo, Unphosphorylate... +3   191  2.3e-26   2
A sp|P51166|CDK5_XENLA CELL DIVISION PROTEIN KINASE 5 (N... +3   303  2.5e-26   1
A sp|P49615|CDK5_MOUSE CELL DIVISION PROTEIN KINASE 5 (T... +3   303  2.5e-26   1
A sp|Q03114|CDK5_RAT   CELL DIVISION PROTEIN KINASE 5 (T... +3   303  2.5e-26   1
A gi|16217             (X57840) p34(cdc2)-like protein [... +3   303  2.5e-26   1
A sp|Q40517|NTF3_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE ... +3   180  2.5e-26   2
A gi|2196780           (AF003597) p38 mitogen activated ... +3   190  2.6e-26   2
A gi|2408067           (Z99165) protein kinase [Schizosa... +3   201  2.9e-26   2
A bbs|138416           Cdc2E1-4 product {P element-induc... +3   302  3.2e-26   1
A bbs|138423           Cdc2E1-9 product {P element-induc... +3   302  3.2e-26   1
A sp|P23572|CC2_DROME  CELL DIVISION CONTROL PROTEIN 2 H... +3   302  3.2e-26   1
A bbs|138417           Cdc2216 product {P element-induce... +3   302  3.2e-26   1
A bbs|138418           Cdc2D57 product {P element-induce... +3   302  3.2e-26   1
A sp|Q40531|NTF6_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE ... +3   179  3.2e-26   2
A sp|P47812|MP38_XENLA MITOGEN-ACTIVATED PROTEIN KINASE ... +3   189  3.5e-26   2
A gnl|PID|e323538      (Y12785) MAP kinase I [Petroselin... +3   175  3.5e-26   2
A pir||I78840          protein kinase (EC 2.7.1.37) cdk2... +3   221  3.7e-26   2
A pir||I48157          protein kinase (EC 2.7.1.37) cdk2... +3   221  3.7e-26   2
A gnl|PID|d1005708     (D26178) serine/threonine protein... +3   217  4.0e-26   2
A gi|2599387           (AF027300) positive transcription... +3   186  4.5e-26   2
A sp|P50750|KPL1_HUMAN SERINE/THREONINE PROTEIN KINASE P... +3   186  4.5e-26   2
A bbs|138419           Cdc2E10 product {P element-induce... +3   300  5.2e-26   1
A sp|P34556|CC2_CAEEL  CELL DIVISION CONTROL PROTEIN 2 H... +3   300  5.2e-26   1
A gnl|PID|e292753      (X97317) cdc2MsF [Medicago sativa]   +3   300  5.2e-26   1
A sp|Q39027|MPK7_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +3   175  5.4e-26   2
A sp|Q39022|MPK2_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +3   178  5.7e-26   2
A gnl|PID|e292751      (X97316) cdc2MsE [Medicago sativa]   +3   192  5.8e-26   2
A sp|Q00646|CC2_EMENI  CELL DIVISION CONTROL PROTEIN 2 (... +3   299  6.6e-26   1
A gi|1326389           (U58752) strong similarity to CDC... +3   190  7.3e-26   2
A gnl|PID|e284865      (Z83244) W06F12.d [Caenorhabditis... +3   191  7.4e-26   2
A sp|Q90336|MP38_CYPCA MITOGEN-ACTIVATED PROTEIN KINASE ... +3   186  7.7e-26   2
A sp|P20793|MAK_RAT    SERINE/THREONINE-PROTEIN KINASE M... +3   213  8.1e-26   2
A sp|Q04859|MAK_MOUSE  SERINE/THREONINE-PROTEIN KINASE M... +3   213  8.1e-26   2
A bbs|138420           Cdc2E1-23 product {P element-indu... +3   298  8.5e-26   1
A sp|Q40884|MAPK_PETHY MITOGEN-ACTIVATED PROTEIN KINASE ... +3   176  8.5e-26   2
A sp|P43068|MKC1_CANAL MITOGEN-ACTIVATED PROTEIN KINASE ... +3   186  9.4e-26   2
A sp|Q09892|STY1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE ... +3   178  9.6e-26   2
A gi|1772646           (U66243) p38gamma MAP Kinase [Hom... +3   190  1.0e-25   2
A gnl|PID|e291136      (Y10487) stress-activated protein... +3   190  1.0e-25   2
A gnl|PID|d1020522     (D83073) p38b [Mus musculus]         +3   185  1.0e-25   2
A pir||S51008          protein kinase (EC 2.7.1.37) cdk5... +3   297  1.1e-25   1
A gnl|PID|e255551      (X99511) CDK5 kinase [Drosophila ... +3   297  1.1e-25   1
A gi|2072361           (AF001008) p38Beta2 MAP Kinase [H... +3   189  1.2e-25   2
A gi|2316012           (U92268) mitogen activated protei... +3   189  1.2e-25   2
A gnl|PID|e340014      (Z98977) protein kniase [Schizosa... +3   180  1.2e-25   2
A gnl|PID|e320986      (Y13439) stress-activated protein... +3   188  1.3e-25   2
A sp|Q15759|M38B_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE ... +3   189  1.4e-25   2
sp|P39073|UME5_YEAST MEIOTIC MRNA STABILITY PROTEIN KI... +3   196  1.5e-25   2
gi|1279911           (U52963) mitogen-activated protei... +3   193  1.5e-25   2
gi|1666813           (U70134) pathogenicity MAP kinase... +3   193  1.5e-25   2
pir||S50157          cyclin-dependent kinase chain SRB... +3   196  1.6e-25   2
pir||S68680          stress-activated protein kinase 3... +3   187  1.7e-25   2
bbs|138421           Cdc2E1-24 product {P element-indu... +3   295  1.8e-25   1
pir||B54843          nemo, form II - fruit fly (Drosop... +3   177  1.9e-25   2
gnl|PID|e259403      (Y07597) shaggy-like kinase kappa... +3   190  2.0e-25   3
gi|599829            (X80230) serine/threonine protein... +3   180  2.2e-25   2
gnl|PID|e242657      (X97640) cyclin-dependent kinase ... +3   294  2.2e-25   1
sp|Q92398|SPM1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE ... +3   174  2.2e-25   2
gi|1262446           (U36377) mitogen-activated protei... +3   189  2.4e-25   2
gi|2232214           (AF004709) stress-activated prote... +3   181  2.4e-25   2
gnl|PID|e291121      (Y10488) stress-activated protein... +3   181  2.4e-25   2
pir||S60121          mitogen-activated protein kinase ... +3   174  2.5e-25   2
sp|Q39021|MPK1_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +3   172  2.5e-25   2
pir||A54843          nemo, form I - fruit fly (Drosoph... +3   177  2.9e-25   2
bbs|160086           (S75262) p34cdc2 kinase [Caenorha... +3   293  2.9e-25   1
gnl|PID|e264761      (X82646) mitogen-activated protei... +3   189  3.0e-25   2
pir||JC5153          mitogen-activated protein kinase ... +3   189  3.0e-25   2
sp|P16892|FUS3_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +3   189  3.3e-25   2
sp|Q39024|MPK4_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +3   172  3.5e-25   2
gi|2360960           (AF015256) p38 mitogen-activated ... +3   180  4.1e-25   2
sp|Q40353|MMK2_MEDSA MITOGEN-ACTIVATED PROTEIN KINASE ... +3   172  4.1e-25   2
pir||S36387          probable protein kinase (EC 2.7.1... +3   182  4.5e-25   2
pir||S51938          protein kinase homolog - Arabidop... +3   190  5.2e-25   3
sp|P53778|ERK6_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +3   185  6.1e-25   2
sp|P14681|KSS1_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +3   191  6.8e-25   2
sp|Q00532|KKIA_HUMAN SERINE/THREONINE-PROTEIN KINASE K... +3   190  7.3e-25   2
gi|295611            (L06279) HOG1 protein [Saccharomy... +3   170  7.4e-25   2
sp|P43294|MHK_ARATH  SERINE/THREONINE-PROTEIN KINASE M... +3   188  7.7e-25   2
gi|2160191           (AC000132) Identical to A. thalia... +3   190  8.0e-25   3
pir||I51425          intracellular kinase - African cl... +3   180  8.2e-25   3
pir||I51692          glycogen synthase kinase 3 beta -... +3   180  8.2e-25   3
gi|1256876           (U53878) Hog1p: Mitogen-activated... +3   170  9.0e-25   2
sp|P32485|HOG1_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +3   170  9.0e-25   2
pir||S22745          serine/threonine protein kinase K... +3   190  1.0e-24   2
gi|1718193           (U33015) Cdk8 [Drosophila melanog... +3   185  1.1e-24   2
sp|P18265|KG3A_RAT   GLYCOGEN SYNTHASE KINASE-3 ALPHA ... +3   180  1.3e-24   3
sp|Q92207|HOG1_CANAL MITOGEN-ACTIVATED PROTEIN KINASE ... +3   173  1.5e-24   2
sp|Q92241|PH85_KLULA NEGATIVE REGULATOR OF THE PHO SYS... +3   286  1.6e-24   1
sp|P49840|KG3A_HUMAN GLYCOGEN SYNTHASE KINASE-3 ALPHA ... +3   180  1.6e-24   3
sp|Q13164|ERK5_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +3   172  1.7e-24   2
gi|973307            (U29725) BMK1 alpha kinase [Homo ... +3   172  1.7e-24   2
bbs|129891           Mpk1p=mitogen-activated protein k... +3   174  1.7e-24   2
sp|Q00772|SLT2_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +3   174  1.7e-24   2
gi|402652            (X73653) tau-protein kinase [Ratt... +3   180  1.7e-24   3
sp|P49841|KG3B_HUMAN GLYCOGEN SYNTHASE KINASE-3 BETA (... +3   180  1.7e-24   3
pir||A56492          protein kinase ERK2 (EC 2.7.1.-) ... +3   172  1.7e-24   2
sp|P48609|CDK5_DROME CELL DIVISION PROTEIN KINASE 5 HO... +3   284  2.6e-24   1
sp|P18266|KG3B_RAT   GLYCOGEN SYNTHASE KINASE-3 BETA (... +3   178  2.8e-24   3
sp|P27638|SPK1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE ... +3   183  3.7e-24   2
gnl|PID|e242656      (X97639) cyclin-dependent kinas [... +3   282  4.2e-24   1
gi|2191146           (AF007269) MAP Kinase [Arabidopsi... +3   172  5.7e-24   2
gi|1015929           (Z54341) MAP kinase-like protein ... +3   175  8.1e-24   2
gi|1914883           (L29449) protein kinase [Schizosa... +3   180  1.3e-23   2
gnl|PID|e305855      (Y11591) shaggy-like kinase [Rici... +3   187  1.3e-23   2
sp|P49336|CDK8_HUMAN CELL DIVISION PROTEIN KINASE 8 (P... +3   182  1.4e-23   2
sp|P42525|ERK1_DICDI EXTRACELLULAR SIGNAL-REGULATED KI... +3   172  1.6e-23   2
pir||A56042          mitogen-activated protein kinase ... +3   172  1.6e-23   2
gnl|PID|d1022290     (AB004538) identical to S.pombe m... +3   179  1.9e-23   2
sp|P41808|SMK1_YEAST SPORULATION-SPECIFIC MITOGEN-ACTI... +3   169  2.0e-23   2
pir||S10931          probable protein kinase zeste-whi... +3   180  3.0e-23   2
gi|1326388           (U58752) similar to the CDC2/CDC2... +3   210  3.4e-23   2
dbj||D89206_1        (D89206) similar to Saccharomyces... +3   179  3.6e-23   2
gi|1280149           (U55854) similar to MAP kinases [... +3   164  4.4e-23   2
dbj||D89120_1        (D89120) Saccharomyces cerevisiae... +3   178  4.6e-23   2
gi|1654379           (U69958) cdc2-related protein kin... +3   272  4.8e-23   1
pir||S51105          petunia shaggy kinase 4 - garden ... +3   186  5.1e-23   2
gnl|PID|e255554      (X99513) protein kinase [Drosophi... +3   283  5.6e-23   1
gnl|PID|e321995      (Z81079) F39H11.3 [Caenorhabditis... +3   192  6.2e-23   2
gi|1916549           (U50966) DJNK [Drosophila melanog... +3   171  8.0e-23   2
sp|P51136|KG3H_DICDI GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +3   190  1.2e-22   2
gi|861314            (U28929) similar to Ser/Thr prote... +3   167  1.3e-22   2
pir||S71267          shaggy-like kinase etha - Arabido... +3   187  1.4e-22   2
gnl|PID|e252637      (X99100) protein kinase [Trifoliu... +3   192  1.5e-22   2
gi|1656058           (U73196) Jun-N-terminal kinase [D... +3   171  1.7e-22   2
gnl|PID|e320985      (Y13437) shaggy-like kinase etha ... +3   191  1.9e-22   2
gnl|PID|e305854      (Y11527) serine/threonine protein... +3   194  1.9e-22   2
gi|1857041           (U49180) JNK protein kinase [Dros... +3   171  2.2e-22   2
sp|P51139|MSK3_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +3   185  2.3e-22   2
sp|Q11179|YPC2_CAEEL PUTATIVE SERINE/THREONINE-PROTEIN... +3   172  2.5e-22   2
gi|2191169           (AF007270) Similar to shaggy rela... +3   188  4.2e-22   2
pir||S52095          tau-protein kinase (EC 2.7.1.135)... +3   189  4.2e-22   2
gi|1293853           (U57054) strong similarity to CDC... +3   172  4.5e-22   2
pir||S71098          protein kinase JNK1 beta1 - human... +3   168  5.7e-22   2
dbj||AB001744_1      (AB001744) JNKb [Cyprinus carpio]    +3   174  6.7e-22   2
sp|P54666|CC23_TRYBB CELL DIVISION CONTROL PROTEIN 2 H... +3   261  7.1e-22   1
gnl|PID|e318941      (Z95887) MAP-kinase homologue [Le... +3   171  7.7e-22   2
sp|P18431|KSGZ_DROME PROTEIN KINASE SHAGGY, ZYGOTIC (P... +3   181  8.0e-22   2
gnl|PID|e1172776     (AJ002314) shaggy-like kinase 111... +3   189  8.2e-22   2
gnl|PID|e338481      (AJ001275) cdc2-related kinase 3 ... +3   260  9.0e-22   1
pir||S71099          protein kinase JNK1 beta2 - human... +3   168  9.2e-22   2
sp|P38615|MDS1_YEAST SERINE/THREONINE-PROTEIN KINASE M... +3   181  9.5e-22   2
gi|295639            (L12761) protein-serine kinase [S... +3   181  9.5e-22   2
pir||A44331          zeste-white 3-A - fruit fly (Dros... +3   180  1.0e-21   2
gnl|PID|e1172778     (AJ002315) shaggy-like kinase 59 ... +3   188  1.1e-21   2
sp|P43289|KSGG_ARATH SHAGGY RELATED PROTEIN KINASE ASK... +3   188  1.1e-21   2
pir||S71266          shaggy-like kinase dzeta - Arabid... +3   185  1.2e-21   2
sp|P51138|MSK2_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +3   183  1.3e-21   2
pir||S35326          protein kinase sgg3 (EC 2.7.1.-) ... +3   180  1.3e-21   2
sp|P43288|KSGA_ARATH SHAGGY RELATED PROTEIN KINASE ASK... +3   188  1.4e-21   2
gnl|PID|e340154      (AJ000732) shaggy-like kinase alp... +3   188  1.4e-21   2
pir||S35327          protein kinase sgg39 (EC 2.7.1.-)... +3   180  1.5e-21   2
gi|1916547           (U50965) DJNK [Drosophila melanog... +3   163  1.8e-21   2
sp|P51137|MSK1_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +3   187  1.9e-21   2
sp|P36005|KKQ1_YEAST PROBABLE SERINE/THREONINE-PROTEIN... +3   157  2.3e-21   2
pir||S51106          shaggy kinase 6 - garden petunia ... +3   187  2.4e-21   2
gnl|PID|e256971      (X99696) shaggy-like protein kina... +3   184  2.4e-21   2
gi|310969            (L10997) protein kinase [Trypanos... +3   161  2.8e-21   2
sp|P23646|KSGM_DROME PROTEIN KINASE SHAGGY, MATERNAL (... +3   180  3.3e-21   2
pir||S71101          protein kinase JNK2 beta1 - human... +3   159  5.6e-21   2
gi|1336061           (U56661) cyclin-dependent kinase ... +3   252  6.3e-21   1
gi|529434            (L35236) mitogen-activated protei... +3   160  6.7e-21   2
dbj||D83273_1        (D83273) JNKa [Cyprinus carpio]      +3   160  7.0e-21   2
pir||S71100          proteine kinase JNK2 alpha1 - hum... +3   158  7.2e-21   2
gnl|PID|d1019937     (AB000807) c-JUN amino-terminal k... +3   158  7.2e-21   2
gnl|PID|e273936      (Y08607) Shaggy-like kinase 6 [Ni... +3   187  7.4e-21   2
pir||S43967          p54-alpha stress-activated protei... +3   159  8.6e-21   2
pir||S73317          protein kinase JNK2 beta2 - human... +3   159  8.7e-21   2
pir||S35423          protein kinase sgg46 (EC 2.7.1.-)... +3   180  9.3e-21   2
sp|Q61831|JNK3_MOUSE STRESS-ACTIVATED PROTEIN KINASE J... +3   160  9.6e-21   2
sp|P32581|SME1_YEAST MEIOSIS INDUCTION PROTEIN KINASE ... +3   170  9.8e-21   3
gnl|PID|d1006195     (D26605) cyclin-dependent kinase ... +2   212  1.1e-20   2
sp|P49186|JNK2_RAT   STRESS-ACTIVATED PROTEIN KINASE J... +3   158  1.1e-20   2
sp|P45984|JNK2_HUMAN STRESS-ACTIVATED PROTEIN KINASE J... +3   158  1.1e-20   2
pir||A55480          c-Jun amino-terminal kinase JNK2,... +3   158  1.1e-20   2
sp|P20911|CDK7_XENLA CELL DIVISION PROTEIN KINASE 7 (4... +3   249  1.3e-20   1
pir||S12091          protein kinase, 40K - African cla... +3   249  1.3e-20   1
pir||S71103          protein kinase JNK3 alpha1 - huma... +3   156  1.8e-20   2
pir||S43969          p54-beta stress-activated protein... +3   156  1.9e-20   2
sp|P53779|JNK3_HUMAN STRESS-ACTIVATED PROTEIN KINASE J... +3   156  2.6e-20   2
gi|493211            (L27128) stress activated protein... +3   156  3.1e-20   2
sp|P49187|JNK3_RAT   STRESS-ACTIVATED PROTEIN KINASE J... +3   156  4.2e-20   2
pir||A53063          protein kinase JNK1 - human >gi|4... +3   151  4.4e-20   2
sp|P27704|ERK3_RAT   EXTRACELLULAR SIGNAL-REGULATED KI... +3   146  5.3e-20   2
sp|Q16659|ERK3_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +3   146  5.4e-20   2
gnl|PID|e312305      (Y07822) Shaggy-like kinase tetha... +3   178  5.7e-20   2
sp|P45983|JNK1_HUMAN STRESS-ACTIVATED PROTEIN KINASE J... +3   151  6.8e-20   2
sp|P54665|CC22_TRYBB CELL DIVISION CONTROL PROTEIN 2 H... +3   241  9.3e-20   1
sp|P49185|JNK1_RAT   STRESS-ACTIVATED PROTEIN KINASE J... +3   149  9.7e-20   2
pir||S43970          p54-gamma stress-activated protei... +3   149  9.7e-20   2
sp|Q63454|ERK4_RAT   EXTRACELLULAR SIGNAL-REGULATED KI... +2   141  1.0e-19   2
gnl|PID|d1022272     (AB004537) MEIOSIS INDUCTION PROT... +3   161  1.7e-19   2
gi|1022332           (X83707) protein kinase [Plasmodi... +3   188  2.8e-19   2
gi|1825660           (U88175) Similar to ser/thr-prote... +3   157  4.8e-19   2
gi|493207            (L27111) stress activated protein... +3   147  7.0e-19   2
sp|P50873|MRK1_YEAST SERINE/THREONINE-PROTEIN KINASE M... +3   159  1.0e-18   2
sp|P51953|CDK7_CARAU CELL DIVISION PROTEIN KINASE 7 (4... +3   231  1.1e-18   1
gnl|PID|e321513      (Y13493) protein kinase Dyrk2 [Ho... +3   172  1.3e-18   2
sp|P31152|ERK4_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +3   141  1.5e-18   2
pir||S62456          hypothetical protein SPAC2G11.01 ... +3   162  2.0e-18   2
pir||S67615          MRK1 protein - yeast (Saccharomyc... +3   159  3.2e-18   2
sp|P14680|YAK1_YEAST PROTEIN KINASE YAK1 >pir||A32582 ... +3   173  3.8e-18   2
gnl|PID|e233924      (Z70308) F49E11.1 [Caenorhabditis... +3   173  6.0e-18   2
sp|Q09815|KAB7_SCHPO PROBABLE SERINE/THREONINE-PROTEIN... +3   162  7.1e-18   2
gnl|PID|e351364      (Z99568) serine threonine protein... +3   156  7.4e-18   2
sp|Q12222|KOM8_YEAST PROBABLE SERINE/THREONINE-PROTEIN... +3   164  8.0e-18   2
sp|P19026|CC21_PEA   CELL DIVISION CONTROL PROTEIN 2 H... +2   168  9.2e-18   2
pir||E46036          CDC28/cdc2 homolog - fruit fly (D... +2   168  1.5e-17   2
sp|Q09690|KA23_SCHPO PROBABLE SERINE/THREONINE-PROTEIN... +3   167  1.7e-17   2
gnl|PID|e236437      (Z68298) F44D12.11 [Caenorhabditi... +3   148  2.5e-17   2
sp|Q04770|CDK2_ENTHI CELL DIVISION PROTEIN KINASE 2 HO... +3   216  4.1e-17   1
pir||S47042          protein kinase (EC 2.7.1.37) cdc2... +3   224  6.5e-17   1
gi|575365            (X80759) cdc2-related protein kin... +3   224  7.3e-17   1
gnl|PID|e348281      (Z79598) C44H4.6 [Caenorhabditis ... +3   139  7.5e-17   2
gi|1669368           (AC000065) human CDK6 [Homo sapiens] +3   211  1.4e-16   1
gnl|PID|e250837      (X98689) mitogen-activated protei... +3   136  1.9e-16   2
sp|P28547|KC2A_THEPA CASEIN KINASE II, ALPHA CHAIN (CK... +3   140  3.0e-16   2
gnl|PID|e304438      (Z81038) C25A1.14 [Caenorhabditis... +3   141  3.7e-16   2
sp|P46551|CDK2_CAEEL PUTATIVE CELL DIVISION PROTEIN KI... +3   209  6.0e-16   1
pir||S43968          p54-alpha-2 stress-activated prot... +3   135  1.1e-15   2
sp|P21965|MCK1_YEAST PROTEIN KINASE MCK1 (MEIOSIS AND ... +3   142  1.1e-15   2
sp|P20427|KC22_BOVIN CASEIN KINASE II, ALPHA' CHAIN (C... +3   138  1.6e-15   2
sp|P19784|KC22_HUMAN CASEIN KINASE II, ALPHA' CHAIN (C... +3   138  1.6e-15   2
gi|1763647           (U80932) serine/threonine kinase ... +2   154  1.8e-15   2
gi|757823            (X70794) serin/threonin-kinase [D... +3   161  2.0e-15   2
gnl|PID|e224540      (Z69885) T04C10.1 [Caenorhabditis... +3   168  2.4e-15   2
gnl|PID|e349043      (Z80215) C36B1.10 [Caenorhabditis... +3   142  2.4e-15   2
sp|P21869|KC22_CHICK CASEIN KINASE II, ALPHA' CHAIN (C... +3   138  3.3e-15   2
gi|915406            (U29665) cdk7 gene product [Marth... +3   198  3.3e-15   1
sp|P08181|KC2A_DROME CASEIN KINASE II, ALPHA CHAIN (CK... +3   134  3.4e-15   2
gi|2257984           (AF007817) IPL1 and aurora relate... +2   152  3.7e-15   2
sp|P28523|KC2A_MAIZE CASEIN KINASE II, ALPHA CHAIN (CK... +3   135  4.6e-15   2
bbs|163823           (S76875) casein kinase 2 alpha su... +3   135  5.5e-15   2
pir||PN0486          cell division cycle-2-related pro... +2   121  7.2e-15   2
sp|P49657|MNB_DROME  SERINE/THREONINE PROTEIN KINASE M... +3   161  7.5e-15   2
sp|P28020|KC22_XENLA CASEIN KINASE II, ALPHA' CHAIN (C... +3   134  2.1e-14   2
gnl|PID|e258484      (X99964) protein kinase CK2 alpha... +3   139  2.4e-14   2
gnl|PID|e283507      (Z83096) caseine kinase II cataly... +3   135  2.7e-14   2
sp|P18334|KC2A_CAEEL CASEIN KINASE II, ALPHA CHAIN (CK... +3   130  2.7e-14   2
pir||B30319          casein kinase II (EC 2.7.1.-) alp... +3   134  3.1e-14   2
sp|P33674|KC21_RABIT CASEIN KINASE II, ALPHA CHAIN (CK... +3   134  3.3e-14   2
sp|P19138|KC21_HUMAN CASEIN KINASE II, ALPHA CHAIN (CK... +3   134  3.3e-14   2
gi|599778            (X70251) casein kinase II alpha s... +3   134  3.3e-14   2
sp|P19139|KC21_RAT   CASEIN KINASE II, ALPHA CHAIN (CK... +3   134  3.3e-14   2
sp|P21868|KC21_CHICK CASEIN KINASE II, ALPHA CHAIN (CK... +3   134  3.3e-14   2
pir||I49141          casein kinase II alpha subunit - ... +3   134  3.3e-14   2
gi|1262300           (U51866) casein kinase II alpha s... +3   134  3.3e-14   2
sp|P19454|KC22_YEAST CASEIN KINASE II, ALPHA' CHAIN (C... +3   130  3.4e-14   2
sp|Q08466|KC22_ARATH CASEIN KINASE II, ALPHA CHAIN 2 (... +3   136  4.4e-14   2
pir||JC4898          minibrain protein - human >gnl|PI... +3   156  4.9e-14   2
prf||2208359A        protein kinase Dyrk [Rattus norve... +3   156  5.1e-14   2
sp|Q13627|MNB_HUMAN  SERINE/THREONINE-SPECIFIC PROTEIN... +3   156  5.1e-14   2
gi|1381158           (U58497) mp86 [Mus musculus]         +3   156  5.1e-14   2
gi|1663726           (U52373) MNB [Homo sapiens]          +3   156  5.1e-14   2
gnl|PID|e1169187     (X79769) Dual Specificity Yak1-re... +3   156  5.1e-14   2
gi|1326255           (U58726) coded for by C. elegans ... +2   154  5.5e-14   2
gi|560034            (U16029) protein kinase [Leishman... +2   156  7.9e-14   2
sp|Q02720|KC2A_DICDI CASEIN KINASE II, ALPHA CHAIN (CK... +3   133  1.2e-13   2
gnl|PID|e244476      (Z71703) cdc2-like protein kinase... +2   141  1.3e-13   2
gnl|PID|e286205      (Y10036) SNF1-related protein kin... +2   149  1.3e-13   2
pir||S59941          protein kinase BKIN2 (EC 2.7.1.-)... +2   148  1.4e-13   2
pir||A56009          protein kinase NPK5 (EC 2.7.1.-) ... +2   149  1.4e-13   2
pir||JC1446          serine/threonine protein kinase (... +2   149  1.4e-13   2
gnl|PID|e276839      (X99279) AKin11 [Arabidopsis thal... +2   149  1.4e-13   2
gnl|PID|e218048      (X94755) ser/thr protein kinase [... +2   149  1.4e-13   2
gi|1935916           (U83797) StubSNF1 protein [Solanu... +2   149  1.4e-13   2
gi|575292            (X82548) SNF1-related protein kin... +2   148  1.5e-13   2
prf||2106147A        protein kinase CK2:SUBUNIT=alpha ... +3   134  1.8e-13   2
sp|P15790|KC21_YEAST CASEIN KINASE II, ALPHA CHAIN (CK... +3   126  1.9e-13   2
gi|2347199           (AC002338) protein kinase isolog ... +2   152  3.2e-13   2
sp|P40231|KC21_SCHPO CASEIN KINASE II, ALPHA CHAIN (CK... +3   122  3.9e-13   2
gi|2306915           (AF004022) protein kinase [Homo s... +2   142  5.0e-13   2
gnl|PID|e325363      (Z97211) hypothetical protein [Sc... +2   140  5.7e-13   2
sp|Q08467|KC21_ARATH CASEIN KINASE II, ALPHA CHAIN 1 (... +3   125  7.8e-13   2
gnl|PID|d1005187     (D21099) STK-1 [Mus musculus]        +2   139  8.3e-13   2
pir||JC4665          protein kinase (EC 2.7.1.37) - mouse +2   139  8.3e-13   2
gi|1943805           (U97196) Similar to protein kinas... +2   145  1.0e-12   2
pir||S52243          p46Eg265 protein - African clawed... +2   142  1.9e-12   2
sp|Q09595|YRL5_CAEEL PUTATIVE SERINE/THREONINE-PROTEIN... +3   122  2.7e-12   2
gnl|PID|d1003439     (D13785) Mkk2 protein kinase [Sac... +2   142  3.2e-12   2
sp|P32491|MKK2_YEAST PROTEIN KINASE MKK2/SSP33 >pir||S... +2   142  3.2e-12   2
sp|P28829|BYR2_SCHPO PROTEIN KINASE BYR2 (PROTEIN KINA... +2   140  4.0e-12   2
gnl|PID|e318885      (Z49369) ORF YJL095w [Saccharomyc... +2   130  6.1e-12   2
gi|2443747           (AF020309) SNF1A/AMP-activated pr... +2   145  6.7e-12   2
pir||S52242          p46XlEg22 protein - African clawe... +2   142  6.8e-12   2
gi|758783            (U22456) AMP-activated protein ki... +2   134  9.7e-12   2
pir||S62365          SNF1-related protein kinase (EC 2... +2   127  1.2e-11   2
pir||S30503          protein kinase Mpk-7 (EC 2.7.1.-)... +3   105  1.5e-11   2
gnl|PID|e264782      (Y07750) protein kinase [Schizosa... +2   133  1.8e-11   2
gnl|PID|d1006875     (D30622) novel serine/threonine p... +2   146  1.8e-11   2
gnl|PID|e309222      (Y11989) Wak1 protein [Schizosacc... +2   133  1.9e-11   2
sp|P32490|MKK1_YEAST PROTEIN KINASE MKK1/SSP32 >pir||A... +2   134  1.9e-11   2
pir||S44355          casein kinase II (EC 2.7.1.-) alp... +3   114  2.0e-11   2
gi|1597730           (U70231) serine threonine kinase ... +2   135  2.1e-11   2
gnl|PID|e1168668     (Z98763) MAP kinase kinase kinase... +2   133  2.2e-11   2
gnl|PID|d1001853     (D10495) protein kinase C delta-t... +2   126  2.7e-11   2
pir||S35704          protein kinase C (EC 2.7.1.-) del... +2   126  3.3e-11   2
sp|Q05655|KPCD_HUMAN PROTEIN KINASE C, DELTA TYPE (NPK... +2   126  3.3e-11   2
gi|1537064           (U58205) Plx1 [Xenopus laevis]       +2   127  3.6e-11   2


WARNING:  Descriptions of 2401 database sequences were not reported due to the
          limiting value of parameter V = 500.



>sp|Q07785|CC2H_PLAFK CELL DIVISION CONTROL PROTEIN 2 HOMOLOG >pir||S42566
            protein kinase (EC 2.7.1.37) cdc2 homolog - Plasmodium falciparum
            >gi|9934 (X61921) protein kinase p34cdc2 [Plasmodium falciparum]
            Length = 288

  Plus Strand HSPs:

 Score = 436 (153.5 bits), Expect = 3.0e-68, Sum P(2) = 3.0e-68
 Identities = 80/82 (97%), Positives = 82/82 (100%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS
Sbjct:   146 LARAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 205

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             EADQLMRIFRILGTPNSKNWPN
Sbjct:   206 EADQLMRIFRILGTPNSKNWPN 227

 Score = 281 (98.9 bits), Expect = 3.0e-68, Sum P(2) = 3.0e-68
 Identities = 55/56 (98%), Positives = 55/56 (98%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             C GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR
Sbjct:    93 CEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 148


>gnl|PID|e251152 (X98768) cdc2-like kinase [Theileria annulata]
            Length = 298

  Plus Strand HSPs:

 Score = 375 (132.0 bits), Expect = 1.3e-57, Sum P(2) = 1.3e-57
 Identities = 66/81 (81%), Positives = 73/81 (90%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAF IPVR YTHEVVTLWYRAPDVLMGSKKYST +DIWSVGCIFAEM+NG PLFPG+S
Sbjct:   146 LARAFAIPVRSYTHEVVTLWYRAPDVLMGSKKYSTAVDIWSVGCIFAEMINGVPLFPGIS 205

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIF+ILGTPN  +WP
Sbjct:   206 EQDQLKRIFKILGTPNVDSWP 226

 Score = 241 (84.8 bits), Expect = 1.3e-57, Sum P(2) = 1.3e-57
 Identities = 45/56 (80%), Positives = 49/56 (87%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             C GGLE  TAKSFL Q+L GI+YCHD R+LHRDLKPQNLLINREG LK+ADFGLAR
Sbjct:    93 CDGGLEPTTAKSFLYQILRGISYCHDHRILHRDLKPQNLLINREGVLKLADFGLAR 148


>gnl|PID|e251627 (X98824) cdec2-related kinase [Theileria parva]
            Length = 298

  Plus Strand HSPs:

 Score = 370 (130.2 bits), Expect = 4.3e-57, Sum P(2) = 4.3e-57
 Identities = 65/81 (80%), Positives = 73/81 (90%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAF IPVR YTHEVVTLWYRAPDVLMGSKKYST +DIWSVGCIFAEM+NG PLFPG+S
Sbjct:   146 LARAFAIPVRSYTHEVVTLWYRAPDVLMGSKKYSTAVDIWSVGCIFAEMINGVPLFPGIS 205

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIF+ILGTP+  +WP
Sbjct:   206 EQDQLKRIFKILGTPSVDSWP 226

 Score = 241 (84.8 bits), Expect = 4.3e-57, Sum P(2) = 4.3e-57
 Identities = 45/56 (80%), Positives = 49/56 (87%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             C GGLE  TAKSFL Q+L GI+YCHD R+LHRDLKPQNLLINREG LK+ADFGLAR
Sbjct:    93 CDGGLEPTTAKSFLYQILRGISYCHDHRILHRDLKPQNLLINREGVLKLADFGLAR 148


>gnl|PID|e333558 (AJ001085) putative 34kDa cdc2-related protein kinase
            [Toxoplasma gondii]
            Length = 300

  Plus Strand HSPs:

 Score = 345 (121.4 bits), Expect = 6.2e-54, Sum P(2) = 6.2e-54
 Identities = 62/81 (76%), Positives = 68/81 (83%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR YTHEVVTLWYRAPDVLMGSK YST +DIWSVGCIFAEMVNG PLFPG  
Sbjct:   146 LARAFGIPVRSYTHEVVTLWYRAPDVLMGSKTYSTPVDIWSVGCIFAEMVNGRPLFPGTG 205

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               DQLM+IF++LGTP     P
Sbjct:   206 NEDQLMKIFKVLGTPQVSEHP 226

 Score = 236 (83.1 bits), Expect = 6.2e-54, Sum P(2) = 6.2e-54
 Identities = 46/56 (82%), Positives = 48/56 (85%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             C GGLE  T KSFL QLL GIAYCH+ RVLHRDLKPQNLLINREG LK+ADFGLAR
Sbjct:    93 CDGGLEPSTTKSFLFQLLCGIAYCHEHRVLHRDLKPQNLLINREGALKLADFGLAR 148


>sp|P34117|CC2H_DICDI CDC2-LIKE SERINE/THREONINE-PROTEIN KINASE CRP
            >pir||S40021 protein kinase (EC 2.7.1.37) cdc2 homolog - slime mold
            (Dictyostelium discoideum) >gi|167696 (L00652) crp [Dictyostelium
            discoideum]
            Length = 292

  Plus Strand HSPs:

 Score = 343 (120.7 bits), Expect = 3.0e-52, Sum P(2) = 3.0e-52
 Identities = 61/82 (74%), Positives = 71/82 (86%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR Y+HEVVTLWYRAPDVLMGS+KYST IDIWS  CIFAEM +G PLFPG  
Sbjct:   147 LARAFGIPVRTYSHEVVTLWYRAPDVLMGSRKYSTPIDIWSALCIFAEMASGRPLFPGSG 206

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
              +DQL RIF+ILGTPN ++WP+
Sbjct:   207 TSDQLFRIFKILGTPNEESWPS 228

 Score = 222 (78.1 bits), Expect = 3.0e-52, Sum P(2) = 3.0e-52
 Identities = 42/60 (70%), Positives = 48/60 (80%), Frame = +2

Query:     8 YKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             Y   C G +   T KSF+ QLL G+A+CHD RVLHRDLKPQNLLINR+GELK+ADFGLAR
Sbjct:    90 YLDECGGEISKPTIKSFMYQLLKGVAFCHDHRVLHRDLKPQNLLINRKGELKLADFGLAR 149


>gi|1658064 (U74762) cdc2-related protein kinase 2 [Trypanosoma cruzi]
            Length = 301

  Plus Strand HSPs:

 Score = 339 (119.3 bits), Expect = 3.0e-48, Sum P(2) = 3.0e-48
 Identities = 59/82 (71%), Positives = 72/82 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + RAFGIPV+K+THEVVTLWYR+PDVL+GS +Y T +DIWSVGCIFAEMV G PLF G +
Sbjct:   148 LGRAFGIPVKKFTHEVVTLWYRSPDVLLGSTQYGTPVDIWSVGCIFAEMVIGAPLFAGKN 207

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             +ADQL+RIFR LGTPN++ WP+
Sbjct:   208 DADQLLRIFRFLGTPNNQVWPS 229

 Score = 188 (66.2 bits), Expect = 3.0e-48, Sum P(2) = 3.0e-48
 Identities = 34/54 (62%), Positives = 42/54 (77%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G L++ T + F+  LLNG+ +CHDR VLHRDLKP NLLI+RE  LK+ADFGL R
Sbjct:    97 GNLDAATIQDFMRDLLNGVRFCHDRNVLHRDLKPPNLLISREKSLKLADFGLGR 150


>gnl|PID|d1022523 (AB006033) cdc2 kinase [Allium cepa]
            Length = 294

  Plus Strand HSPs:

 Score = 340 (119.7 bits), Expect = 3.8e-48, Sum P(2) = 3.8e-48
 Identities = 58/81 (71%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+G+++YST +DIWSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGARQYSTPVDIWSVGCIFAEMVNQRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRI+GTPN   WP
Sbjct:   209 EIDELFKIFRIMGTPNEDTWP 229

 Score = 186 (65.5 bits), Expect = 3.8e-48, Sum P(2) = 3.8e-48
 Identities = 38/52 (73%), Positives = 42/52 (80%), Frame = +2

Query:    35 ESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             +S  AK+FL QLL GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   100 DSRLAKTFLYQLLRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 151


>pir||A40444 protein kinase (EC 2.7.1.37) cdc2 homolog A - maize
            Length = 294

  Plus Strand HSPs:

 Score = 344 (121.1 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 58/81 (71%), Positives = 73/81 (90%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+G+++YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGARQYSTPVDVWSVGCIFAEMVNQKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRILGTPN ++WP
Sbjct:   209 EIDELFKIFRILGTPNEQSWP 229

 Score = 177 (62.3 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 34/47 (72%), Positives = 40/47 (85%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             KS+L Q+L+G+AYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KSYLYQILHGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 151


>sp|P23111|CC2_MAIZE CELL DIVISION CONTROL PROTEIN 2 HOMOLOG >gi|168511
            (M60526) protein cdc2 kinase [Zea mays]
            Length = 294

  Plus Strand HSPs:

 Score = 344 (121.1 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 58/81 (71%), Positives = 73/81 (90%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+G+++YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGARQYSTPVDVWSVGCIFAEMVNQKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRILGTPN ++WP
Sbjct:   209 EIDELFKIFRILGTPNEQSWP 229

 Score = 177 (62.3 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 34/47 (72%), Positives = 40/47 (85%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             KS+L Q+L+G+AYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KSYLYQILHGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 151


>pir||S42049 protein kinase (EC 2.7.1.37) cdc2-Pa - Norway spruce >gi|454980
            (X77680) cdc2Pa [Picea abies]
            Length = 294

  Plus Strand HSPs:

 Score = 343 (120.7 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 58/81 (71%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR+LGTPN + WP
Sbjct:   209 EIDELFKIFRVLGTPNEETWP 229

 Score = 178 (62.7 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 35/47 (74%), Positives = 40/47 (85%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K+FL Q+L GIAYCH  RVLHRDLKPQNLLI+R+   LK+ADFGLAR
Sbjct:   105 KTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLAR 151


>gi|530748 (X80845) cdc2Pnc gene product [Pinus contorta]
           Length = 206

  Plus Strand HSPs:

 Score = 343 (120.7 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 58/81 (71%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:    76 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDS 135

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR+LGTPN + WP
Sbjct:   136 EIDELFKIFRVLGTPNEETWP 156

 Score = 178 (62.7 bits), Expect = 1.3e-47, Sum P(2) = 1.3e-47
 Identities = 35/47 (74%), Positives = 40/47 (85%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K+FL Q+L GIAYCH  RVLHRDLKPQNLLI+R+   LK+ADFGLAR
Sbjct:    32 KTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLADFGLAR 78


>sp|P29618|CC21_ORYSA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 1 >pir||S22440
            protein kinase (EC 2.7.1.37) cdc2 homolog 1 - rice >gi|20343
            (X60374) Rcdc2-1 gene product [Oryza sativa] >prf||1814443A cdc2
            protein:ISOTYPE=cdc2Os-1 [Oryza sativa]
            Length = 294

  Plus Strand HSPs:

 Score = 344 (121.1 bits), Expect = 1.6e-47, Sum P(2) = 1.6e-47
 Identities = 58/81 (71%), Positives = 73/81 (90%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS++YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRQYSTPVDMWSVGCIFAEMVNQKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR+LGTPN ++WP
Sbjct:   209 EIDELFKIFRVLGTPNEQSWP 229

 Score = 176 (62.0 bits), Expect = 1.6e-47, Sum P(2) = 1.6e-47
 Identities = 34/47 (72%), Positives = 39/47 (82%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             KS+L Q+L G+AYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KSYLYQILRGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 151


>pir||B40444 protein kinase (EC 2.7.1.37) cdc2 homolog B - maize (fragment)
            Length = 294

  Plus Strand HSPs:

 Score = 342 (120.4 bits), Expect = 2.1e-47, Sum P(2) = 2.1e-47
 Identities = 57/81 (70%), Positives = 72/81 (88%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+G+++YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGARQYSTPVDVWSVGCIFAEMVNQKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR+LGTPN + WP
Sbjct:   209 EIDELFKIFRVLGTPNEQGWP 229

 Score = 177 (62.3 bits), Expect = 2.1e-47, Sum P(2) = 2.1e-47
 Identities = 34/47 (72%), Positives = 39/47 (82%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGE-LKIADFGLAR 187
             KS+L Q+L G+AYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KSYLYQILRGVAYCHSHRVLHRDLKPQNLLIDRRNNALKLADFGLAR 151


>sp|P54664|CC21_TRYCO CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 1 >pir||S42101
            protein kinase (EC 2.7.1.37) cdc2 homolog - Trypanosoma congolense
            >gi|457421 (Z30312) cdc2-related kinase [Trypanosoma congolense]
            Length = 301

  Plus Strand HSPs:

 Score = 337 (118.6 bits), Expect = 2.6e-47, Sum P(2) = 2.6e-47
 Identities = 59/82 (71%), Positives = 71/82 (86%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + RAFGIPV+KYTHEVVTLWYR+PDVL+GS +Y T +DIWSVGCIFAEM  G PLF G +
Sbjct:   148 LGRAFGIPVKKYTHEVVTLWYRSPDVLLGSTQYGTPVDIWSVGCIFAEMAIGAPLFAGKN 207

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             +ADQL+RIFR LGTP+S+ WP+
Sbjct:   208 DADQLLRIFRFLGTPSSQVWPS 229

 Score = 181 (63.7 bits), Expect = 2.6e-47, Sum P(2) = 2.6e-47
 Identities = 33/54 (61%), Positives = 41/54 (75%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G L+  T + F+  LL G+ +CH+R VLHRDLKP NLLI+RE ELK+ADFGL R
Sbjct:    97 GNLDPATIQEFMRSLLKGVRFCHERNVLHRDLKPPNLLISREKELKLADFGLGR 150


>pir||JQ2243 protein kinase (EC 2.7.1.37) cdc2 homolog - moth bean >gi|170642
            (M99497) protein kinase [Vigna aconitifolia]
            Length = 294

  Plus Strand HSPs:

 Score = 344 (121.1 bits), Expect = 3.3e-47, Sum P(2) = 3.3e-47
 Identities = 59/81 (72%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRILGTPN + WP
Sbjct:   209 EIDELFKIFRILGTPNEETWP 229

 Score = 173 (60.9 bits), Expect = 3.3e-47, Sum P(2) = 3.3e-47
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 151


>gnl|PID|e242615 (X97637) cyclin-dependent kinase [Antirrhinum majus]
            Length = 302

  Plus Strand HSPs:

 Score = 341 (120.0 bits), Expect = 4.2e-47, Sum P(2) = 4.2e-47
 Identities = 57/81 (70%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   157 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDS 216

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR++GTPN + WP
Sbjct:   217 EIDELFKIFRVMGTPNEETWP 237

 Score = 175 (61.6 bits), Expect = 4.2e-47, Sum P(2) = 4.2e-47
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   113 KMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 159


>gnl|PID|e290217 (Y10160) cyclin dependent kinase p34 [Chenopodium rubrum]
            Length = 294

  Plus Strand HSPs:

 Score = 339 (119.3 bits), Expect = 4.2e-47, Sum P(2) = 4.2e-47
 Identities = 58/81 (71%), Positives = 70/81 (86%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR LGTPN + WP
Sbjct:   209 EIDELFKIFRTLGTPNEETWP 229

 Score = 177 (62.3 bits), Expect = 4.2e-47, Sum P(2) = 4.2e-47
 Identities = 35/47 (74%), Positives = 39/47 (82%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R+   LK+ADFGLAR
Sbjct:   105 KRFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRQTNALKLADFGLAR 151


>pir||S57928 protein kinase (EC 2.7.1.37) cdc2 homolog - cowpea >gi|1235610
            (X89400) protein kinase [Vigna unguiculata]
            Length = 294

  Plus Strand HSPs:

 Score = 342 (120.4 bits), Expect = 5.4e-47, Sum P(2) = 5.4e-47
 Identities = 58/81 (71%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGC+FAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCLFAEMVNRRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRILGTPN + WP
Sbjct:   209 EIDELFKIFRILGTPNEETWP 229

 Score = 173 (60.9 bits), Expect = 5.4e-47, Sum P(2) = 5.4e-47
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 151


>sp|P52389|CC2_VIGUN CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
            Length = 294

  Plus Strand HSPs:

 Score = 342 (120.4 bits), Expect = 5.4e-47, Sum P(2) = 5.4e-47
 Identities = 58/81 (71%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGC+FAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCLFAEMVNRRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRILGTPN + WP
Sbjct:   209 EIDELFKIFRILGTPNEETWP 229

 Score = 173 (60.9 bits), Expect = 5.4e-47, Sum P(2) = 5.4e-47
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 151


>pir||A37871 protein kinase (EC 2.7.1.37) cdk2 - African clawed frog
            Length = 297

  Plus Strand HSPs:

 Score = 317 (111.6 bits), Expect = 6.9e-47, Sum P(2) = 6.9e-47
 Identities = 55/81 (67%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR +THEVVTLWYRAP++L+G K YST +DIWS+GCIFAEM+    LFPG S
Sbjct:   148 LARAFGVPVRTFTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAEMITRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+  +WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVSWP 228

 Score = 197 (69.3 bits), Expect = 6.9e-47, Sum P(2) = 6.9e-47
 Identities = 36/55 (65%), Positives = 43/55 (78%), Frame = +2

Query:    23 IGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             I G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN +G +K+ADFGLAR
Sbjct:    96 ISGISLALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINSDGAIKLADFGLAR 150


>sp|P23437|CDK2_XENLA CELL DIVISION PROTEIN KINASE 2 (CDC2 HOMOLOG EG1 PROTEIN
            KINASE) >gi|64666 (X14227) highly homologous to cdc2
            (serine-threonine kinase) [Xenopus laevis]
            Length = 297

  Plus Strand HSPs:

 Score = 317 (111.6 bits), Expect = 6.9e-47, Sum P(2) = 6.9e-47
 Identities = 55/81 (67%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR +THEVVTLWYRAP++L+G K YST +DIWS+GCIFAEM+    LFPG S
Sbjct:   148 LARAFGVPVRTFTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAEMITRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+  +WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVSWP 228

 Score = 197 (69.3 bits), Expect = 6.9e-47, Sum P(2) = 6.9e-47
 Identities = 36/55 (65%), Positives = 43/55 (78%), Frame = +2

Query:    23 IGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             I G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN +G +K+ADFGLAR
Sbjct:    96 ISGISLALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINSDGAIKLADFGLAR 150


>gnl|PID|e251272 (Z75661) cdc2 kinase homologue [Sesbania rostrata]
            Length = 294

  Plus Strand HSPs:

 Score = 340 (119.7 bits), Expect = 8.8e-47, Sum P(2) = 8.8e-47
 Identities = 60/81 (74%), Positives = 69/81 (85%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP +L+GS+ YST +DIWSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPGILLGSRHYSTPVDIWSVGCIFAEMVNRRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRILGTPN   WP
Sbjct:   209 EIDELFKIFRILGTPNEDTWP 229

 Score = 173 (60.9 bits), Expect = 8.8e-47, Sum P(2) = 8.8e-47
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 151


>gi|2564701 (AF026546) Cdc2 cyclin-dependent kinase [Pneumocystis carinii]
            Length = 300

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 8.8e-47, Sum P(2) = 8.8e-47
 Identities = 54/81 (66%), Positives = 69/81 (85%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+P+R YTHEVVTLWYRAP+VL+G ++Y+T +DIWS+GCIFAEM    PLFPG S
Sbjct:   149 LARAFGVPLRGYTHEVVTLWYRAPEVLLGGRQYATALDIWSIGCIFAEMATKKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D++ RIFRILGTP+  +WP
Sbjct:   209 EIDEIFRIFRILGTPDENSWP 229

 Score = 188 (66.2 bits), Expect = 8.8e-47, Sum P(2) = 8.8e-47
 Identities = 35/53 (66%), Positives = 43/53 (81%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G E +  K F+ QL++G+ YCH  R+LHRDLKPQNLLI+REG LK+ADFGLAR
Sbjct:   101 GAEMI--KKFMSQLVSGVKYCHSHRILHRDLKPQNLLIDREGNLKLADFGLAR 151


>gi|2564703 (AF026545) Cdc2 cyclin-dependent kinase [Pneumocystis carinii]
            Length = 300

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 8.8e-47, Sum P(2) = 8.8e-47
 Identities = 54/81 (66%), Positives = 69/81 (85%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+P+R YTHEVVTLWYRAP+VL+G ++Y+T +DIWS+GCIFAEM    PLFPG S
Sbjct:   149 LARAFGVPLRGYTHEVVTLWYRAPEVLLGGRQYATALDIWSIGCIFAEMATKKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D++ RIFRILGTP+  +WP
Sbjct:   209 EIDEIFRIFRILGTPDENSWP 229

 Score = 188 (66.2 bits), Expect = 8.8e-47, Sum P(2) = 8.8e-47
 Identities = 35/53 (66%), Positives = 43/53 (81%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G E +  K F+ QL++G+ YCH  R+LHRDLKPQNLLI+REG LK+ADFGLAR
Sbjct:   101 GAEMI--KKFMSQLVSGVKYCHSHRILHRDLKPQNLLIDREGNLKLADFGLAR 151


>gi|1196796 (L34206) protein kinase p34cdc2 [Petroselinum crispum]
            Length = 294

  Plus Strand HSPs:

 Score = 337 (118.6 bits), Expect = 1.1e-46, Sum P(2) = 1.1e-46
 Identities = 58/81 (71%), Positives = 69/81 (85%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRI GTPN   WP
Sbjct:   209 EIDELFKIFRITGTPNEDTWP 229

 Score = 175 (61.6 bits), Expect = 1.1e-46, Sum P(2) = 1.1e-46
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 151


>sp|P29619|CC22_ORYSA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 2 >pir||S22441
            protein kinase (EC 2.7.1.37) cdc2 homolog 2 - rice >gi|20345
            (X60375) Rcdc2-2 gene product [Oryza sativa] >prf||1814443B cdc2
            protein:ISOTYPE=cdc2Os-2 [Oryza sativa]
            Length = 292

  Plus Strand HSPs:

 Score = 331 (116.5 bits), Expect = 1.1e-46, Sum P(2) = 1.1e-46
 Identities = 56/81 (69%), Positives = 70/81 (86%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+G++ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   148 LARAFGIPVRTFTHEVVTLWYRAPEILLGARHYSTPVDMWSVGCIFAEMVNQKPLFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IF I+GTPN + WP
Sbjct:   208 EIDELFKIFSIMGTPNEETWP 228

 Score = 181 (63.7 bits), Expect = 1.1e-46, Sum P(2) = 1.1e-46
 Identities = 36/47 (76%), Positives = 39/47 (82%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             KSFL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   104 KSFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 150


>sp|P04551|CC2_SCHPO CELL DIVISION CONTROL PROTEIN 2 (P34 PROTEIN KINASE)
            >pir||TVZP2 protein kinase (EC 2.7.1.37) cdc2 - fission yeast
            (Schizosaccharomyces pombe) >gi|173359 (M12912) CDC2 protein kinase
            [Schizosaccharomyces pombe] >gnl|PID|d1022225 (AB004534) CELL
            DIVISION CONTROL PROTEIN 2 [Schizosaccharomyces pombe]
            >prf||1101270A protein CDC2 [Schizosaccharomyces pombe]
            Length = 297

  Plus Strand HSPs:

 Score = 327 (115.1 bits), Expect = 2.3e-46, Sum P(2) = 2.3e-46
 Identities = 53/81 (65%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R+FG+P+R YTHE+VTLWYRAP+VL+GS+ YST +DIWSVGCIFAEM+  +PLFPG S
Sbjct:   155 LARSFGVPLRNYTHEIVTLWYRAPEVLLGSRHYSTGVDIWSVGCIFAEMIRRSPLFPGDS 214

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D++ +IF++LGTPN + WP
Sbjct:   215 EIDEIFKIFQVLGTPNEEVWP 235

 Score = 182 (64.1 bits), Expect = 2.3e-46, Sum P(2) = 2.3e-46
 Identities = 32/52 (61%), Positives = 42/52 (80%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             L+    + F  QL+NG+ +CH RR++HRDLKPQNLLI++EG LK+ADFGLAR
Sbjct:   106 LDPRLVQKFTYQLVNGVNFCHSRRIIHRDLKPQNLLIDKEGNLKLADFGLAR 157


>sp|Q05006|CC22_MEDSA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 2 >pir||S31332
            protein kinase (EC 2.7.1.37) cdc2-B - alfalfa >gi|19583 (X70707)
            CDC2 kinase [Medicago sativa]
            Length = 294

  Plus Strand HSPs:

 Score = 338 (119.0 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 57/81 (70%), Positives = 70/81 (86%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEM+N  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMINQRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRI GTPN + WP
Sbjct:   209 EIDELFKIFRITGTPNEETWP 229

 Score = 170 (59.8 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 34/47 (72%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGE-LKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    +K+ADFGLAR
Sbjct:   105 KMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRSSNAVKLADFGLAR 151


>gnl|PID|e242658 (X97638) cyclin-dependent kinase [Antirrhinum majus]
            Length = 280

  Plus Strand HSPs:

 Score = 336 (118.3 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 59/81 (72%), Positives = 70/81 (86%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP+VL+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:   136 LARAFGIPVRTFTHEVVTLWYRAPEVLLGSRHYSTPVDVWSVGCIFAEMVNQKPLFPGDS 195

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRI+GTPN   WP
Sbjct:   196 EIDELHKIFRIIGTPNEDIWP 216

 Score = 172 (60.5 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 33/47 (70%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINR-EGELKIADFGLAR 187
             K FL Q+L G+AYCH  RVLHRDLKPQNLLI+R    +K+ADFGLAR
Sbjct:    92 KMFLCQILRGVAYCHSHRVLHRDLKPQNLLIDRGSNTIKLADFGLAR 138


>gnl|PID|d1010011 (D50738) cdc2 homolog [Nicotiana tabacum]
            Length = 294

  Plus Strand HSPs:

 Score = 333 (117.2 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 56/81 (69%), Positives = 69/81 (85%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMV   PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVTQRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR++GTPN   WP
Sbjct:   209 EIDELFKIFRVMGTPNEDTWP 229

 Score = 175 (61.6 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 151


>sp|Q06309|CRK1_LEIME CELL DIVISION PROTEIN KINASE 2 HOMOLOG CRK1 >pir||A48041
            protein kinase (EC 2.7.1.37) cdc2-related CRK1 - Leishmania
            mexicana >gi|9540 (X60385) cdc2-like protein [Leishmania mexicana]
            Length = 301

  Plus Strand HSPs:

 Score = 322 (113.3 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 55/82 (67%), Positives = 69/82 (84%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+F IPVRK+T+EVVTLWYR PDVL+GS +Y   +D+WSVGCIF+EM  GTPLF G +
Sbjct:   148 LGRSFAIPVRKFTNEVVTLWYRPPDVLLGSMQYGPPVDVWSVGCIFSEMATGTPLFAGKN 207

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             +ADQLMRIFR LGTPN++ WP+
Sbjct:   208 DADQLMRIFRFLGTPNNRVWPS 229

 Score = 186 (65.5 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 34/54 (62%), Positives = 42/54 (77%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G L++ T + F+  LL G+A+CH R VLHRDLKPQNLLI+RE ELK+ DFGL R
Sbjct:    97 GNLDAATIQHFMRDLLRGVAFCHQRSVLHRDLKPQNLLISREKELKLGDFGLGR 150


>pdb|1JST|A Homo sapiens >pdb|1JST|C Homo sapiens >pdb|1JSU|A Homo sapiens
            Length = 298

  Plus Strand HSPs:

 Score = 314 (110.5 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 56/81 (69%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR Y HEVVTLWYRAP++L+G K YST +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPVRTYXHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVVWP 228

 Score = 194 (68.3 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 37/61 (60%), Positives = 44/61 (72%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA 149

Query:   185 R 187
             R
Sbjct:   150 R 150


>sp|P38973|CC21_TRYBB CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 1 >pir||S19209
            protein kinase (EC 2.7.1.37) cdc2-like - Trypanosoma brucei
            >gi|10458 (X64314) cdc2-like protein kinase [Trypanosoma brucei]
            Length = 301

  Plus Strand HSPs:

 Score = 321 (113.0 bits), Expect = 4.8e-46, Sum P(2) = 4.8e-46
 Identities = 56/82 (68%), Positives = 69/82 (84%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + RAFGIPV+K+T EVVTLWYR+PDVL+GS +Y T +DIWSVGCIFAEM  G PLF G +
Sbjct:   148 LGRAFGIPVKKFTQEVVTLWYRSPDVLLGSTQYGTPVDIWSVGCIFAEMAIGAPLFTGKN 207

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             +ADQL+RIF+ LGTPN + WP+
Sbjct:   208 DADQLLRIFQFLGTPNRQVWPS 229

 Score = 185 (65.1 bits), Expect = 4.8e-46, Sum P(2) = 4.8e-46
 Identities = 35/60 (58%), Positives = 45/60 (75%), Frame = +2

Query:     8 YKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             Y  H  G L++ T + F+  LL+G+ +CH+R VLHRDLKP NLLI+RE ELK+ADFGL R
Sbjct:    91 YMDHVGGDLDAGTIQEFMRSLLSGVRFCHERNVLHRDLKPPNLLISREKELKLADFGLGR 150


>gi|1377888 (L77082) cdc2 gene product [Nicotiana tabacum]
            Length = 294

  Plus Strand HSPs:

 Score = 330 (116.2 bits), Expect = 6.1e-46, Sum P(2) = 6.1e-46
 Identities = 55/81 (67%), Positives = 69/81 (85%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+G++ YST +D+WSVGCIFAEMV   PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGTRHYSTPVDVWSVGCIFAEMVTQRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR++GTPN   WP
Sbjct:   209 EIDELFKIFRVMGTPNEDTWP 229

 Score = 175 (61.6 bits), Expect = 6.1e-46, Sum P(2) = 6.1e-46
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 151


>sp|P24923|CC21_MEDSA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 1 >pir||A39107
            protein kinase (EC 2.7.1.37) cdc2 homolog - alfalfa (fragment)
            >gi|166414 (M58365) serine threonine tyrosine kinase [Medicago
            sativa]
            Length = 291

  Plus Strand HSPs:

 Score = 330 (116.2 bits), Expect = 9.9e-46, Sum P(2) = 9.9e-46
 Identities = 57/81 (70%), Positives = 68/81 (83%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEM N  PL PG S
Sbjct:   146 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMANRRPLSPGDS 205

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFRILGTPN   WP
Sbjct:   206 EIDELFKIFRILGTPNEDTWP 226

 Score = 173 (60.9 bits), Expect = 9.9e-46, Sum P(2) = 9.9e-46
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   102 KMFLYQMLCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 148


>gi|1236190 (U18365) cyclin dependent protein kinase homolog; similar to moth
            bean p34cdc2 protein, PIR Accession Number JQ2243 [Brassica napus]
            Length = 294

  Plus Strand HSPs:

 Score = 329 (115.8 bits), Expect = 2.6e-45, Sum P(2) = 2.6e-45
 Identities = 57/81 (70%), Positives = 68/81 (83%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS  YST +DIWSVGCIFAEM++  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSHHYSTPVDIWSVGCIFAEMISQKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL +IFRI+GTP    WP
Sbjct:   209 EIDQLFKIFRIMGTPTEDTWP 229

 Score = 170 (59.8 bits), Expect = 2.6e-45, Sum P(2) = 2.6e-45
 Identities = 33/47 (70%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K ++ Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KRYVYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 151


>gi|1377890 (L77083) cdc2 gene product [Nicotiana tabacum]
            Length = 293

  Plus Strand HSPs:

 Score = 322 (113.3 bits), Expect = 4.2e-45, Sum P(2) = 4.2e-45
 Identities = 56/81 (69%), Positives = 68/81 (83%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMV   PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVTQRPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L R FR++GTPN   WP
Sbjct:   209 EIDELSR-FRVMGTPNEDTWP 228

 Score = 175 (61.6 bits), Expect = 4.2e-45, Sum P(2) = 4.2e-45
 Identities = 35/47 (74%), Positives = 38/47 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLAR 151


>sp|P24100|CC2A_ARATH CELL DIVISION CONTROL PROTEIN 2 HOMOLOG A >pir||S23095
            protein kinase (EC 2.7.1.37) cdc2 - Arabidopsis thaliana
            >bbs|109461 p34cdc2 protein kinase [Arabidopsis thaliana, flower,
            Peptide, 294 aa] >gi|16219 (X57839) p34(cdc2) [Arabidopsis
            thaliana] >gi|166784 (M59198) protein kinase [Arabidopsis thaliana]
            >gnl|PID|d1002098 (D10850) p32 protein serine/threonine kinase
            [Arabidopsis thaliana] >bbs|115411 (S45387) Aracdc2=p34cdc2 protein
            kinase homolog [Arabidopsis thaliana, ecotype Columbia, flowers,
            Peptide, 294 aa] [Arabidopsis thaliana]
            Length = 294

  Plus Strand HSPs:

 Score = 320 (112.6 bits), Expect = 6.8e-45, Sum P(2) = 6.8e-45
 Identities = 56/80 (70%), Positives = 67/80 (83%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS  YST +DIWSVGCIFAEM++  PLFPG S
Sbjct:   149 LARAFGIPVRTFTHEVVTLWYRAPEILLGSHHYSTPVDIWSVGCIFAEMISQKPLFPGDS 208

Query:   540 EADQLMRIFRILGTPNSKNW 599
             E DQL +IFRI+GTP    W
Sbjct:   209 EIDQLFKIFRIMGTPYEDTW 228

 Score = 175 (61.6 bits), Expect = 6.8e-45, Sum P(2) = 6.8e-45
 Identities = 34/47 (72%), Positives = 39/47 (82%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINRE-GELKIADFGLAR 187
             K++L Q+L GIAYCH  RVLHRDLKPQNLLI+R    LK+ADFGLAR
Sbjct:   105 KTYLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLAR 151


>gnl|PID|e321536 (Y13646) cyclin dependent kinase [Petunia x hybrida]
            Length = 307

  Plus Strand HSPs:

 Score = 333 (117.2 bits), Expect = 1.4e-44, Sum P(2) = 1.4e-44
 Identities = 56/81 (69%), Positives = 69/81 (85%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMV   PLFPG S
Sbjct:   154 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVTQRPLFPGDS 213

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR++GTPN   WP
Sbjct:   214 EIDELFKIFRVMGTPNEDTWP 234

 Score = 159 (56.0 bits), Expect = 1.4e-44, Sum P(2) = 1.4e-44
 Identities = 35/51 (68%), Positives = 37/51 (72%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHR----DLKPQNLLINRE-GELKIADFGLAR 187
             K FL Q+L GIAYCH  RVLHR    DLKPQNLLI R    LK+ADFGLAR
Sbjct:   106 KMFLYQILRGIAYCHSHRVLHRVLHRDLKPQNLLIGRRTNALKLADFGLAR 156


>gi|727249 (U15802) CDC2 [Paramecium tetraurelia]
           Length = 307

  Plus Strand HSPs:

 Score = 300 (105.6 bits), Expect = 9.8e-44, Sum P(2) = 9.8e-44
 Identities = 54/81 (66%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA GIPV+ +THEVVTLWYR PDVL+GSK Y+T+IDIWSVGCIF EM N  PLF G +
Sbjct:   153 LARASGIPVKSFTHEVVTLWYRPPDVLLGSKNYNTSIDIWSVGCIFGEMSNLKPLFAGSN 212

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL +IFR+LGTP+   +P
Sbjct:   213 ETDQLKKIFRVLGTPSPIEYP 233

 Score = 184 (64.8 bits), Expect = 9.8e-44, Sum P(2) = 9.8e-44
 Identities = 35/53 (66%), Positives = 43/53 (81%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G+E V  KSFL QLL GI  CH +++LHRDLKPQNLL +++G LK+ADFGLAR
Sbjct:   103 GMEPVIVKSFLYQLLRGIQACHQQKILHRDLKPQNLLGSKDGILKLADFGLAR 155


>pir||S53538 protein kinase (EC 2.7.1.37) cdc2 homolog - Paramecium tetraurelia
            (SGC5)
            Length = 308

  Plus Strand HSPs:

 Score = 300 (105.6 bits), Expect = 9.8e-44, Sum P(2) = 9.8e-44
 Identities = 54/81 (66%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA GIPV+ +THEVVTLWYR PDVL+GSK Y+T+IDIWSVGCIF EM N  PLF G +
Sbjct:   154 LARASGIPVKSFTHEVVTLWYRPPDVLLGSKNYNTSIDIWSVGCIFGEMSNLKPLFAGSN 213

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL +IFR+LGTP+   +P
Sbjct:   214 ETDQLKKIFRVLGTPSPIEYP 234

 Score = 184 (64.8 bits), Expect = 9.8e-44, Sum P(2) = 9.8e-44
 Identities = 35/53 (66%), Positives = 43/53 (81%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G+E V  KSFL QLL GI  CH +++LHRDLKPQNLL +++G LK+ADFGLAR
Sbjct:   104 GMEPVIVKSFLYQLLRGIQACHQQKILHRDLKPQNLLGSKDGILKLADFGLAR 156


>gnl|PID|e325272 (Z82059) T27E9.3 [Caenorhabditis elegans]
            Length = 296

  Plus Strand HSPs:

 Score = 289 (101.7 bits), Expect = 4.2e-43, Sum P(2) = 4.2e-43
 Identities = 52/83 (62%), Positives = 66/83 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFG+PVR ++ EVVTLWYR PDVL G+K Y+T+ID+WS GCIFAE+ N G PLFPG 
Sbjct:   147 LARAFGVPVRCFSAEVVTLWYRPPDVLFGAKLYNTSIDMWSAGCIFAEISNAGRPLFPGA 206

Query:   537 SEADQLMRIFRILGTPNSKNWPN 605
                DQL RIF+ LG+P+  NWP+
Sbjct:   207 DVDDQLKRIFKQLGSPSEDNWPS 229

 Score = 189 (66.5 bits), Expect = 4.2e-43, Sum P(2) = 4.2e-43
 Identities = 35/54 (64%), Positives = 44/54 (81%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G +++ TA+S +LQLL G+++CH   VLHRDLKPQNLLIN  G LK+ADFGLAR
Sbjct:    96 GYMDAQTARSLMLQLLRGLSFCHAHHVLHRDLKPQNLLINTNGTLKLADFGLAR 149


>pir||S23384 protein kinase (EC 2.7.1.37) cdc2-related PCTAIRE-2 - human
            Length = 523

  Plus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 9.6e-42, Sum P(2) = 9.6e-42
 Identities = 48/81 (59%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P + Y++EVVTLWYR PDVL+GS +YST ID+W VGCIF EM +G PLFPG +
Sbjct:   334 LARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGST 393

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               D+L  IFR+LGTP+ + WP
Sbjct:   394 VEDELHLIFRLLGTPSQETWP 414

 Score = 197 (69.3 bits), Expect = 9.6e-42, Sum P(2) = 9.6e-42
 Identities = 40/60 (66%), Positives = 47/60 (78%), Frame = +2

Query:     8 YKLHCIGGLESV-TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             Y   C G + S+   K FL Q+L G+AYCH R+VLHRDLKPQNLLIN +GELK+ADFGLA
Sbjct:   277 YMDDC-GNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLA 335

Query:   185 R 187
             R
Sbjct:   336 R 336


>sp|Q07002|KPT3_HUMAN SERINE/THREONINE PROTEIN KINASE PCTAIRE-3 >pir||S32831
            serine/threonine-specific protein kinase PCTAIRE-3 (EC 2.7.1.-) -
            human (fragment) >gi|297102 (X66362) serine/threonine protein
            kinase [Homo sapiens]
            Length = 380

  Plus Strand HSPs:

 Score = 258 (90.8 bits), Expect = 9.7e-42, Sum P(2) = 9.7e-42
 Identities = 45/81 (55%), Positives = 59/81 (72%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P + Y++EVVTLWYR PDVL+GS +YST I +W VGCI  EM  G PLFPG +
Sbjct:   192 LARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIAMWGVGCIHYEMATGRPLFPGST 251

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               ++L  IFR+LGTP  + WP
Sbjct:   252 VKEELHLIFRLLGTPTEETWP 272

 Score = 207 (72.9 bits), Expect = 9.7e-42, Sum P(2) = 9.7e-42
 Identities = 41/60 (68%), Positives = 47/60 (78%), Frame = +2

Query:     8 YKLHCIGGLESV-TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             Y  HC G L S+   K F+ QLL G+AYCH R++LHRDLKPQNLLIN  GELK+ADFGLA
Sbjct:   135 YLDHC-GNLMSMHNVKIFMFQLLRGLAYCHTRKILHRDLKPQNLLINERGELKLADFGLA 193

Query:   185 R 187
             R
Sbjct:   194 R 194


>sp|Q04899|KPT3_MOUSE SERINE/THREONINE-PROTEIN KINASE PCTAIRE-3 >pir||S30436
            protein kinase PCTAIRE-3 (EC 2.7.1.-) - mouse >gi|53613 (X69026)
            PCTAIRE-3 protein kinase [Mus musculus]
            Length = 451

  Plus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.2e-41, Sum P(2) = 1.2e-41
 Identities = 46/81 (56%), Positives = 61/81 (75%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P + Y++EVVTLWYR PDVL+GS +YST ID+W VGCI  EM  G PLFPG +
Sbjct:   263 LARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGST 322

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               ++L  IFR+LGTP  ++WP
Sbjct:   323 VKEELHLIFRLLGTPTEESWP 343

 Score = 204 (71.8 bits), Expect = 1.2e-41, Sum P(2) = 1.2e-41
 Identities = 40/60 (66%), Positives = 47/60 (78%), Frame = +2

Query:     8 YKLHCIGGLESV-TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             Y  HC G L ++   K F+ QLL G+AYCH R++LHRDLKPQNLLIN  GELK+ADFGLA
Sbjct:   206 YLDHC-GNLMNMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLA 264

Query:   185 R 187
             R
Sbjct:   265 R 265


>dbj||AB005540_1 (AB005540) PCTAIRE2 [Rattus rattus]
            Length = 523

  Plus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 1.2e-41, Sum P(2) = 1.2e-41
 Identities = 48/81 (59%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P + Y++EVVTLWYR PDVL+GS +YST ID+W VGCIF EM +G PLFPG +
Sbjct:   334 LARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGST 393

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               D+L  IFR+LGTP+ + WP
Sbjct:   394 VEDELHLIFRLLGTPSQETWP 414

 Score = 196 (69.0 bits), Expect = 1.2e-41, Sum P(2) = 1.2e-41
 Identities = 40/60 (66%), Positives = 46/60 (76%), Frame = +2

Query:     8 YKLHCIGGLESV-TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             Y   C G + S+   K FL Q+L G+AYCH R+VLHRDLKPQNLLIN  GELK+ADFGLA
Sbjct:   277 YMDDC-GSIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFGLA 335

Query:   185 R 187
             R
Sbjct:   336 R 336


>gnl|PID|e255553 (X99512) serine/threonine protein kinase [Drosophila
            melanogaster]
            Length = 509

  Plus Strand HSPs:

 Score = 281 (98.9 bits), Expect = 1.2e-41, Sum P(2) = 1.2e-41
 Identities = 48/82 (58%), Positives = 62/82 (75%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P   Y+HEVVTLWYR PDVL+GS +YST++D+W VGCIF EMV G P FPG+ 
Sbjct:   334 LARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIR 393

Query:   540 EA-DQLMRIFRILGTPNSKNWP 602
             +  DQL +IF++LGTP    WP
Sbjct:   394 DTYDQLDKIFKLLGTPTEDTWP 415

 Score = 194 (68.3 bits), Expect = 1.2e-41, Sum P(2) = 1.2e-41
 Identities = 37/54 (68%), Positives = 44/54 (81%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             GGL+    + FL QLL G++YCH RRVLHRD+KPQNLLI+  GELK+ADFGLAR
Sbjct:   283 GGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLAR 336


>gnl|PID|d1022319 (AB005541) PCTAIRE3 [Rattus rattus]
            Length = 451

  Plus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-41, Sum P(2) = 1.5e-41
 Identities = 46/81 (56%), Positives = 61/81 (75%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P + Y++EVVTLWYR PDVL+GS +YST ID+W VGCI  EM  G PLFPG +
Sbjct:   263 LARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGST 322

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               ++L  IFR+LGTP  ++WP
Sbjct:   323 VKEELHLIFRLLGTPTEESWP 343

 Score = 203 (71.5 bits), Expect = 1.5e-41, Sum P(2) = 1.5e-41
 Identities = 40/60 (66%), Positives = 47/60 (78%), Frame = +2

Query:     8 YKLHCIGGLESV-TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             Y  HC G L ++   K F+ QLL G+AYCH R++LHRDLKPQNLLIN  GELK+ADFGLA
Sbjct:   206 YLDHC-GNLMNMHNVKIFMFQLLRGLAYCHRRKILHRDLKPQNLLINERGELKLADFGLA 264

Query:   185 R 187
             R
Sbjct:   265 R 265


>sp|Q00537|KPT2_HUMAN SERINE/THREONINE-PROTEIN KINASE PCTAIRE-2 >gi|36617
            (X66360) serine/threonine protein kinase [Homo sapiens]
            Length = 523

  Plus Strand HSPs:

 Score = 274 (96.5 bits), Expect = 4.6e-41, Sum P(2) = 4.6e-41
 Identities = 47/81 (58%), Positives = 62/81 (76%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P + Y++EVVTLWYR PDVL+GS +Y T ID+W VGCIF EM +G PLFPG +
Sbjct:   334 LARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYLTQIDMWGVGCIFFEMASGRPLFPGST 393

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               D+L  IFR+LGTP+ + WP
Sbjct:   394 VEDELHLIFRLLGTPSQETWP 414

 Score = 197 (69.3 bits), Expect = 4.6e-41, Sum P(2) = 4.6e-41
 Identities = 40/60 (66%), Positives = 47/60 (78%), Frame = +2

Query:     8 YKLHCIGGLESV-TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             Y   C G + S+   K FL Q+L G+AYCH R+VLHRDLKPQNLLIN +GELK+ADFGLA
Sbjct:   277 YMDDC-GNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLA 335

Query:   185 R 187
             R
Sbjct:   336 R 336


>sp|Q00536|KPT1_HUMAN SERINE/THREONINE-PROTEIN KINASE PCTAIRE-1 >pir||S23385
            protein kinase (EC 2.7.1.37) cdc2-related PCTAIRE-1 - human
            >gi|36619 (X66363) serine/threonine protein kinase [Homo sapiens]
            Length = 496

  Plus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 8.0e-41, Sum P(2) = 8.0e-41
 Identities = 49/81 (60%), Positives = 60/81 (74%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  IP + Y++EVVTLWYR PD+L+GS  YST ID+W VGCIF EM  G PLFPG +
Sbjct:   307 LARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGST 366

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               +QL  IFRILGTP  + WP
Sbjct:   367 VEEQLHFIFRILGTPTEETWP 387

 Score = 192 (67.6 bits), Expect = 8.0e-41, Sum P(2) = 8.0e-41
 Identities = 36/46 (78%), Positives = 40/46 (86%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K FL QLL G+AYCH ++VLHRDLKPQNLLIN  GELK+ADFGLAR
Sbjct:   264 KLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLAR 309

 Score = 38 (13.4 bits), Expect = 1.1e-24, Sum P(2) = 1.1e-24
 Identities = 9/23 (39%), Positives = 14/23 (60%), Frame = +2

Query:   221 EYLILCIHIIFRYNMYFFFFFLM 289
             +YL  C +II  +N+  F F L+
Sbjct:   249 QYLDDCGNIINMHNVKLFLFQLL 271


>sp|Q04735|KPT1_MOUSE SERINE/THREONINE-PROTEIN KINASE PCTAIRE-1 (CRK5)
            >pir||S30435 protein kinase PCTAIRE-1 (EC 2.7.1.-) - mouse
            >gi|53611 (X69025) PCTAIRE-1 protein kinase [Mus musculus]
            Length = 496

  Plus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 8.0e-41, Sum P(2) = 8.0e-41
 Identities = 49/81 (60%), Positives = 60/81 (74%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  IP + Y++EVVTLWYR PD+L+GS  YST ID+W VGCIF EM  G PLFPG +
Sbjct:   307 LARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGST 366

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               +QL  IFRILGTP  + WP
Sbjct:   367 VEEQLHFIFRILGTPTEETWP 387

 Score = 192 (67.6 bits), Expect = 8.0e-41, Sum P(2) = 8.0e-41
 Identities = 36/46 (78%), Positives = 40/46 (86%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K FL QLL G+AYCH ++VLHRDLKPQNLLIN  GELK+ADFGLAR
Sbjct:   264 KLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLAR 309


>gi|2392814 (U62391) PFTAIRE kinase [Mus musculus]
            Length = 423

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 5.3e-40, Sum P(2) = 5.3e-40
 Identities = 47/82 (57%), Positives = 60/82 (73%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P   Y++EVVTLWYR PDVL+GS +YST +D+W VGCIF EM+ G   FPG+ 
Sbjct:   231 LARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMK 290

Query:   540 EA-DQLMRIFRILGTPNSKNWP 602
             +  DQL RIF +LGTPN   WP
Sbjct:   291 DIQDQLERIFLVLGTPNEDTWP 312

 Score = 184 (64.8 bits), Expect = 5.3e-40, Sum P(2) = 5.3e-40
 Identities = 36/54 (66%), Positives = 41/54 (75%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             GGL     K FL QLL G++Y H R +LHRDLKPQNLLI+  GELK+ADFGLAR
Sbjct:   180 GGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLAR 233


>pir||JC5111 cyclin-dependent kinase-related protein 1b - rat >gi|1040968
            (U36444) PCTAIRE-1b Protein Kinase [Rattus rattus]
            Length = 461

  Plus Strand HSPs:

 Score = 259 (91.2 bits), Expect = 7.9e-39, Sum P(2) = 7.9e-39
 Identities = 47/81 (58%), Positives = 57/81 (70%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++ A  IP + Y++EVVTLWYR PD+L+GS  YS  ID+W VGCIF EM  G PLFPG +
Sbjct:   272 LAYAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSGQIDMWGVGCIFYEMATGRPLFPGST 331

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               +QL  IFRILGTP    WP
Sbjct:   332 VEEQLHFIFRILGTPTEDTWP 352

 Score = 188 (66.2 bits), Expect = 7.9e-39, Sum P(2) = 7.9e-39
 Identities = 39/59 (66%), Positives = 44/59 (74%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLNIITLEY 226
             K FL QLL G+AYCH ++VLHRDLKPQNLLIN  GELK+ADFGLA    Y  +I T  Y
Sbjct:   229 KLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLA----YAKSIPTKTY 283


>pir||JC5110 cyclin-dependent kinase-related protein 1a - rat >gi|1040967
            (U36444) PCTAIRE-1a protein kinase [Rattus rattus]
            Length = 496

  Plus Strand HSPs:

 Score = 259 (91.2 bits), Expect = 1.4e-38, Sum P(2) = 1.4e-38
 Identities = 47/81 (58%), Positives = 57/81 (70%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++ A  IP + Y++EVVTLWYR PD+L+GS  YS  ID+W VGCIF EM  G PLFPG +
Sbjct:   307 LAYAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSGQIDMWGVGCIFYEMATGRPLFPGST 366

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               +QL  IFRILGTP    WP
Sbjct:   367 VEEQLHFIFRILGTPTEDTWP 387

 Score = 188 (66.2 bits), Expect = 1.4e-38, Sum P(2) = 1.4e-38
 Identities = 39/59 (66%), Positives = 44/59 (74%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLNIITLEY 226
             K FL QLL G+AYCH ++VLHRDLKPQNLLIN  GELK+ADFGLA    Y  +I T  Y
Sbjct:   264 KLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLA----YAKSIPTKTY 318


>gi|1326380 (U58751) coded for by C. elegans cDNA yk39d9.5; coded for by C.
            elegans cDNA yk39d9.5; coded for by C. elegans cDNA yk74b12.5;
            coded for by C. elegans cDNA yk113c1.5; coded for by C. elegans
            cDNA yk46h3.5; coded for by C. elegans cDNA yk74b1...
            Length = 577

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 9.8e-37, Sum P(2) = 9.8e-37
 Identities = 44/81 (54%), Positives = 56/81 (69%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  +P + Y++EVVTLWYR PDVL+GS  YST ID+W VGCI  EM+ G  LFPG +
Sbjct:   380 LARAKSVPTKTYSNEVVTLWYRPPDVLLGSTDYSTHIDMWGVGCILFEMIAGRALFPGGT 439

Query:   540 EADQLMRIFRILGTPNSKNWP 602
               +QL  IFR LG+P     P
Sbjct:   440 PTEQLGLIFRTLGSPRPDRHP 460

 Score = 197 (69.3 bits), Expect = 9.8e-37, Sum P(2) = 9.8e-37
 Identities = 38/60 (63%), Positives = 44/60 (73%), Frame = +2

Query:     8 YKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             Y   C   ++    + FL QLL G+AYCH RRVLHRDLKPQNLLI  +GELK+ADFGLAR
Sbjct:   323 YMDSCNNAMQMNNIRLFLYQLLRGLAYCHQRRVLHRDLKPQNLLITAKGELKLADFGLAR 382


>pir||A38282 p58 galactosyltransferase-associated protein kinase - human
            Length = 434

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 2.3e-36, Sum P(2) = 2.3e-36
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   222 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 281

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   282 EIDQINKVFKDLGTPSEKIWP 302

 Score = 139 (48.9 bits), Expect = 2.3e-36, Sum P(2) = 2.3e-36
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   179 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 224


>gi|189481 (M37712) p58/GTA protein kinase [Homo sapiens]
           Length = 439

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 2.7e-36, Sum P(2) = 2.7e-36
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   227 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 286

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   287 EIDQINKVFKDLGTPSEKIWP 307

 Score = 139 (48.9 bits), Expect = 2.7e-36, Sum P(2) = 2.7e-36
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   184 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 229


>gi|507158 (U04815) PITSLRE alpha 1 [Homo sapiens]
           Length = 461

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 5.0e-36, Sum P(2) = 5.0e-36
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   249 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 308

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   309 EIDQINKVFKDLGTPSEKIWP 329

 Score = 139 (48.9 bits), Expect = 5.0e-36, Sum P(2) = 5.0e-36
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   206 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 251


>sp|P21127|KP58_HUMAN GALACTOSYLTRANSFERASE ASSOCIATED PROTEIN KINASE P58/GTA
            (CELL DIVISION CYCLE 2-LIKE 1) (CLK-1) (P58 CLK-1)
            Length = 436

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 1.3e-35, Sum P(2) = 1.3e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   224 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 283

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   284 EIDQINKVFKDLGTPSEKIWP 304

 Score = 139 (48.9 bits), Expect = 1.3e-35, Sum P(2) = 1.3e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   181 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 226


>pir||A42823 cell division control-related protein kinase p58clk-1 - human
            Length = 439

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 1.5e-35, Sum P(2) = 1.5e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   227 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 286

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   287 EIDQINKVFKDLGTPSEKIWP 307

 Score = 139 (48.9 bits), Expect = 1.5e-35, Sum P(2) = 1.5e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   184 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 229


>gi|189496 (M88565) p58 protein kinase [Homo sapiens]
           Length = 446

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 1.8e-35, Sum P(2) = 1.8e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   234 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 293

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   294 EIDQINKVFKDLGTPSEKIWP 314

 Score = 139 (48.9 bits), Expect = 1.8e-35, Sum P(2) = 1.8e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   191 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 236


>gi|507166 (U04819) PITSLRE beta 1 [Homo sapiens]
           Length = 439

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 2.0e-35, Sum P(2) = 2.0e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   227 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 286

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   287 EIDQINKVFKELGTPSEKIWP 307

 Score = 139 (48.9 bits), Expect = 2.0e-35, Sum P(2) = 2.0e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   184 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 229


>sp|P46892|KP58_RAT GALACTOSYLTRANSFERASE ASSOCIATED PROTEIN KINASE P58/GTA
            >pir||S47628 GTA-kinase - rat
            Length = 436

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 2.4e-35, Sum P(2) = 2.4e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST  D+WSVGCIF E++   PLFPG S
Sbjct:   224 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTACDMWSVGCIFGELLTQKPLFPGKS 283

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             + DQ+ +IF+ +GTP+ K WP
Sbjct:   284 DIDQINKIFKDIGTPSEKIWP 304

 Score = 139 (48.9 bits), Expect = 2.4e-35, Sum P(2) = 2.4e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL+G+ + HD  +LHRDLK  NLL+   G LK+ DFGLAR
Sbjct:   181 KTLMIQLLSGVKHLHDNWILHRDLKTSNLLLTHAGILKVGDFGLAR 226


>gi|507164 (U04818) PITSLRE alpha 2-4 [Homo sapiens]
           Length = 562

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 2.4e-35, Sum P(2) = 2.4e-35
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   350 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 409

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   410 EIDQINKVFKDLGTPSEKIWP 430

 Score = 139 (48.9 bits), Expect = 2.4e-35, Sum P(2) = 2.4e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   307 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 352


>pir||S47430 protein kinase (EC 2.7.1.37) cdc2 - Sitka spruce (fragment)
            >gi|530757 (X80846) cdc2Ps gene product [Picea sitchensis]
            >gi|758205 (X77681) cdc2Pa [Picea abies]
            Length = 105

  Plus Strand HSPs:

 Score = 343 (120.7 bits), Expect = 2.5e-35, Sum P(2) = 2.5e-35
 Identities = 58/81 (71%), Positives = 71/81 (87%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR +THEVVTLWYRAP++L+GS+ YST +D+WSVGCIFAEMVN  PLFPG S
Sbjct:    18 LARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDS 77

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D+L +IFR+LGTPN + WP
Sbjct:    78 EIDELFKIFRVLGTPNEETWP 98

 Score = 61 (21.5 bits), Expect = 2.5e-35, Sum P(2) = 2.5e-35
 Identities = 14/20 (70%), Positives = 17/20 (85%), Frame = +2

Query:   131 NLLINRE-GELKIADFGLAR 187
             NLLI+R+   LK+ADFGLAR
Sbjct:     1 NLLIDRKTNALKLADFGLAR 20


>gi|1129065 (L24388) galactosyltransferase-associated kinase [Rattus
            norvegicus]
            Length = 438

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 2.5e-35, Sum P(2) = 2.5e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST  D+WSVGCIF E++   PLFPG S
Sbjct:   226 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTACDMWSVGCIFGELLTQKPLFPGKS 285

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             + DQ+ +IF+ +GTP+ K WP
Sbjct:   286 DIDQINKIFKDIGTPSEKIWP 306

 Score = 139 (48.9 bits), Expect = 2.5e-35, Sum P(2) = 2.5e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL+G+ + HD  +LHRDLK  NLL+   G LK+ DFGLAR
Sbjct:   183 KTLMIQLLSGVKHLHDNWILHRDLKTSNLLLTHAGILKVGDFGLAR 228


>sp|P24788|KP58_MOUSE GALACTOSYLTRANSFERASE ASSOCIATED PROTEIN KINASE P58/GTA
            >gi|200208 (M58633) p58/GTA protein kinase [Mus musculus]
            Length = 434

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 4.0e-35, Sum P(2) = 4.0e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST  D+WSVGCIF E++   PLFPG S
Sbjct:   222 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTACDMWSVGCIFGELLTQKPLFPGKS 281

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             + DQ+ +IF+ LG+P+ K WP
Sbjct:   282 DIDQINKIFKDLGSPSEKIWP 302

 Score = 139 (48.9 bits), Expect = 4.0e-35, Sum P(2) = 4.0e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL+G+ + HD  +LHRDLK  NLL+   G LK+ DFGLAR
Sbjct:   179 KTLMIQLLSGVKHLHDNWILHRDLKTSNLLLTHAGILKVGDFGLAR 224


>pir||A53227 galactosyltransferase-associated protein kinase - mouse
            Length = 436

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 4.2e-35, Sum P(2) = 4.2e-35
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST  D+WSVGCIF E++   PLFPG S
Sbjct:   224 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTACDMWSVGCIFGELLTQKPLFPGKS 283

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             + DQ+ +IF+ LG+P+ K WP
Sbjct:   284 DIDQINKIFKDLGSPSEKIWP 304

 Score = 139 (48.9 bits), Expect = 4.2e-35, Sum P(2) = 4.2e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL+G+ + HD  +LHRDLK  NLL+   G LK+ DFGLAR
Sbjct:   181 KTLMIQLLSGVKHLHDNWILHRDLKTSNLLLTHAGILKVGDFGLAR 226


>pir||A54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha-1 - human
            Length = 461

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 5.8e-35, Sum P(2) = 5.8e-35
 Identities = 44/81 (54%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  V+T WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   249 LAREYGSPLKAYTPVVLTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 308

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   309 EIDQINKVFKDLGTPSEKIWP 329

 Score = 139 (48.9 bits), Expect = 5.8e-35, Sum P(2) = 5.8e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   206 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 251


>pir||I50463 protein kinase - chicken >gi|571460 (U16656) protein kinase
            [Gallus gallus]
            Length = 772

  Plus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 6.8e-35, Sum P(2) = 6.8e-35
 Identities = 47/81 (58%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST ID+WSVGCIF E++   PLFPG S
Sbjct:   560 LAREYGSPLKPYTPVVVTLWYRAPELLLGAKEYSTAIDMWSVGCIFGELLTQKPLFPGKS 619

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   620 EIDQINKVFKDLGTPSEKIWP 640

 Score = 140 (49.3 bits), Expect = 6.8e-35, Sum P(2) = 6.8e-35
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   517 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHSGILKVGDFGLAR 562


>gi|507162 (U04817) PITSLRE alpha 2-3 [Homo sapiens]
           Length = 768

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   556 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 615

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   616 EIDQINKVFKDLGTPSEKIWP 636

 Score = 139 (48.9 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   513 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 558


>gi|507160 (U04816) PITSLRE alpha 2-2 [Homo sapiens]
           Length = 777

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   565 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 624

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   625 EIDQINKVFKDLGTPSEKIWP 645

 Score = 139 (48.9 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   522 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 567


>gi|507168 (U04824) PITSLRE alpha 2-1 [Homo sapiens]
           Length = 779

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   567 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 626

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   627 EIDQINKVFKDLGTPSEKIWP 647

 Score = 139 (48.9 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   524 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 569


>sp|P29620|KC47_ORYSA CDC2+/CDC28-RELATED PROTEIN KINASE R2 >pir||S13934
            protein kinase (EC 2.7.1.37) chain cdc2/cdc28 homolog - rice
            >gi|20194 (X58194) cdc2+/CDC28-related protein kinase [Oryza
            sativa]
            Length = 424

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 1.2e-34, Sum P(2) = 1.2e-34
 Identities = 40/82 (48%), Positives = 56/82 (68%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R FG P R +TH+V   WYRAP++L G+K+Y + +DIW+ GCIFAE++   P   G S
Sbjct:   162 LARIFGSPERNFTHQVFARWYRAPELLFGTKQYGSAVDIWAAGCIFAELLLRRPFLQGSS 221

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + DQL +IF   GTP S  WP+
Sbjct:   222 DIDQLGKIFAAFGTPKSSQWPD 243

 Score = 164 (57.7 bits), Expect = 1.2e-34, Sum P(2) = 1.2e-34
 Identities = 29/52 (55%), Positives = 39/52 (75%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             L     KS++  +L G+A+CH + VLHRD+KP NLLI  +G+LK+ADFGLAR
Sbjct:   113 LSPADTKSYIQMMLKGLAFCHKKWVLHRDMKPNNLLIGADGQLKLADFGLAR 164


>sp|P50613|CDK7_HUMAN CELL DIVISION PROTEIN KINASE 7 (CDK-ACTIVATING KINASE)
            (CAK) (39 KD PROTEIN KINASE) (P39 MO15) (STK1) (CAK1) >pir||A54820
            CDK-activating protein kinase (CAK) (EC 2.7.1.-) 40K chain - human
            >gi|348243 (L20320) protein serine/threonine kinase [Homo sapiens]
            >gi|468789 (X77743) CDK activating kinase [Homo sapiens] >gi|485909
            (X79193) MO15/CDK-activating kinase (CAK) [Homo sapiens]
            >gnl|PID|e257806 (X77303) Cdk-activating kinase [Homo sapiens]
            Length = 346

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 1.3e-34, Sum P(2) = 1.3e-34
 Identities = 42/82 (51%), Positives = 59/82 (71%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++++FG P R YTH+VVT WYRAP++L G++ Y   +D+W+VGCI AE++   P  PG S
Sbjct:   158 LAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDS 217

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + DQL RIF  LGTP  + WP+
Sbjct:   218 DLDQLTRIFETLGTPTEEQWPD 239

 Score = 142 (50.0 bits), Expect = 1.3e-34, Sum P(2) = 1.3e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+++L  L G+ Y H   +LHRDLKP NLL++  G LK+ADFGLA+
Sbjct:   115 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 160


>sp|Q03147|CDK7_MOUSE CELL DIVISION PROTEIN KINASE 7 (CDK-ACTIVATING KINASE)
            (CAK) (39 KD PROTEIN KINASE) (P39 MO15) (PROTEIN-TYROSINE KINASE
            MPK-7) (CR4 PROTEIN KINASE) (CRK4) >pir||A56231 MO15/CDK-activating
            protein kinase CAK (EC 2.7.1.-) - mouse >gi|562024 (U11822)
            MO15-associated kinase [Mus musculus]
            Length = 346

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 1.3e-34, Sum P(2) = 1.3e-34
 Identities = 42/82 (51%), Positives = 59/82 (71%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++++FG P R YTH+VVT WYRAP++L G++ Y   +D+W+VGCI AE++   P  PG S
Sbjct:   158 LAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDS 217

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + DQL RIF  LGTP  + WP+
Sbjct:   218 DLDQLTRIFETLGTPTEEQWPD 239

 Score = 142 (50.0 bits), Expect = 1.3e-34, Sum P(2) = 1.3e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+++L  L G+ Y H   +LHRDLKP NLL++  G LK+ADFGLA+
Sbjct:   115 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 160


>gnl|PID|e318801 (Y13120) serine/threonine protein kinase [Homo sapiens]
            Length = 346

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 1.3e-34, Sum P(2) = 1.3e-34
 Identities = 42/82 (51%), Positives = 59/82 (71%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++++FG P R YTH+VVT WYRAP++L G++ Y   +D+W+VGCI AE++   P  PG S
Sbjct:   158 LAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDS 217

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + DQL RIF  LGTP  + WP+
Sbjct:   218 DLDQLTRIFETLGTPTEEQWPD 239

 Score = 142 (50.0 bits), Expect = 1.3e-34, Sum P(2) = 1.3e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+++L  L G+ Y H   +LHRDLKP NLL++  G LK+ADFGLA+
Sbjct:   115 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 160


>pir||A55817 cyclin-dependent kinase p130-PITSLRE - mouse >gi|561746 (L37092)
            cyclin-dependent protein kinase [Mus musculus]
            Length = 783

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.5e-34, Sum P(2) = 1.5e-34
 Identities = 46/81 (56%), Positives = 65/81 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVTLWYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   571 LAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKS 630

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             + DQ+ +IF+ LGTP+ K WP
Sbjct:   631 DIDQINKIFKDLGTPSEKIWP 651

 Score = 140 (49.3 bits), Expect = 1.5e-34, Sum P(2) = 1.5e-34
 Identities = 25/46 (54%), Positives = 35/46 (76%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL+G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   528 KTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 573


>pir||S34652 cell division cycle-2-related protein kinase (EC 2.7.1.-) CRK4 -
            mouse >gi|395048 (X74145) protein kinase [Mus musculus]
            Length = 346

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 1.7e-34, Sum P(2) = 1.7e-34
 Identities = 42/82 (51%), Positives = 59/82 (71%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++++FG P R YTH+VVT WYRAP++L G++ Y   +D+W+VGCI AE++   P  PG S
Sbjct:   158 LAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDS 217

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + DQL RIF  LGTP  + WP+
Sbjct:   218 DLDQLTRIFETLGTPTEEQWPD 239

 Score = 141 (49.6 bits), Expect = 1.7e-34, Sum P(2) = 1.7e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+++L  L G+ Y H   +LHRDLKP NLL++  G LK+ADFGLA+
Sbjct:   115 KAYMLMTLQGLEYLHHNWILHRDLKPNNLLLDENGVLKLADFGLAK 160


>bbs|171000 (S79590) Mo15=putative protein kinase-subunit of Cdc-2-activating
            kinase [Dictyostelium discoideum, V12-M2, Peptide, 362 aa]
            [Dictyostelium discoideum] >prf||2115201A Mo15 kinase-related
            protein [Dictyostelium discoideum]
            Length = 362

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 3.5e-34, Sum P(2) = 3.5e-34
 Identities = 40/81 (49%), Positives = 58/81 (71%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P + ++ + VT++YRAP++L G+K Y  ++DIWS+GCIFAE++  TP  PG  
Sbjct:   151 LARQYGSPNKVFSPQAVTIFYRAPELLFGAKSYGPSVDIWSIGCIFAELMLRTPYLPGTG 210

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL +I   LGTPN  NWP
Sbjct:   211 EIDQLRKICSALGTPNESNWP 231

 Score = 151 (53.2 bits), Expect = 3.5e-34, Sum P(2) = 3.5e-34
 Identities = 30/52 (57%), Positives = 37/52 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             L+    KS++  LL GI  CH   VLHRDLKP NLL++  G+LK+ADFGLAR
Sbjct:   102 LKPADIKSYMKMLLQGIEACHRNWVLHRDLKPNNLLMSINGDLKLADFGLAR 153


>sp|P54685|CDK7_DICDI CELL DIVISION PROTEIN KINASE 7 (CDK-ACTIVATING KINASE)
            (CAK) (MO15 HOMOLOG)
            Length = 362

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 3.5e-34, Sum P(2) = 3.5e-34
 Identities = 40/81 (49%), Positives = 58/81 (71%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P + ++ + VT++YRAP++L G+K Y  ++DIWS+GCIFAE++  TP  PG  
Sbjct:   151 LARQYGSPNKVFSPQAVTIFYRAPELLFGAKSYGPSVDIWSIGCIFAELMLRTPYLPGTG 210

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL +I   LGTPN  NWP
Sbjct:   211 EIDQLRKICSALGTPNESNWP 231

 Score = 151 (53.2 bits), Expect = 3.5e-34, Sum P(2) = 3.5e-34
 Identities = 30/52 (57%), Positives = 37/52 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             L+    KS++  LL GI  CH   VLHRDLKP NLL++  G+LK+ADFGLAR
Sbjct:   102 LKPADIKSYMKMLLQGIEACHRNWVLHRDLKPNNLLMSINGDLKLADFGLAR 153


>pir||F54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE beta 2-1 - human
            Length = 777

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 5.0e-34, Sum P(2) = 5.0e-34
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   565 LAREYGSPLKAYTFVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 624

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   625 EIDQINKVFKELGTPSEKIWP 645

 Score = 139 (48.9 bits), Expect = 5.0e-34, Sum P(2) = 5.0e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   522 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 567


>pir||G54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE beta 2-2 - human
            Length = 766

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 6.1e-34, Sum P(2) = 6.1e-34
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   554 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 613

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   614 EIDQINKVFKELGTPSEKIWP 634

 Score = 139 (48.9 bits), Expect = 6.1e-34, Sum P(2) = 6.1e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   511 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 556


>pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-3 -
            human
            Length = 768

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 6.2e-34, Sum P(2) = 6.2e-34
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   556 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 615

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   616 EIDQINKVFKELGTPSEKIWP 636

 Score = 139 (48.9 bits), Expect = 6.2e-34, Sum P(2) = 6.2e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   513 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 558


>gi|507429 (U07705) PITSLRE isoform PBETA22 [Homo sapiens]
           Length = 775

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 6.4e-34, Sum P(2) = 6.4e-34
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   563 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 622

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   623 EIDQINKVFKELGTPSEKIWP 643

 Score = 139 (48.9 bits), Expect = 6.4e-34, Sum P(2) = 6.4e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   520 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 565


>gi|507427 (U07704) PITSLRE isoform PBETA21 [Homo sapiens]
           Length = 777

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 6.5e-34, Sum P(2) = 6.5e-34
 Identities = 45/81 (55%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  VVT WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   565 LAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 624

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   625 EIDQINKVFKELGTPSEKIWP 645

 Score = 139 (48.9 bits), Expect = 6.5e-34, Sum P(2) = 6.5e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   522 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 567


>pir||S51085 CdK-activating kinase Cdk7 - rat (fragment) >gi|619509 (X83579)
            CdK-activating kinase Cdk7 [Rattus norvegicus]
            Length = 312

  Plus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 9.2e-34, Sum P(2) = 9.2e-34
 Identities = 41/82 (50%), Positives = 58/82 (70%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++++FG P   YTH+VVT WYRAP++L G++ Y   +D+W+VGCI AE++   P  PG S
Sbjct:   150 LAKSFGSPNWAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDS 209

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + DQL RIF  LGTP  + WP+
Sbjct:   210 DLDQLTRIFETLGTPTEEQWPD 231

 Score = 142 (50.0 bits), Expect = 9.2e-34, Sum P(2) = 9.2e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+++L  L G+ Y H   +LHRDLKP NLL++  G LK+ADFGLA+
Sbjct:   107 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 152


>sp|P51952|CDK7_RAT CELL DIVISION PROTEIN KINASE 7 (CDK-ACTIVATING KINASE)
            (CAK) (39 KD PROTEIN KINASE) (P39 MO15)
            Length = 329

  Plus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 9.2e-34, Sum P(2) = 9.2e-34
 Identities = 41/82 (50%), Positives = 58/82 (70%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++++FG P   YTH+VVT WYRAP++L G++ Y   +D+W+VGCI AE++   P  PG S
Sbjct:   150 LAKSFGSPNWAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDS 209

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + DQL RIF  LGTP  + WP+
Sbjct:   210 DLDQLTRIFETLGTPTEEQWPD 231

 Score = 142 (50.0 bits), Expect = 9.2e-34, Sum P(2) = 9.2e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+++L  L G+ Y H   +LHRDLKP NLL++  G LK+ADFGLA+
Sbjct:   107 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 152


>pir||E54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-1 -
            human
            Length = 779

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 1.1e-33, Sum P(2) = 1.1e-33
 Identities = 44/81 (54%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  V+T WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   567 LAREYGSPLKAYTFVVLTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 626

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   627 EIDQINKVFKELGTPSEKIWP 647

 Score = 139 (48.9 bits), Expect = 1.1e-33, Sum P(2) = 1.1e-33
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   524 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 569


>pir||B54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-2 -
            human
            Length = 777

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.4e-33, Sum P(2) = 1.4e-33
 Identities = 44/81 (54%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R +G P++ YT  V+T WYRAP++L+G+K+YST +D+WSVGCIF E++   PLFPG S
Sbjct:   565 LAREYGSPLKAYTPVVLTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS 624

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ ++F+ LGTP+ K WP
Sbjct:   625 EIDQINKVFKELGTPSEKIWP 645

 Score = 139 (48.9 bits), Expect = 1.4e-33, Sum P(2) = 1.4e-33
 Identities = 25/46 (54%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ ++QLL G+ + HD  +LHRDLK  NLL++  G LK+ DFGLAR
Sbjct:   522 KTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAR 567


>gnl|PID|e330421 (Z92847) H01G02.2 [Caenorhabditis elegans]
            Length = 305

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 1.9e-33, Sum P(2) = 1.9e-33
 Identities = 43/75 (57%), Positives = 55/75 (73%), Frame = +3

Query:   381 PVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMR 560
             P ++Y   V T WYRAP++L GSKKY   +DIW++GCI AE+V G P+FPG SE +Q+  
Sbjct:   139 PNQEYDVNVATRWYRAPELLFGSKKYKPDVDIWAIGCILAELVRGKPIFPGRSELEQISI 198

Query:   561 IFRILGTPNSKNWPN 605
             IF +LGTPN  NWPN
Sbjct:   199 IFGVLGTPNEDNWPN 213

 Score = 131 (46.1 bits), Expect = 1.9e-33, Sum P(2) = 1.9e-33
 Identities = 23/50 (46%), Positives = 34/50 (68%), Frame = +2

Query:    35 ESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             E V    +  Q+L+GIAY H + ++HRD+KP+N+L+     +KIADFG A
Sbjct:    82 EEVPYTWYYTQILSGIAYLHSKEIMHRDIKPENILVTSRNVVKIADFGQA 131


>gi|1303658 (L77991) cyclin-dependent kinase [Gallus gallus]
            Length = 326

  Plus Strand HSPs:

 Score = 224 (78.9 bits), Expect = 2.4e-33, Sum P(2) = 2.4e-33
 Identities = 41/70 (58%), Positives = 52/70 (74%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G S+ DQL +IF ++
Sbjct:   177 TSVVVTLWYRAPEVLLQSS-YATPVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVI 235

Query:   576 GTPNSKNWPN 605
             G P  ++WPN
Sbjct:   236 GLPEEEDWPN 245

 Score = 161 (56.7 bits), Expect = 2.4e-33, Sum P(2) = 2.4e-33
 Identities = 28/53 (52%), Positives = 39/53 (73%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G+ + T K  +LQL  G+ + H  RV+HRDLKPQN+L+   G++K+ADFGLAR
Sbjct:   116 GVPTETIKDMMLQLFRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLAR 168


>gi|1695919 (U73195) MO15-related protein kinase Pfmrk [Plasmodium falciparum]
            Length = 324

  Plus Strand HSPs:

 Score = 246 (86.6 bits), Expect = 1.3e-32, Sum P(2) = 1.3e-32
 Identities = 43/69 (62%), Positives = 56/69 (81%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T +VVTLWYRAP++L+GS KY+++ID+WS GCIFAE++    LFPG +E DQL +IF +L
Sbjct:   182 TSKVVTLWYRAPELLLGSNKYNSSIDMWSFGCIFAELLLQKALFPGENEIDQLGKIFFLL 241

Query:   576 GTPNSKNWP 602
             GTPN  NWP
Sbjct:   242 GTPNENNWP 250

 Score = 132 (46.5 bits), Expect = 1.3e-32, Sum P(2) = 1.3e-32
 Identities = 24/44 (54%), Positives = 32/44 (72%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGL 181
             K  LLQ+LNG+   H    +HRDL P N+ IN++GE+K+ADFGL
Sbjct:   114 KCILLQILNGLNVLHKYYFMHRDLSPANIFINKKGEVKLADFGL 157


>gnl|PID|e292745 (X97314) cdc2MsC [Medicago sativa]
            Length = 509

  Plus Strand HSPs:

 Score = 234 (82.4 bits), Expect = 2.3e-32, Sum P(2) = 2.3e-32
 Identities = 36/69 (52%), Positives = 53/69 (76%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T+ V+TLWYR P++L+G+ +Y   +D+WSVGCIFAE+++G P+FPG  E +QL +IF + 
Sbjct:   197 TNRVITLWYRPPELLLGTTRYGPAVDMWSVGCIFAELLHGKPIFPGKDEPEQLNKIFELC 256

Query:   576 GTPNSKNWP 602
             G P+  NWP
Sbjct:   257 GAPDEVNWP 265

 Score = 156 (54.9 bits), Expect = 2.3e-32, Sum P(2) = 2.3e-32
 Identities = 29/46 (63%), Positives = 36/46 (78%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K ++ QLL G+ YCH  +VLHRD+K  NLLI+ EG LK+ADFGLAR
Sbjct:   141 KCYMRQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLAR 186


>sp|Q00534|CDK6_HUMAN CELL DIVISION PROTEIN KINASE 6 (KINASE PLSTIRE)
            >pir||S23387 protein kinase (EC 2.7.1.37) cdk6 - human >gi|36623
            (X66365) serine/threonine protein kinase [Homo sapiens]
            Length = 326

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 4.2e-32, Sum P(2) = 4.2e-32
 Identities = 39/69 (56%), Positives = 50/69 (72%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G S+ DQL +I  ++
Sbjct:   177 TSVVVTLWYRAPEVLLQSS-YATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVI 235

Query:   576 GTPNSKNWP 602
             G P  ++WP
Sbjct:   236 GLPGEEDWP 244

 Score = 161 (56.7 bits), Expect = 4.2e-32, Sum P(2) = 4.2e-32
 Identities = 28/53 (52%), Positives = 39/53 (73%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G+ + T K  + QLL G+ + H  RV+HRDLKPQN+L+   G++K+ADFGLAR
Sbjct:   116 GVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLAR 168


>pir||S66145 Cdk-activating protein kinase (EC 2.7.1.-) chain mop1 - fission
            yeast (Schizosaccharomyces pombe) >gi|987976 (X91239)
            Cdk-activating kinase [Schizosaccharomyces pombe] >gi|1063602
            (L47353) mammalian CAK homologue [Schizosaccharomyces pombe]
            Length = 335

  Plus Strand HSPs:

 Score = 224 (78.9 bits), Expect = 7.1e-32, Sum P(2) = 7.1e-32
 Identities = 41/75 (54%), Positives = 53/75 (70%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             +SR FG P    +H+V+T WYR P++ MG + Y T +D+WSVGCIFAE++  TP  PG S
Sbjct:   154 LSRDFGTPSHM-SHQVITRWYRPPELFMGCRSYGTGVDMWSVGCIFAELMLRTPYLPGES 212

Query:   540 EADQLMRIFRILGTP 584
             + DQL  IFR LGTP
Sbjct:   213 DLDQLNVIFRALGTP 227

 Score = 147 (51.7 bits), Expect = 7.1e-32, Sum P(2) = 7.1e-32
 Identities = 27/46 (58%), Positives = 37/46 (80%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             KS+++ LL G+ + H R +LHRDLKP NLLI+ +G LK+ADFGL+R
Sbjct:   111 KSWMVMLLRGLHHIHSRFILHRDLKPNNLLISSDGVLKLADFGLSR 156


>sp|P06242|KI28_YEAST SERINE/THREONINE-PROTEIN KINASE KIN28 >pir||A25698
            probable protein kinase KIN28 (EC 2.7.1.-) - yeast (Saccharomyces
            cerevisiae) >gi|3849 (X04423) protein kinase [Saccharomyces
            cerevisiae] >gnl|PID|e223186 (X95644) ORF 2330 [Saccharomyces
            cerevisiae] >gnl|PID|e253036 (Z74156) ORF YDL108w [Saccharomyces
            cerevisiae] >prf||2102251A protein kinase [Saccharomyces
            cerevisiae]
            Length = 306

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.4e-31, Sum P(2) = 2.4e-31
 Identities = 40/81 (49%), Positives = 54/81 (66%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA   P    T  VVT WYRAP++L G+K Y++ IDIWSVG IFAE++   P  PG +
Sbjct:   150 LARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQN 209

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             + DQ+   FR LGTP  ++WP
Sbjct:   210 DVDQMEVTFRALGTPTDRDWP 230

 Score = 147 (51.7 bits), Expect = 2.4e-31, Sum P(2) = 2.4e-31
 Identities = 25/46 (54%), Positives = 36/46 (78%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+++L  L G+ +CH   +LHRDLKP NLL + +G++K+ADFGLAR
Sbjct:   107 KAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLAR 152


>gnl|PID|e255552 (X99510) CDK4/6 kinase [Drosophila melanogaster]
            Length = 317

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 3.0e-31, Sum P(2) = 3.0e-31
 Identities = 40/81 (49%), Positives = 55/81 (67%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             +++ +G  + K T  VVTLWYRAP+VL+ ++ Y++T+DIWS  CI  EM N   LFPG S
Sbjct:   178 LAKTYGSEM-KLTSVVVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTS 235

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E +QL RIF + G P  + WP
Sbjct:   236 EKNQLDRIFELTGRPTEQQWP 256

 Score = 152 (53.5 bits), Expect = 3.0e-31, Sum P(2) = 3.0e-31
 Identities = 27/53 (50%), Positives = 38/53 (71%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             G+   T +    +LL G+ + H  R++HRDLKPQNLL++ +G LKIADFGLA+
Sbjct:   128 GMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK 180


>gi|496090 (L33264) CDC2-related kinase [Homo sapiens]
           Length = 316

  Plus Strand HSPs:

 Score = 240 (84.5 bits), Expect = 6.2e-31, Sum P(2) = 6.2e-31
 Identities = 41/81 (50%), Positives = 61/81 (75%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA+G+PV+  T +VVTLWYRAP++L+G+   +T+ID+W+VGCI AE++   PL PG S
Sbjct:   157 LARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTS 216

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E  Q+  I ++LGTP+   WP
Sbjct:   217 EIHQIDLIVQLLGTPSENIWP 237

 Score = 122 (42.9 bits), Expect = 6.2e-31, Sum P(2) = 6.2e-31
 Identities = 24/46 (52%), Positives = 32/46 (69%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K  +LQ+L G+ Y H   ++HRDLK  NLL+  +G +K ADFGLAR
Sbjct:   114 KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLAR 159


>sp|Q09437|YP62_CAEEL PUTATIVE SERINE/THREONINE-PROTEIN KINASE B0495.2 IN
            CHROMOSOME II >gi|687819 (U21317) similar to cell division control
            protein 2 [Caenorhabditis elegans]
            Length = 719

  Plus Strand HSPs:

 Score = 246 (86.6 bits), Expect = 6.3e-31, Sum P(2) = 6.3e-31
 Identities = 43/89 (48%), Positives = 62/89 (69%), Frame = +3

Query:   336 IFLIL*LNISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNG 515
             I  I    ++R +G P++K+T  VVTLWYR+P++L+G++ YST +D+WSVGCI AE +  
Sbjct:   497 ILKIADFGLAREYGDPLKKFTSIVVTLWYRSPELLLGTRLYSTPVDMWSVGCIMAEFILL 556

Query:   516 TPLFPGVSEADQLMRIFRILGTPNSKNWP 602
              PLFPG  E +Q+ +IF  +GTP    WP
Sbjct:   557 KPLFPGRGELEQIKKIFMEMGTPTESIWP 585

 Score = 136 (47.9 bits), Expect = 6.3e-31, Sum P(2) = 6.3e-31
 Identities = 28/46 (60%), Positives = 35/46 (76%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ L QLL+GI + H   +LHRDLK  NLL++ +G LKIADFGLAR
Sbjct:   462 KTLLQQLLSGIEHMHKLWILHRDLKTSNLLMSHKGILKIADFGLAR 507


>pir||S49330 serine/threonine kinase pisslre - human >gi|556651 (X78342)
            PISSLRE gene product [Homo sapiens]
            Length = 360

  Plus Strand HSPs:

 Score = 240 (84.5 bits), Expect = 6.5e-31, Sum P(2) = 6.5e-31
 Identities = 41/81 (50%), Positives = 61/81 (75%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA+G+PV+  T +VVTLWYRAP++L+G+   +T+ID+W+VGCI AE++   PL PG S
Sbjct:   184 LARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTS 243

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E  Q+  I ++LGTP+   WP
Sbjct:   244 EIHQIDLIVQLLGTPSENIWP 264

 Score = 122 (42.9 bits), Expect = 6.5e-31, Sum P(2) = 6.5e-31
 Identities = 24/46 (52%), Positives = 32/46 (69%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K  +LQ+L G+ Y H   ++HRDLK  NLL+  +G +K ADFGLAR
Sbjct:   141 KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLAR 186


>pir||S57926 protein kinase (EC 2.7.1.37) cdk4 - African clawed frog >gi|897817
            (X89477) cyclin dependent kinase 4 [Xenopus laevis]
            Length = 319

  Plus Strand HSPs:

 Score = 222 (78.1 bits), Expect = 1.0e-30, Sum P(2) = 1.0e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WS GCIFAEM    PLF G SEADQL +IF I+
Sbjct:   172 TPVVVTLWYRAPEVLLQST-YATPVDVWSAGCIFAEMFKRKPLFCGNSEADQLCKIFDII 230

Query:   576 GTPNSKNWP 602
             G P+ + WP
Sbjct:   231 GLPSEEEWP 239

 Score = 138 (48.6 bits), Expect = 1.0e-30, Sum P(2) = 1.0e-30
 Identities = 25/53 (47%), Positives = 37/53 (69%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             GL   T K  + Q L+G+ + H   ++HRDLKP+N+L+   G++K+ADFGLAR
Sbjct:   111 GLPLETIKDLMKQFLSGLEFLHLNCIVHRDLKPENILVTSGGQVKLADFGLAR 163


>sp|Q01917|CC2H_CRIFA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG >pir||S26381
            cdc2-related protein - Crithidia fasciculata >gi|6978 (Z12149) cdc2
            gene homologue [Crithidia fasciculata]
            Length = 474

  Plus Strand HSPs:

 Score = 250 (88.0 bits), Expect = 2.0e-30, Sum P(3) = 2.0e-30
 Identities = 45/82 (54%), Positives = 60/82 (73%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R   IPV+KY+HEVVTLWYR+PDVLM S  YS  +DIWS+G IF EM     LF G +
Sbjct:   218 LARVEEIPVKKYSHEVVTLWYRSPDVLMSSALYSYPVDIWSMGAIFFEMATSKVLFSGRN 277

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             E +QL+R+F +LG+P  + WP+
Sbjct:   278 EDEQLLRMFWLLGSPTKETWPS 299

 Score = 92 (32.4 bits), Expect = 2.0e-30, Sum P(3) = 2.0e-30
 Identities = 16/35 (45%), Positives = 23/35 (65%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREG 154
             +  L Q+  G+ Y H R V+HRD+KPQN+ +N  G
Sbjct:   109 RPILKQIFLGLEYLHGRCVVHRDMKPQNIFVNVRG 143

 Score = 42 (14.8 bits), Expect = 2.0e-30, Sum P(3) = 2.0e-30
 Identities = 8/10 (80%), Positives = 9/10 (90%), Frame = +2

Query:   158 LKIADFGLAR 187
             +KI DFGLAR
Sbjct:   211 IKIGDFGLAR 220

 Score = 41 (14.4 bits), Expect = 0.015, Sum P(3) = 0.015
 Identities = 14/69 (20%), Positives = 28/69 (40%), Frame = +3

Query:   387 RKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS-EADQLMRI 563
             +++ H    +  R       +  Y   +++W    +F E +  T     VS E   L+R 
Sbjct:   366 KRFYHSESAMQQRRESASSAANSYRLPVELWFDRPLFKEYMAATRCDVSVSPEGIDLLRR 425

Query:   564 FRILGTPNSK 593
               ++  PN +
Sbjct:   426 C-LMYEPNQR 434


>sp|P11802|CDK4_HUMAN CELL DIVISION PROTEIN KINASE 4 (PSK-J3) >gi|456427
            (M14505) cyclin-dependent protein kinase, type 4 [Homo sapiens]
            >gi|1353416 (U37022) cyclin-dependent kinase 4 [Homo sapiens]
            Length = 303

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G SEADQL +IF ++
Sbjct:   172 TPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLI 230

Query:   576 GTPNSKNWP 602
             G P   +WP
Sbjct:   231 GLPPEDDWP 239

 Score = 139 (48.9 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 29/70 (41%), Positives = 43/70 (61%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL + T K  + Q L G+ + H   ++HRDLKP+N+L+   G +K+ADFGLAR   Y + 
Sbjct:   111 GLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMA 170

Query:   209 ----IITLEY 226
                 ++TL Y
Sbjct:   171 LTPVVVTLWY 180


>sp|P35426|CDK4_RAT CELL DIVISION PROTEIN KINASE 4 (PSK-J3) >pir||JN0460
            protein kinase (EC 2.7.1.37) cdk4 - rat >bbs|128628
            cyclin-dependent kinase 4=cdk4 product [rats, fetal lungs, Peptide,
            303 aa] >gi|203392 (L11007) cyclin-dependent kinase 4 [Rattus
            norvegicus]
            Length = 303

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G SEADQL +IF ++
Sbjct:   172 TPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLI 230

Query:   576 GTPNSKNWP 602
             G P   +WP
Sbjct:   231 GLPPEDDWP 239

 Score = 139 (48.9 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 29/70 (41%), Positives = 43/70 (61%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL   T K  + Q L+G+ + H   ++HRDLKP+N+L+   G +K+ADFGLAR   Y + 
Sbjct:   111 GLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMA 170

Query:   209 ----IITLEY 226
                 ++TL Y
Sbjct:   171 LTPVVVTLWY 180


>sp|P30285|CDK4_MOUSE CELL DIVISION PROTEIN KINASE 4 (PSK-J3) (CRK3)
            >pir||A44293 protein kinase (EC 2.7.1.37) crk3 - mouse >gi|193364
            (L01640) D-type G1 cyclin catalytic subunit [Mus musculus]
            Length = 303

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G SEADQL +IF ++
Sbjct:   172 TPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLI 230

Query:   576 GTPNSKNWP 602
             G P   +WP
Sbjct:   231 GLPPEDDWP 239

 Score = 139 (48.9 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 29/70 (41%), Positives = 43/70 (61%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL   T K  + Q L+G+ + H   ++HRDLKP+N+L+   G +K+ADFGLAR   Y + 
Sbjct:   111 GLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMA 170

Query:   209 ----IITLEY 226
                 ++TL Y
Sbjct:   171 LTPVVVTLWY 180


>pir||S52841 protein kinase (EC 2.7.1.37) cdk4 - human >gi|763124 (Z48970) orf
            [Homo sapiens]
            Length = 303

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G SEADQL +IF ++
Sbjct:   172 TPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLI 230

Query:   576 GTPNSKNWP 602
             G P   +WP
Sbjct:   231 GLPPEDDWP 239

 Score = 139 (48.9 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 29/70 (41%), Positives = 43/70 (61%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL + T K  + Q L G+ + H   ++HRDLKP+N+L+   G +K+ADFGLAR   Y + 
Sbjct:   111 GLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMA 170

Query:   209 ----IITLEY 226
                 ++TL Y
Sbjct:   171 LTPVVVTLWY 180


>gi|1710234 (U79269) cyclin dependent protein kinase [Homo sapiens]
            Length = 229

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G SEADQL +IF ++
Sbjct:    98 TPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLI 156

Query:   576 GTPNSKNWP 602
             G P   +WP
Sbjct:   157 GLPPEDDWP 165

 Score = 139 (48.9 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 29/70 (41%), Positives = 43/70 (61%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL + T K  + Q L G+ + H   ++HRDLKP+N+L+   G +K+ADFGLAR   Y + 
Sbjct:    37 GLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMA 96

Query:   209 ----IITLEY 226
                 ++TL Y
Sbjct:    97 LTPVVVTLWY 106


>gi|2209290 (U81031) CDK4 [Homo sapiens]
            Length = 303

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G SEADQL +IF ++
Sbjct:   172 TPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLI 230

Query:   576 GTPNSKNWP 602
             G P   +WP
Sbjct:   231 GLPPEDDWP 239

 Score = 139 (48.9 bits), Expect = 3.4e-30, Sum P(2) = 3.4e-30
 Identities = 29/70 (41%), Positives = 43/70 (61%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL + T K  + Q L G+ + H   ++HRDLKP+N+L+   G +K+ADFGLAR   Y + 
Sbjct:   111 GLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMA 170

Query:   209 ----IITLEY 226
                 ++TL Y
Sbjct:   171 LTPVVVTLWY 180


>gi|1763059 (U68478) cyclin-dependent kinase 4 [Sus scrofa]
            Length = 303

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 6.9e-30, Sum P(2) = 6.9e-30
 Identities = 42/69 (60%), Positives = 51/69 (73%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVTLWYRAP+VL+ S  Y+T +D+WSVGCIFAEM    PLF G SEADQL +IF ++
Sbjct:   172 TPVVVTLWYRAPEVLLQST-YATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLI 230

Query:   576 GTPNSKNWP 602
             G P   +WP
Sbjct:   231 GLPPEDDWP 239

 Score = 136 (47.9 bits), Expect = 6.9e-30, Sum P(2) = 6.9e-30
 Identities = 29/70 (41%), Positives = 42/70 (60%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL   T K  + Q L G+ + H   ++HRDLKP+N+L+   G +K+ADFGLAR   Y + 
Sbjct:   111 GLPVETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMA 170

Query:   209 ----IITLEY 226
                 ++TL Y
Sbjct:   171 LTPVVVTLWY 180


>sp|P43063|CC28_CANAL CELL DIVISION CONTROL PROTEIN 28 >pir||JC4827 protein
            kinase (EC 2.7.1.37) cdc28 - yeast (Candida albicans) >gi|520628
            (X80034) Cdc 28 protein kinase [Candida albicans] >gi|1103926
            (U40405) Cdk1 [Candida albicans]
            Length = 317

  Plus Strand HSPs:

 Score = 336 (118.3 bits), Expect = 8.0e-30, P = 8.0e-30
 Identities = 57/82 (69%), Positives = 71/82 (86%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+P+R YTHEVVTLWYRAP++L+G K+YST +D+WSVGCIFAEM N  PLFPG S
Sbjct:   154 LARAFGVPLRAYTHEVVTLWYRAPEILLGGKQYSTGVDMWSVGCIFAEMCNRKPLFPGDS 213

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             E D++ RIFRILGTPN + WP+
Sbjct:   214 EIDEIFRIFRILGTPNEEIWPD 235

 Score = 184 (64.8 bits), Expect = 2.0e-13, P = 2.0e-13
 Identities = 39/71 (54%), Positives = 48/71 (67%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----N 193
             GL +   K F+ QL+ GI +CH  RVLHRDLKPQNLLI++EG LK+ADFGLAR       
Sbjct:   104 GLGANMIKRFMNQLIRGIKHCHSHRVLHRDLKPQNLLIDKEGNLKLADFGLARAFGVPLR 163

Query:   194 IYVLNIITLEY 226
              Y   ++TL Y
Sbjct:   164 AYTHEVVTLWY 174


>gnl|PID|d1022237 (AB004534) cdc2 kinase homologue [Schizosaccharomyces pombe]
            Length = 591

  Plus Strand HSPs:

 Score = 225 (79.2 bits), Expect = 2.1e-29, Sum P(2) = 2.1e-29
 Identities = 39/73 (53%), Positives = 53/73 (72%), Frame = +3

Query:   387 RKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIF 566
             R+YT  VVT WYR+P++L+G ++Y+T ID+WSVGCI AEM  G P+  G S+ DQL +IF
Sbjct:   209 REYTGCVVTRWYRSPELLLGERRYTTAIDMWSVGCIMAEMYKGRPILQGSSDLDQLDKIF 268

Query:   567 RILGTPNSKNWPN 605
             R+ G+P     PN
Sbjct:   269 RLCGSPTQATMPN 281

 Score = 140 (49.3 bits), Expect = 2.1e-29, Sum P(2) = 2.1e-29
 Identities = 28/46 (60%), Positives = 33/46 (71%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K ++ QL  G  Y HD+ +LHRDLK  NLLI+  G LKIADFGLAR
Sbjct:   144 KCYMKQLFAGTKYLHDQLILHRDLKAANLLIDNHGILKIADFGLAR 189


>sp||ERK1_MOUSE_2 [Segment 2 of 2] EXTRACELLULAR SIGNAL-REGULATED KINASE 1
            (ERK1) (INSULIN-STIMULATED MAP2 KINASE) (MAP KINASE 1) (MAPK 1)
            (P44-ERK1) (ERT2) (P44-MAPK) (MICROTUBULE-ASSOCIATED PROTEIN-2
            KINASE) (MNK1)
            Length = 304

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.4e-29, Sum P(2) = 4.4e-29
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   127 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 186

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   187 GSPSQED 193

 Score = 148 (52.1 bits), Expect = 4.4e-29, Sum P(2) = 4.4e-29
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:    71 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 114


>dbj||D87271_1 (D87271) ERK2 [Mus musculus]
            Length = 291

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 6.1e-29, Sum P(2) = 6.1e-29
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   183 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 242

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   243 GSPSQED 249

 Score = 146 (51.4 bits), Expect = 6.1e-29, Sum P(2) = 6.1e-29
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   127 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 170


>sp|Q00526|CDK3_HUMAN CELL DIVISION PROTEIN KINASE 3 >pir||S23382 protein
            kinase (EC 2.7.1.37) cdk3 - human >gi|36613 (X66357)
            serine/threonine protein kinase [Homo sapiens]
            Length = 305

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 1.2e-28, P = 1.2e-28
 Identities = 56/81 (69%), Positives = 68/81 (83%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+P+R YTHEVVTLWYRAP++L+GSK Y+T +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTRKALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR+LGTP+   WP
Sbjct:   208 EIDQLFRIFRMLGTPSEDTWP 228

 Score = 181 (63.7 bits), Expect = 3.8e-13, P = 3.8e-13
 Identities = 36/64 (56%), Positives = 45/64 (70%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NIYVLNII 214
             KS+L QLL G+++CH  RV+HRDLKPQNLLIN  G +K+ADFGLAR        Y   ++
Sbjct:   105 KSYLFQLLQGVSFCHSHRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVV 164

Query:   215 TLEY 226
             TL Y
Sbjct:   165 TLWY 168


>gi|29849 (X61622) cell division kinase. CDC2 homolog [Homo sapiens]
          Length = 298

  Plus Strand HSPs:

 Score = 324 (114.1 bits), Expect = 1.5e-28, P = 1.5e-28
 Identities = 58/81 (71%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP++L+GSK YST +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGSKYYSTAVDIWSLGCIFAEMVTRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVVWP 228

 Score = 195 (68.6 bits), Expect = 7.0e-15, P = 7.0e-15
 Identities = 41/79 (51%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168


>gnl|PID|d1012143 (D79982) cdc2 [Asterina pectinifera]
            Length = 300

  Plus Strand HSPs:

 Score = 324 (114.1 bits), Expect = 1.5e-28, P = 1.5e-28
 Identities = 58/81 (71%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR YTHEVVTLWYRAP+VL+GS +YST +D+WS+GCIFAEMV   PLF G S
Sbjct:   148 LARAFGIPVRVYTHEVVTLWYRAPEVLLGSPRYSTPVDVWSIGCIFAEMVTKRPLFHGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR  GTP  K WP
Sbjct:   208 EIDQLFRIFRTPGTPTDKTWP 228

 Score = 179 (63.0 bits), Expect = 5.9e-13, P = 5.9e-13
 Identities = 36/70 (51%), Positives = 49/70 (70%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++    KS+L Q++ GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:    99 MDPALVKSYLHQIVQGILFCHCRRVLHRDLKPQNLLIDEKGIIKLADFGLARAFGIPVRV 158

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   159 YTHEVVTLWY 168


>gnl|PID|e49056 (Z11696) 44kDa protein kinase [Homo sapiens] >prf||1813206C
            mitogen-activated protein kinase [Homo sapiens]
            Length = 355

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 2.5e-28, Sum P(2) = 2.5e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   178 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 237

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   238 GSPSQED 244

 Score = 148 (52.1 bits), Expect = 2.5e-28, Sum P(2) = 2.5e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   122 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 165


>pir||PQ0270 extracellular signal-regulated kinase 1 (EC 2.7.1.-) - human
            (fragment) >gi|186696 (M84490) kinase 1 [Homo sapiens]
            Length = 366

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 3.2e-28, Sum P(2) = 3.2e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   189 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 248

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   249 GSPSQED 255

 Score = 148 (52.1 bits), Expect = 3.2e-28, Sum P(2) = 3.2e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   133 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 176


>gi|515499 (U12008) microtubule-associated protein-2 kinase [Rattus norvegicus]
           Length = 367

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 3.2e-28, Sum P(2) = 3.2e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   190 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 249

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   250 GSPSQED 256

 Score = 148 (52.1 bits), Expect = 3.2e-28, Sum P(2) = 3.2e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   134 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 177


>pir||A60041 Ca2+/calmodulin-dependent protein kinase (EC 2.7.1.123) ERK1 -
            Chinese hamster (fragment)
            Length = 369

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 3.4e-28, Sum P(2) = 3.4e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   192 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 251

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   252 GSPSQED 258

 Score = 148 (52.1 bits), Expect = 3.4e-28, Sum P(2) = 3.4e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   136 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 179


>gi|23879 (Z11695) 40kDa protein kinase [Homo sapiens] >prf||1813206B
          mitogen-activated protein kinase [Homo sapiens]
          Length = 348

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 3.4e-28, Sum P(2) = 3.4e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   173 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 232

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   233 GSPSQED 239

 Score = 146 (51.4 bits), Expect = 3.4e-28, Sum P(2) = 3.4e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   117 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 160


>gi|204054 (M61177) extracellular-signal-regulated kinase 1 [Rattus norvegicus]
           Length = 374

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 3.7e-28, Sum P(2) = 3.7e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   197 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 256

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   257 GSPSQED 263

 Score = 148 (52.1 bits), Expect = 3.7e-28, Sum P(2) = 3.7e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   141 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 184


>pir||S28184 Ca2+/calmodulin-dependent protein kinase (EC 2.7.1.123) - mouse
            Length = 377

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 3.9e-28, Sum P(2) = 3.9e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   200 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 259

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   260 GSPSQED 266

 Score = 148 (52.1 bits), Expect = 3.9e-28, Sum P(2) = 3.9e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   144 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 187


>sp|P43450|CDK2_CARAU CELL DIVISION PROTEIN KINASE 2 >pir||A44878 protein
            kinase (EC 2.7.1.37) cdk2 - goldfish >bbs|108783 (S40289) cell
            division kinase, cyclin-dependent kinase, cdk2=cell cycle regulator
            cdc2 homolog [goldfish, oocytes, Peptide, 298 aa] [Carassius
            auratus]
            Length = 298

  Plus Strand HSPs:

 Score = 320 (112.6 bits), Expect = 3.9e-28, P = 3.9e-28
 Identities = 56/81 (69%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEM+    LFPG S
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMITRKALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDESIWP 228

 Score = 199 (70.1 bits), Expect = 2.6e-15, P = 2.6e-15
 Identities = 40/73 (54%), Positives = 50/73 (68%), Frame = +2

Query:    23 IGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*---- 190
             + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN +GE+K+ADFGLAR     
Sbjct:    96 VTGISLPLVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVP 155

Query:   191 -NIYVLNIITLEY 226
                Y   ++TL Y
Sbjct:   156 VRTYTHEVVTLWY 168


>sp|P00546|CC28_YEAST CELL DIVISION CONTROL PROTEIN 28 >pir||TVBY8 protein
            kinase (EC 2.7.1.37) cdc28 - yeast (Saccharomyces cerevisiae)
            >gi|3486 (X00257) CDC28 product put. protein kinase [Saccharomyces
            cerevisiae] >gi|535469 (X80224) protein kinase [Saccharomyces
            cerevisiae] >gi|536494 (Z36029) ORF YBR160w [Saccharomyces
            cerevisiae] >prf||1002252A protein CDC28 [Saccharomyces cerevisiae]
            Length = 298

  Plus Strand HSPs:

 Score = 320 (112.6 bits), Expect = 3.9e-28, P = 3.9e-28
 Identities = 53/82 (64%), Positives = 68/82 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+P+R YTHE+VTLWYRAP+VL+G K+YST +D WS+GCIFAEM N  P+F G S
Sbjct:   157 LARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDS 216

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             E DQ+ +IFR+LGTPN   WP+
Sbjct:   217 EIDQIFKIFRVLGTPNEAIWPD 238

 Score = 191 (67.2 bits), Expect = 2.2e-14, P = 2.2e-14
 Identities = 38/64 (59%), Positives = 45/64 (70%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NIYVLNII 214
             K F++QL  GIAYCH  R+LHRDLKPQNLLIN++G LK+ DFGLAR        Y   I+
Sbjct:   114 KKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIV 173

Query:   215 TLEY 226
             TL Y
Sbjct:   174 TLWY 177


>sp|P27361|ERK1_HUMAN EXTRACELLULAR SIGNAL-REGULATED KINASE 1 (ERK1)
            (INSULIN-STIMULATED MAP2 KINASE) (MAP KINASE 1) (MAPK 1) (P44-ERK1)
            (ERT2) (P44-MAPK) (MICROTUBULE-ASSOCIATED PROTEIN-2 KINASE)
            Length = 379

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.1e-28, Sum P(2) = 4.1e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   202 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 261

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   262 GSPSQED 268

 Score = 148 (52.1 bits), Expect = 4.1e-28, Sum P(2) = 4.1e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   146 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 189


>sp|P21708|ERK1_RAT EXTRACELLULAR SIGNAL-REGULATED KINASE 1 (ERK1)
            (INSULIN-STIMULATED MAP2 KINASE) (MAP KINASE 1) (MAPK 1) (P44-ERK1)
            (ERT2) (P44-MAPK) (MICROTUBULE-ASSOCIATED PROTEIN-2 KINASE) (MNK1)
            >pir||JC1451 Ca2+/calmodulin-dependent protein kinase (EC
            2.7.1.123) - rat >gi|56627 (X65198) MAP kinase [Rattus norvegicus]
            Length = 380

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.1e-28, Sum P(2) = 4.1e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   203 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 262

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   263 GSPSQED 269

 Score = 148 (52.1 bits), Expect = 4.1e-28, Sum P(2) = 4.1e-28
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   147 FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLAR 190


>sp|Q03957|CTK1_YEAST CTD KINASE ALPHA SUBUNIT (CTD KINASE 58 KD SUBUNIT)
            (CTDK-I ALPHA SUBUNIT) >pir||S32593 [RNA-polymerase]-subunit kinase
            (EC 2.7.1.141) alpha chain - yeast (Saccharomyces cerevisiae)
            >gi|171328 (M69024) CTD kinase largest subunit [Saccharomyces
            cerevisiae] >gi|486235 (Z28139) ORF YKL139w [Saccharomyces
            cerevisiae]
            Length = 528

  Plus Strand HSPs:

 Score = 210 (73.9 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 32/70 (45%), Positives = 49/70 (70%), Frame = +3

Query:   393 YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRI 572
             YT+ V+TLWYR P++L+G+  Y T +D+W  GC+  E+ N T +F G +E +Q+  IF+I
Sbjct:   337 YTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKI 396

Query:   573 LGTPNSKNWP 602
             +GTP   +WP
Sbjct:   397 MGTPTINSWP 406

 Score = 141 (49.6 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 32/63 (50%), Positives = 40/63 (63%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-NI---YVLNIIT 217
             K    QLL G+ Y HD ++LHRD+K  N+LI+ +G LKI DFGLAR  N    Y   +IT
Sbjct:   284 KHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLARKMNSRADYTNRVIT 343

Query:   218 LEY 226
             L Y
Sbjct:   344 LWY 346


>sp|P46196|ERK2_BOVIN EXTRACELLULAR SIGNAL-REGULATED KINASE 2 (ERK2)
            (MITOGEN-ACTIVATED PROTEIN KINASE 2) (MAP KINASE 2) (MAPK 2)
            (P42-MAPK) (ERT1) >pir||S25011 protein kinase ERK2 (EC 2.7.1.-) -
            bovine >gi|337 (Z14089) extracellular signal-regulated kinase
            (ERK2) [Bos taurus]
            Length = 360

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   185 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 244

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   245 GSPSQED 251

 Score = 146 (51.4 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   129 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 172


>pir||S23427 protein kinase, 41K (EC 2.7.1.-) - human >gi|23881 (Z11694) 41kD
            protein kinase [Homo sapiens] >prf||1813206A mitogen-activated
            protein kinase [Homo sapiens]
            Length = 360

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   185 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 244

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   245 GSPSQED 251

 Score = 146 (51.4 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   129 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 172


>sp|P28482|ERK2_HUMAN EXTRACELLULAR SIGNAL-REGULATED KINASE 2 (ERK2)
            (MITOGEN-ACTIVATED PROTEIN KINASE 2) (MAP KINASE 2) (MAPK 2)
            (P42-MAPK) (ERT1) >pir||JQ1400 extracellular signal-regulated
            kinase 2 (EC 2.7.-.-) - human >gi|182191 (M84489) protein kinase 2
            [Homo sapiens]
            Length = 360

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   185 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 244

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   245 GSPSQED 251

 Score = 146 (51.4 bits), Expect = 4.5e-28, Sum P(2) = 4.5e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   129 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 172


>pir||A39754 mitogen-activated protein kinase (EC 2.7.1.-) - African clawed
            frog
            Length = 361

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.6e-28, Sum P(2) = 4.6e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   188 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 247

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   248 GSPSQED 254

 Score = 146 (51.4 bits), Expect = 4.6e-28, Sum P(2) = 4.6e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   132 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 175


>sp|P26696|ERK2_XENLA MITOGEN-ACTIVATED PROTEIN KINASE (MYELIN XP42 PROTEIN
            KINASE) (MYELIN BASIC PROTEIN KINASE) (MBP KINASE) (M PHASE MAP
            KINASE) >gi|214931 (M60977) myelin basic protein kinase-like
            protein [Xenopus laevis]
            Length = 361

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.6e-28, Sum P(2) = 4.6e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   188 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 247

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   248 GSPSQED 254

 Score = 146 (51.4 bits), Expect = 4.6e-28, Sum P(2) = 4.6e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   132 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 175


>gi|64894 (X59813) MAP kinase [Xenopus laevis]
          Length = 361

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.6e-28, Sum P(2) = 4.6e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   188 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 247

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   248 GSPSQED 254

 Score = 146 (51.4 bits), Expect = 4.6e-28, Sum P(2) = 4.6e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   132 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 175


>pdb|1GOL|  Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At
            Position 52 Transferase, SerineTHREONINE-Protein Kinase,
            Atp-Binding, Cell Cycle, Phosphorylation Mol_id: 1; Molecule:
            Extracellular Regulated Kinase 2; Chain: Null; ...
            Length = 364

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.9e-28, Sum P(2) = 4.9e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   189 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 248

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   249 GSPSQED 255

 Score = 146 (51.4 bits), Expect = 4.9e-28, Sum P(2) = 4.9e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   133 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 176


>pdb|1ERK|  Structure Of Signal-Regulated Kinase Transferase,
            SerineTHREONINE-Protein Kinase, Atp-Binding Cell Cycle,
            Phosphorylation. Mol_id: 1; Molecule: Extracellular Regulated
            Kinase 2; Chain: Null; Synonym: Mitogen Activated Protein (Map...
            Length = 364

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 4.9e-28, Sum P(2) = 4.9e-28
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   189 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 248

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   249 GSPSQED 255

 Score = 146 (51.4 bits), Expect = 4.9e-28, Sum P(2) = 4.9e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   133 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 176


>gnl|PID|d1006498 (D28753) cyclin dependent kinase 2-alpha [Rattus rattus]
            Length = 298

  Plus Strand HSPs:

 Score = 319 (112.3 bits), Expect = 5.0e-28, P = 5.0e-28
 Identities = 57/81 (70%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVVWP 228

 Score = 198 (69.7 bits), Expect = 3.3e-15, P = 3.3e-15
 Identities = 42/79 (53%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + GL     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASALTGLPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168


>sp|P48963|CDK2_MESAU CELL DIVISION PROTEIN KINASE 2 >gnl|PID|d1004684 (D17350)
            cdk2 [Mesocricetus auratus]
            Length = 298

  Plus Strand HSPs:

 Score = 319 (112.3 bits), Expect = 5.0e-28, P = 5.0e-28
 Identities = 57/81 (70%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVVWP 228

 Score = 197 (69.3 bits), Expect = 4.3e-15, P = 4.3e-15
 Identities = 41/79 (51%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASAVTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168


>gi|1695880 (U63337) cyclin-dependent kinase-2 alpha [Mus musculus]
            Length = 298

  Plus Strand HSPs:

 Score = 319 (112.3 bits), Expect = 5.0e-28, P = 5.0e-28
 Identities = 57/81 (70%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVVWP 228

 Score = 196 (69.0 bits), Expect = 5.5e-15, P = 5.5e-15
 Identities = 41/79 (51%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168


>sp|P24941|CDK2_HUMAN CELL DIVISION PROTEIN KINASE 2 (P33 PROTEIN KINASE)
            >pir||A41227 protein kinase (EC 2.7.1.37) cdk2 - human >pdb|1FIN|A
            Homo sapiens >pdb|1FIN|C Homo sapiens >pdb|1HCK|  Human
            Cyclin-Dependent Kinase 2 Transferase, SerineTHREONINE PROTEIN
            KINASE, ATP-Binding, Cell Cycle, Cell Division, Mitosis,
            Phosphorylation Mol_id: 1; Molecule: Human Cyclin-Dependent Kinase
            2; Chain: Null; Synonym: Cdk2; Ec: 2.... >pdb|1HCL|  Human
            Cyclin-Dependent Kinase 2 Transferase, SerineTHREONINE PROTEIN
            KINASE, ATP-Binding, Cell Cycle, Cell Division, Mitosis,
            Phosphorylation Mol_id: 1; Molecule: Human Cyclin-Dependent Kinase
            2; Chain: Null; Synonym: Cdk2; Ec: 2.... >gi|180178 (M68520)
            cdc2-related protein kinase [Homo sapiens] >prf||1717387A cyclin A
            dependent p33 kinase:SUBUNIT=2 [Homo sapiens]
            Length = 298

  Plus Strand HSPs:

 Score = 319 (112.3 bits), Expect = 5.0e-28, P = 5.0e-28
 Identities = 57/81 (70%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVVWP 228

 Score = 195 (68.6 bits), Expect = 7.0e-15, P = 7.0e-15
 Identities = 41/79 (51%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168


>gi|312803 (X62071) cdk2 gene product [Homo sapiens]
           Length = 298

  Plus Strand HSPs:

 Score = 319 (112.3 bits), Expect = 5.0e-28, P = 5.0e-28
 Identities = 57/81 (70%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEMV    LFPG S
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP+   WP
Sbjct:   208 EIDQLFRIFRTLGTPDEVVWP 228

 Score = 195 (68.6 bits), Expect = 7.0e-15, P = 7.0e-15
 Identities = 41/79 (51%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168


>gi|1517820 (U35146) p56 KKIAMRE protein kinase [Homo sapiens]
            Length = 493

  Plus Strand HSPs:

 Score = 193 (67.9 bits), Expect = 5.2e-28, Sum P(2) = 5.2e-28
 Identities = 34/72 (47%), Positives = 44/72 (61%), Frame = +3

Query:   363 SRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSE 542
             +R    P   YT  V T WYRAP++L+G  KY   +D+W++GC+  EM  G PLFPG S+
Sbjct:   148 ARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSD 207

Query:   543 ADQLMRIFRILG 578
              DQL  I   LG
Sbjct:   208 IDQLYHIMMCLG 219

 Score = 157 (55.3 bits), Expect = 5.2e-28, Sum P(2) = 5.2e-28
 Identities = 23/53 (43%), Positives = 39/53 (73%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             GL+    + +L Q++NGI +CH   ++HRD+KP+N+L+++ G +K+ DFG AR
Sbjct:    97 GLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFAR 149


>sp|P40417|ERKA_DROME MITOGEN-ACTIVATED PROTEIN KINASE ERK-A
            (EXTRACELLULAR-REGULATED KINASE A) (ROLLED PROTEIN) >pir||A46036
            extracellular signal-regulated kinase, DmERK-A - fruit fly
            (Drosophila melanogaster) >gi|485755 (M95124) MAP kinase
            [Drosophila melanogaster]
            Length = 376

  Plus Strand HSPs:

 Score = 194 (68.3 bits), Expect = 6.8e-28, Sum P(2) = 6.8e-28
 Identities = 34/64 (53%), Positives = 46/64 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  +L
Sbjct:   198 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVL 257

Query:   576 GTPN 587
             G+P+
Sbjct:   258 GSPS 261

 Score = 149 (52.5 bits), Expect = 6.8e-28, Sum P(2) = 6.8e-28
 Identities = 28/44 (63%), Positives = 33/44 (75%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N+  +LKI DFGLAR
Sbjct:   142 FLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLAR 185


>pir||A38197 protein kinase (EC 2.7.1.37) cdc2-like - human
            Length = 418

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 8.3e-28, Sum P(2) = 8.3e-28
 Identities = 33/73 (45%), Positives = 47/73 (64%), Frame = +3

Query:   387 RKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIF 566
             R YT++V+TLWYR P++L+G ++Y+  ID+WS GCI  E+    P+F    E  QL  I 
Sbjct:   254 RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELIS 313

Query:   567 RILGTPNSKNWPN 605
             RI G+P    WP+
Sbjct:   314 RICGSPCPAVWPD 326

 Score = 155 (54.6 bits), Expect = 8.3e-28, Sum P(2) = 8.3e-28
 Identities = 26/46 (56%), Positives = 36/46 (78%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             KSF+ QL+ G+ YCH +  LHRD+K  N+L+N  G++K+ADFGLAR
Sbjct:   201 KSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLAR 246


>gi|180492 (M80629) cdc2-related protein kinase [Homo sapiens]
           Length = 418

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 8.3e-28, Sum P(2) = 8.3e-28
 Identities = 33/73 (45%), Positives = 47/73 (64%), Frame = +3

Query:   387 RKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIF 566
             R YT++V+TLWYR P++L+G ++Y+  ID+WS GCI  E+    P+F    E  QL  I 
Sbjct:   254 RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELIS 313

Query:   567 RILGTPNSKNWPN 605
             RI G+P    WP+
Sbjct:   314 RICGSPCPAVWPD 326

 Score = 155 (54.6 bits), Expect = 8.3e-28, Sum P(2) = 8.3e-28
 Identities = 26/46 (56%), Positives = 36/46 (78%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             KSF+ QL+ G+ YCH +  LHRD+K  N+L+N  G++K+ADFGLAR
Sbjct:   201 KSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLAR 246


>gi|1110512 (U40484) MAP kinase [Aplysia californica]
            Length = 351

  Plus Strand HSPs:

 Score = 194 (68.3 bits), Expect = 8.5e-28, Sum P(2) = 8.5e-28
 Identities = 34/67 (50%), Positives = 47/67 (70%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +ID+WSVGCI AEM+   PLFPG    DQL  I  +L
Sbjct:   174 TEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLANRPLFPGKHYLDQLNHILGVL 233

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   234 GSPSQED 240

 Score = 146 (51.4 bits), Expect = 8.5e-28, Sum P(2) = 8.5e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   118 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 161


>pir||S56638 mitogen-activated protein kinase 1 homolog (clone Aspk9) - oat
            >gi|871984 (X79993) MAP KINASE [Avena sativa]
            Length = 369

  Plus Strand HSPs:

 Score = 194 (68.3 bits), Expect = 9.7e-28, Sum P(2) = 9.7e-28
 Identities = 34/63 (53%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  YS  ID+WSVGCIF E++N  PLFPG     Q+  I  ++
Sbjct:   194 TEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRAPLFPGRDHMHQMRLITEVI 253

Query:   576 GTP 584
             GTP
Sbjct:   254 GTP 256

 Score = 147 (51.7 bits), Expect = 9.7e-28, Sum P(2) = 9.7e-28
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL QLL G+ Y H   V+HRDLKP NLL+N   +LKI DFGLAR
Sbjct:   142 FLYQLLRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLAR 185


>gnl|PID|d1010243 (D61377) WIPK [Nicotiana tabacum]
            Length = 375

  Plus Strand HSPs:

 Score = 181 (63.7 bits), Expect = 1.1e-27, Sum P(2) = 1.1e-27
 Identities = 32/63 (50%), Positives = 42/63 (66%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y+  ID+WSVGCIF E++N  PLF G     Q+  +  +L
Sbjct:   201 TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFGGKDHVHQIRLLTELL 260

Query:   576 GTP 584
             GTP
Sbjct:   261 GTP 263

 Score = 161 (56.7 bits), Expect = 1.1e-27, Sum P(2) = 1.1e-27
 Identities = 35/68 (51%), Positives = 43/68 (63%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*NIYVLN 208
             GL     + F+ QLL G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR NI   N
Sbjct:   140 GLSEDHCQYFMYQLLRGLKYIHSANVLHRDLKPSNLLVNANCDLKICDFGLARPNIENEN 199

Query:   209 IITLEYLI 232
             +   EY++
Sbjct:   200 MT--EYVV 205


>sp|P23293|SGV1_YEAST SERINE/THREONINE PROTEIN KINASE SGV1 >pir||A39526
            probable protein kinase SGV1 (EC 2.7.1.-) - yeast (Saccharomyces
            cerevisiae) >gnl|PID|d1015053 (D90317) SGV1 kinase [Saccharomyces
            cerevisiae] >gi|499701 (L33835) CDC28/cdc2-related kinase
            [Saccharomyces cerevisiae] >gi|849169 (U28371) Protein kinase
            (Swiss Prot. accession number P23293) [Saccharomyces cerevisiae]
            Length = 657

  Plus Strand HSPs:

 Score = 212 (74.6 bits), Expect = 1.3e-27, Sum P(2) = 1.3e-27
 Identities = 35/70 (50%), Positives = 50/70 (71%), Frame = +3

Query:   390 KYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFR 569
             KYT  VVT WYRAP++++G K+Y+T +DIW VGC+FAE     P+  G ++ DQ   IF+
Sbjct:   238 KYTSVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFK 297

Query:   570 ILGTPNSKNW 599
             +LGTP  ++W
Sbjct:   298 LLGTPTEEDW 307

 Score = 138 (48.6 bits), Expect = 1.3e-27, Sum P(2) = 1.3e-27
 Identities = 26/52 (50%), Positives = 36/52 (69%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             LE    K+ +LQ+L G+ Y H  + +HRD+K  N+LI+  G LK+ADFGLAR
Sbjct:   167 LEMCDIKNMMLQILEGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLAR 218


>gi|2465400 (AF020316) MAP kinase Mps1 [Magnaporthe grisea]
            Length = 415

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 1.6e-27, Sum P(2) = 1.6e-27
 Identities = 33/66 (50%), Positives = 44/66 (66%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++  + Y+  ID+WSVGCI AE++ G P F G    DQL +I  IL
Sbjct:   186 TEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHIL 245

Query:   576 GTPNSK 593
             GTPN +
Sbjct:   246 GTPNEE 251

 Score = 151 (53.2 bits), Expect = 1.6e-27, Sum P(2) = 1.6e-27
 Identities = 29/46 (63%), Positives = 35/46 (76%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             +SF+ Q+L G+ Y H   VLHRDLKP NLL+N + ELKI DFGLAR
Sbjct:   127 QSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLAR 172


>pir||A48082 mitogen-activated protein kinase p44-erk1 - human >gi|31221
            (X60188) protein serine/threonine kinase [Homo sapiens]
            Length = 379

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 1.7e-27, Sum P(2) = 1.7e-27
 Identities = 35/67 (52%), Positives = 48/67 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +IDIWSVGCI AEM++  P+FPG    DQL  I  IL
Sbjct:   202 TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 261

Query:   576 GTPNSKN 596
             G+P+ ++
Sbjct:   262 GSPSQED 268

 Score = 142 (50.0 bits), Expect = 1.7e-27, Sum P(2) = 1.7e-27
 Identities = 28/44 (63%), Positives = 31/44 (70%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL N   +LKI DFGLAR
Sbjct:   146 FLYQILRGLKYIHSANVLHRDLKPSNLLSNTTCDLKICDFGLAR 189


>pir||JX0296 protein kinase (EC 2.7.1.37) cdc2-related - fruit fly (Drosophila
            melanogaster) >gnl|PID|d1004402 (D16402) Dcdrk kinase [Drosophila
            melanogaster]
            Length = 349

  Plus Strand HSPs:

 Score = 210 (73.9 bits), Expect = 1.9e-27, Sum P(2) = 1.9e-27
 Identities = 36/81 (44%), Positives = 54/81 (66%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R F  P +  T ++VTLWYRAP++L+G + ++T +D+W+ GCI  E++ G PL PG S
Sbjct:   160 LARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNS 219

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E  QL  I  +LG P+   WP
Sbjct:   220 EIAQLDMIIDLLGAPSESIWP 240

 Score = 124 (43.7 bits), Expect = 1.9e-27, Sum P(2) = 1.9e-27
 Identities = 24/46 (52%), Positives = 32/46 (69%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K   LQ+L  + Y H R ++HRDLK  NLL+  +G +K+ADFGLAR
Sbjct:   117 KCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVADFGLAR 162


>pir||A36978 MAP kinase mpk-1 (EC 2.7.1.-) - Caenorhabditis elegans >gi|603527
            (Z46937) F43C1.2 [Caenorhabditis elegans] >gi|861209 (U27124) MPK-1
            [Caenorhabditis elegans]
            Length = 376

  Plus Strand HSPs:

 Score = 192 (67.6 bits), Expect = 2.3e-27, Sum P(2) = 2.3e-27
 Identities = 33/65 (50%), Positives = 47/65 (72%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +ID+WSVGCI AEM++  PLFPG    DQL  I  ++
Sbjct:   188 TEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVV 247

Query:   576 GTPNS 590
             G+P++
Sbjct:   248 GSPSN 252

 Score = 146 (51.4 bits), Expect = 2.3e-27, Sum P(2) = 2.3e-27
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   132 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 175


>sp|Q40532|NTF4_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG NTF4 (P45)
            >pir||S51321 serine/threonine protein kinase p45Ntf4 - common
            tobacco >pir||S68190 serine/threonine protein kinase p45 - common
            tobacco >gi|634070 (X83880) p45Ntf4 serine/threonine protein kinase
            [Nicotiana tabacum]
            Length = 393

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 2.7e-27, Sum P(2) = 2.7e-27
 Identities = 32/64 (50%), Positives = 44/64 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y+  ID+WSVGCIF E+++  PLFPG     QL  +  ++
Sbjct:   218 TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELI 277

Query:   576 GTPN 587
             GTP+
Sbjct:   278 GTPS 281

 Score = 152 (53.5 bits), Expect = 2.7e-27, Sum P(2) = 2.7e-27
 Identities = 30/53 (56%), Positives = 35/53 (66%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             GL     + FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   157 GLSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLAR 209


>sp|P35567|CC21_XENLA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 1 (P34 PROTEIN
            KINASE) >pir||A44349 protein kinase (EC 2.7.1.37) cdc2-A - African
            clawed frog >gi|214023 (M60680) p34cdc2x1.1 kinase [Xenopus laevis]
            Length = 302

  Plus Strand HSPs:

 Score = 312 (109.8 bits), Expect = 2.8e-27, P = 2.8e-27
 Identities = 56/81 (69%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR YTHEVVTLWYRAP+VL+GS +YST +D+WS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPVRVYTHEVVTLWYRAPEVLLGSVRYSTPVDVWSIGTIFAEIATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 191 (67.2 bits), Expect = 2.4e-14, P = 2.4e-14
 Identities = 37/70 (52%), Positives = 51/70 (72%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++++  KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 IDTMLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDSKGVIKLADFGLARAFGIPVRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>prf||2005165A cdc2 protein [Xenopus laevis]
            Length = 302

  Plus Strand HSPs:

 Score = 312 (109.8 bits), Expect = 2.8e-27, P = 2.8e-27
 Identities = 56/81 (69%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR YTHEVVTLWYRAP+VL+GS +YST +D+WS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPVRVYTHEVVTLWYRAPEVLLGSVRYSTPVDVWSIGTIFAEIATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 191 (67.2 bits), Expect = 2.4e-14, P = 2.4e-14
 Identities = 37/70 (52%), Positives = 51/70 (72%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++++  KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 IDTMLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDSKGVIKLADFGLARAFGIPVRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>sp|P51958|CC2_CARAU CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) >pir||I50474 protein kinase (EC 2.7.1.37) cdc2 - goldfish
            >gnl|PID|d1005133 (D17758) cdc2 kinase, catalytic component of MPF
            [Carassius auratus]
            Length = 302

  Plus Strand HSPs:

 Score = 312 (109.8 bits), Expect = 2.8e-27, P = 2.8e-27
 Identities = 54/82 (65%), Positives = 68/82 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+PVR YTHEVVTLWYRAP+VL+G+ +YST +D+WS+G IFAE+    PLF G S
Sbjct:   149 LARAFGVPVRVYTHEVVTLWYRAPEVLLGASRYSTPVDVWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             E DQL RIFR LGTPN++ WP+
Sbjct:   209 EIDQLFRIFRTLGTPNNEVWPD 230

 Score = 186 (65.5 bits), Expect = 9.2e-14, P = 9.2e-14
 Identities = 37/70 (52%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++ +  KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDPMLVKSYLYQILEGILFCHCRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>sp|P24033|CC22_XENLA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 2 (P34 PROTEIN
            KINASE) >pir||B44349 protein kinase (EC 2.7.1.37) cdc2-B - African
            clawed frog >gi|214035 (M60681) p34cdc2x1.2 kinase [Xenopus laevis]
            Length = 302

  Plus Strand HSPs:

 Score = 312 (109.8 bits), Expect = 2.8e-27, P = 2.8e-27
 Identities = 57/81 (70%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR YTHEVVTLWYRAP+VL+GS +YST +D+WSVG IFAE+    PLF G S
Sbjct:   149 LARAFGIPVRVYTHEVVTLWYRAPEVLLGSVRYSTPVDVWSVGTIFAEIATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRSLGTPNNEVWP 229

 Score = 185 (65.1 bits), Expect = 1.2e-13, P = 1.2e-13
 Identities = 36/70 (51%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++++  KS+L Q+L GI +CH R VLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 IDTMLVKSYLYQILQGIVFCHSRGVLHRDLKPQNLLIDNKGVIKLADFGLARAFGIPVRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>gi|2589145 (D82878) p34cdc2 [Hemicentrotus pulcherrimus]
            Length = 301

  Plus Strand HSPs:

 Score = 312 (109.8 bits), Expect = 2.8e-27, P = 2.8e-27
 Identities = 57/81 (70%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR YTHEVVTLWYRAP+VL+GS +Y+  ID+WS+GCIFAEMV   PLF G S
Sbjct:   148 LARAFGIPVRVYTHEVVTLWYRAPEVLLGSTRYACPIDMWSLGCIFAEMVTKRPLFHGDS 207

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTP  + WP
Sbjct:   208 EIDQLFRIFRTLGTPTDEIWP 228

 Score = 183 (64.4 bits), Expect = 2.0e-13, P = 2.0e-13
 Identities = 35/70 (50%), Positives = 49/70 (70%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++    KS+L Q+++GI +CH RR+LHRDLKPQNLLI+  G +K+ADFGLAR       +
Sbjct:    99 MDPALVKSYLHQMVDGILFCHSRRILHRDLKPQNLLIDNNGTIKLADFGLARAFGIPVRV 158

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   159 YTHEVVTLWY 168


>sp|Q39023|MPK3_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 3 (MAP KINASE 3)
            (ATMPK3) >pir||S40469 mitogen-activated protein kinase 3 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005401 (D21839) MAP
            kinase [Arabidopsis thaliana]
            Length = 370

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 2.8e-27, Sum P(2) = 2.8e-27
 Identities = 33/67 (49%), Positives = 44/67 (65%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y+  ID+WSVGCIF E++N  PLFPG     Q+  +  +L
Sbjct:   196 TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFPGKDHVHQMRLLTELL 255

Query:   576 GTPNSKN 596
             GTP   +
Sbjct:   256 GTPTESD 262

 Score = 146 (51.4 bits), Expect = 2.8e-27, Sum P(2) = 2.8e-27
 Identities = 27/44 (61%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL QLL G+ Y H   ++HRDLKP NLL+N   +LKI DFGLAR
Sbjct:   144 FLYQLLRGLKYIHSANIIHRDLKPSNLLLNANCDLKICDFGLAR 187


>gi|1136798 (U19775) Mxi2 [Homo sapiens] >prf||2124426A Mxi2 protein [Homo
            sapiens]
            Length = 297

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 2.9e-27, Sum P(2) = 2.9e-27
 Identities = 33/66 (50%), Positives = 45/66 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL  I R++
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 239

Query:   576 GTPNSK 593
             GTP ++
Sbjct:   240 GTPGAE 245

 Score = 137 (48.2 bits), Expect = 2.9e-27, Sum P(2) = 2.9e-27
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   129 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 173


>gnl|PID|e286194 (Z83731) M04C9.5 [Caenorhabditis elegans]
            Length = 527

  Plus Strand HSPs:

 Score = 220 (77.4 bits), Expect = 3.5e-27, Sum P(2) = 3.5e-27
 Identities = 39/70 (55%), Positives = 49/70 (70%), Frame = +3

Query:   393 YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRI 572
             YT  V T WYRAP++L+ S  Y++ ID+W++GCI AE+    PLFPG SE DQL +I  I
Sbjct:   197 YTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISI 256

Query:   573 LGTPNSKNWP 602
             LGTPN   WP
Sbjct:   257 LGTPNKDEWP 266

 Score = 122 (42.9 bits), Expect = 3.5e-27, Sum P(2) = 3.5e-27
 Identities = 24/51 (47%), Positives = 35/51 (68%), Frame = +2

Query:    35 ESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             ESV  ++ + Q+L G+A+ H     HRD+KP+N++ N    +KIADFGLAR
Sbjct:   140 ESVI-RNIIYQVLQGLAFMHKNGFFHRDMKPENIMCNGTELVKIADFGLAR 189


>sp|P39951|CC2_RAT CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN KINASE)
            (CYCLIN-DEPENDENT KINASE 1) (CDK1) >pir||S24913 protein kinase (EC
            2.7.1.37) cdc2 - rat >gi|57534 (X60767) cdc2(+) [Rattus norvegicus]
            Length = 297

  Plus Strand HSPs:

 Score = 311 (109.5 bits), Expect = 3.6e-27, P = 3.6e-27
 Identities = 55/81 (67%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIP+R YTHEVVTLWYR+P+VL+GS +YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 191 (67.2 bits), Expect = 2.1e-14, P = 2.1e-14
 Identities = 38/70 (54%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++S   KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>sp|P06493|CC2_HUMAN CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) (CYCLIN-DEPENDENT KINASE 1) (CDK1) >pir||A29539 protein
            kinase (EC 2.7.1.37) cdc2 - human >gi|29839 (X05360) CDC2
            polypeptide (CDC2) (AA 1-297) [Homo sapiens] >gi|29841 (Y00272)
            CDC2 protein (AA 1-297) [Homo sapiens] >prf||1306392A gene CDC2
            [Homo sapiens]
            Length = 297

  Plus Strand HSPs:

 Score = 311 (109.5 bits), Expect = 3.6e-27, P = 3.6e-27
 Identities = 55/81 (67%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIP+R YTHEVVTLWYR+P+VL+GS +YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 191 (67.2 bits), Expect = 2.1e-14, P = 2.1e-14
 Identities = 38/70 (54%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++S   KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>sp|P11440|CC2_MOUSE CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) (CYCLIN-DEPENDENT KINASE 1) (CDK1) >gi|192534 (M38724) cell
            cycle protein p34 [Mus musculus]
            Length = 297

  Plus Strand HSPs:

 Score = 311 (109.5 bits), Expect = 3.6e-27, P = 3.6e-27
 Identities = 55/81 (67%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIP+R YTHEVVTLWYR+P+VL+GS +YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 189 (66.5 bits), Expect = 3.6e-14, P = 3.6e-14
 Identities = 38/70 (54%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++S   KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>gi|1575290 (U58633) p34 cdc2 kinase [Mus musculus]
            Length = 297

  Plus Strand HSPs:

 Score = 311 (109.5 bits), Expect = 3.6e-27, P = 3.6e-27
 Identities = 55/81 (67%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIP+R YTHEVVTLWYR+P+VL+GS +YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 189 (66.5 bits), Expect = 3.6e-14, P = 3.6e-14
 Identities = 38/70 (54%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++S   KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDSSLVKSYLHQMLQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>pir||A47211 protein kinase ERK (EC 2.7.1.-) CEK1 - yeast (Candida albicans)
            (fragment)
            Length = 362

  Plus Strand HSPs:

 Score = 207 (72.9 bits), Expect = 5.0e-27, Sum P(2) = 5.0e-27
 Identities = 36/70 (51%), Positives = 51/70 (72%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++  ++Y+T ID+WSVGCI AEM++G PLFPG    +QL  I  +L
Sbjct:   173 TEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVL 232

Query:   576 GTPNSKNWPN 605
             GTPN +++ N
Sbjct:   233 GTPNMEDYYN 242

 Score = 125 (44.0 bits), Expect = 5.0e-27, Sum P(2) = 5.0e-27
 Identities = 25/44 (56%), Positives = 29/44 (65%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             F+ Q L  +   H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   117 FIYQTLRALKAMHSANVLHRDLKPLNLLLNSNCDLKICDFGLAR 160


>sp|Q39025|MPK5_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 5 (MAP KINASE 5)
            (ATMPK5) >pir||S40471 mitogen-activated protein kinase 5 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005403 (D21841) MAP
            kinase [Arabidopsis thaliana]
            Length = 376

  Plus Strand HSPs:

 Score = 188 (66.2 bits), Expect = 5.3e-27, Sum P(2) = 5.3e-27
 Identities = 33/64 (51%), Positives = 46/64 (71%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S +Y++ ID+WSVGCIFAE++   PLFPG     QL  I  ++
Sbjct:   201 TEYVVTRWYRAPELLLNSSEYTSAIDVWSVGCIFAEIMTREPLFPGKDYVHQLKLITELI 260

Query:   576 GTPN 587
             G+P+
Sbjct:   261 GSPD 264

 Score = 147 (51.7 bits), Expect = 5.3e-27, Sum P(2) = 5.3e-27
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   149 FLYQILRGLKYIHSANVLHRDLKPSNLLLNSNCDLKITDFGLAR 192


>gi|1067075 (Z50029) ZC504.3 [Caenorhabditis elegans]
            Length = 763

  Plus Strand HSPs:

 Score = 210 (73.9 bits), Expect = 5.7e-27, Sum P(2) = 5.7e-27
 Identities = 36/72 (50%), Positives = 53/72 (73%), Frame = +3

Query:   390 KYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFR 569
             K T  VVTLWYR+P++L+  K YST +D+WS+GCI AE +   P+F G SE +Q+ +IF+
Sbjct:   563 KLTPIVVTLWYRSPELLLEPKTYSTPVDMWSIGCIMAEFIMMKPMFQGDSEPNQVHQIFQ 622

Query:   570 ILGTPNSKNWPN 605
             ++GTP  + WP+
Sbjct:   623 MMGTPTEQIWPD 634

 Score = 136 (47.9 bits), Expect = 5.7e-27, Sum P(2) = 5.7e-27
 Identities = 28/46 (60%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K+ + QLL+GI + H   +LHRDLK  NLLI+  G LKIADFGLAR
Sbjct:   505 KTLMSQLLSGIEHMHKLWILHRDLKTSNLLISHSGILKIADFGLAR 550


>gnl|PID|e122949 (X82270) protein kinase [Medicago sativa]
            Length = 371

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 5.8e-27, Sum P(2) = 5.8e-27
 Identities = 33/63 (52%), Positives = 44/63 (69%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y++ ID+WSVGCIF E++N  PLFPG     Q+  +  +L
Sbjct:   197 TEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPLFPGKDHVHQMRLLTELL 256

Query:   576 GTP 584
             GTP
Sbjct:   257 GTP 259

 Score = 143 (50.3 bits), Expect = 5.8e-27, Sum P(2) = 5.8e-27
 Identities = 26/44 (59%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   ++HRDLKP NLL+N   +LKI DFGLAR
Sbjct:   145 FLYQILRGLRYIHSANIIHRDLKPSNLLLNANCDLKIIDFGLAR 188


>gi|2138340 (U94192) salicylic acid-activated MAP kinase [Nicotiana tabacum]
            Length = 393

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 5.8e-27, Sum P(2) = 5.8e-27
 Identities = 32/64 (50%), Positives = 43/64 (67%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYR P++L+ S  Y+  ID+WSVGCIF E+++  PLFPG     QL  I  ++
Sbjct:   218 TEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLIMELI 277

Query:   576 GTPN 587
             GTP+
Sbjct:   278 GTPS 281

 Score = 152 (53.5 bits), Expect = 5.8e-27, Sum P(2) = 5.8e-27
 Identities = 30/53 (56%), Positives = 35/53 (66%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             GL     + FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   157 GLSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLAR 209


>sp|P39745|SUR1_CAEEL MITOGEN-ACTIVATED PROTEIN KINASE SUR-1 (MAP KINASE SUR-1)
            >pir||A36977 MAP kinase sur-1 (EC 2.7.1.-) - Caenorhabditis elegans
            >gi|433357 (U03879) Sur-1 MAP kinase [Caenorhabditis elegans]
            Length = 444

  Plus Strand HSPs:

 Score = 192 (67.6 bits), Expect = 5.9e-27, Sum P(2) = 5.9e-27
 Identities = 33/65 (50%), Positives = 47/65 (72%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++ SK Y+ +ID+WSVGCI AEM++  PLFPG    DQL  I  ++
Sbjct:   256 TEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVV 315

Query:   576 GTPNS 590
             G+P++
Sbjct:   316 GSPSN 320

 Score = 146 (51.4 bits), Expect = 5.9e-27, Sum P(2) = 5.9e-27
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   200 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR 243


>gnl|PID|e354277 (Y15075) stress-activated protein kinase-3 [Danio rerio]
            Length = 363

  Plus Strand HSPs:

 Score = 197 (69.3 bits), Expect = 6.8e-27, Sum P(2) = 6.8e-27
 Identities = 36/66 (54%), Positives = 46/66 (69%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP+V++    Y+ T+DIWSVGCI AEM+ G PLF G    DQLM I ++ 
Sbjct:   181 TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLLGKPLFKGHDHLDQLMEIMKVT 240

Query:   576 GTPNSK 593
             GTP+ +
Sbjct:   241 GTPSKE 246

 Score = 135 (47.5 bits), Expect = 6.8e-27, Sum P(2) = 6.8e-27
 Identities = 29/59 (49%), Positives = 36/59 (61%), Frame = +2

Query:    11 KLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             KL  +  L     +  + Q+L G+ Y H   ++HRDLKP NL IN E ELKI DFGLAR
Sbjct:   116 KLMKMERLSEERVQYLVYQMLKGLKYIHAAGIIHRDLKPGNLAINEECELKILDFGLAR 174


>sp|Q39026|MPK6_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 6 (MAP KINASE 6)
            (ATMPK6) >pir||S40472 mitogen-activated protein kinase 6 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005404 (D21842) MAP
            kinase [Arabidopsis thaliana] >gi|2281091 (AC002333) MAP Kinase 6
            [Arabidopsis thaliana]
            Length = 395

  Plus Strand HSPs:

 Score = 188 (66.2 bits), Expect = 7.1e-27, Sum P(2) = 7.1e-27
 Identities = 32/66 (48%), Positives = 45/66 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y+  ID+WSVGCIF E+++  PLFPG     QL  +  ++
Sbjct:   221 TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELI 280

Query:   576 GTPNSK 593
             GTP+ +
Sbjct:   281 GTPSEE 286

 Score = 147 (51.7 bits), Expect = 7.1e-27, Sum P(2) = 7.1e-27
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   169 FLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLAR 212


>gi|50360 (X16461) CDC2 kinase [Mus musculus]
          Length = 297

  Plus Strand HSPs:

 Score = 308 (108.4 bits), Expect = 7.4e-27, P = 7.4e-27
 Identities = 54/81 (66%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIP+R YTHEV+TLWYR+P+VL+GS +YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPIRVYTHEVLTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 188 (66.2 bits), Expect = 4.8e-14, P = 4.8e-14
 Identities = 38/70 (54%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++S   KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVLTLWY 169


>gnl|PID|d1022330 (D85134) Bm cdc2 [Bombyx mori]
            Length = 319

  Plus Strand HSPs:

 Score = 308 (108.4 bits), Expect = 7.4e-27, P = 7.4e-27
 Identities = 56/81 (69%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + RAFG+PVR YTHEVVTLWYRAP+VL+GS++YS  IDIWSVGCIF+EM +  PLF G S
Sbjct:   149 LGRAFGVPVRVYTHEVVTLWYRAPEVLLGSQRYSCPIDIWSVGCIFSEMSSKKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR+L TP  + WP
Sbjct:   209 EIDQLFRIFRMLRTPTEEIWP 229

 Score = 179 (63.0 bits), Expect = 7.9e-13, P = 7.9e-13
 Identities = 35/70 (50%), Positives = 47/70 (67%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++    KS+L Q+ N I YCH RR+LHRDLKPQNLLI++ G +K+ADFGL R       +
Sbjct:   100 MDPSVVKSYLYQINNAILYCHQRRILHRDLKPQNLLIDKTGIIKVADFGLGRAFGVPVRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>sp|Q07176|MMK1_MEDSA MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG MMK1 (MAP KINASE
            MSK7) (MAP KINASE ERK1) >pir||S48123 mitogen-activated protein
            kinase 7 (EC 2.7.1.-) - alfalfa >pir||S59949
            serine/threonine-specific protein kinase MAP (EC 2.7.1.-) - alfalfa
            >gi|289125 (L07042) MAP kinase [Medicago sativa] >gi|298019
            (X66469) MAP Kinase [Medicago sativa]
            Length = 387

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 8.2e-27, Sum P(2) = 8.2e-27
 Identities = 32/64 (50%), Positives = 44/64 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y+  ID+WSVGCIF E+++  PLFPG     QL  +  ++
Sbjct:   213 TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELI 272

Query:   576 GTPN 587
             GTP+
Sbjct:   273 GTPS 276

 Score = 147 (51.7 bits), Expect = 8.2e-27, Sum P(2) = 8.2e-27
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   161 FLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLAR 204


>sp|P28869|ERK1_CANAL EXTRACELLULAR SIGNAL-REGULATED KINASE 1 (ERK1) (MAP
            KINASE 1) (MAPK 1)
            Length = 417

  Plus Strand HSPs:

 Score = 207 (72.9 bits), Expect = 8.6e-27, Sum P(2) = 8.6e-27
 Identities = 36/70 (51%), Positives = 51/70 (72%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++  ++Y+T ID+WSVGCI AEM++G PLFPG    +QL  I  +L
Sbjct:   228 TEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVL 287

Query:   576 GTPNSKNWPN 605
             GTPN +++ N
Sbjct:   288 GTPNMEDYYN 297

 Score = 127 (44.7 bits), Expect = 8.6e-27, Sum P(2) = 8.6e-27
 Identities = 25/44 (56%), Positives = 29/44 (65%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             F+ Q L  +   H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   172 FIYQTLRALKAMHSANVLHRDLKPSNLLLNSNCDLKICDFGLAR 215


>sp|Q06060|MAPK_PEA MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG D5 >pir||S33635
            mitogen-activated protein kinase homolog (clone D5) - garden pea
            >gi|20808 (X70703) MAP kinase homologue [Pisum sativum]
            Length = 394

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 9.1e-27, Sum P(2) = 9.1e-27
 Identities = 32/64 (50%), Positives = 44/64 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y+  ID+WSVGCIF E+++  PLFPG     QL  +  ++
Sbjct:   220 TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELI 279

Query:   576 GTPN 587
             GTP+
Sbjct:   280 GTPS 283

 Score = 147 (51.7 bits), Expect = 9.1e-27, Sum P(2) = 9.1e-27
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL Q+L G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   168 FLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLAR 211


>sp|P48734|CC2_BOVIN CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) (CYCLIN-DEPENDENT KINASE 1) (CDK1) >gi|498173 (L26547)
            cyclin-dependent kinase 1 [Bos taurus]
            Length = 297

  Plus Strand HSPs:

 Score = 307 (108.1 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 55/81 (67%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIP+R YTHEVVTLWYR+P+VL+GS  YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPIRVYTHEVVTLWYRSPEVLLGSAGYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR LGTPN++ WP
Sbjct:   209 EIDQLFRIFRALGTPNNEVWP 229

 Score = 191 (67.2 bits), Expect = 2.1e-14, P = 2.1e-14
 Identities = 38/70 (54%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++S   KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>gi|295932 (Y00867) PHO85 [Saccharomyces cerevisiae]
           Length = 305

  Plus Strand HSPs:

 Score = 307 (108.1 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 54/82 (65%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPV  ++ EVVTLWYRAPDVLMGS+ YST+IDIWS GCI AEM+ G PLFPG +
Sbjct:   154 LARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTN 213

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + +QL  IF I+GTPN   WP+
Sbjct:   214 DEEQLKLIFDIMGTPNESLWPS 235

 Score = 188 (66.2 bits), Expect = 5.8e-14, P = 5.8e-14
 Identities = 38/71 (53%), Positives = 49/71 (69%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----N 193
             GLE    K F  QLL G+A+CH+ ++LHRDLKPQNLLIN+ G+LK+ DFGLAR      N
Sbjct:   104 GLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVN 163

Query:   194 IYVLNIITLEY 226
              +   ++TL Y
Sbjct:   164 TFSSEVVTLWY 174


>gi|4170 (Y00867) PHO85 [Saccharomyces cerevisiae]
         Length = 302

  Plus Strand HSPs:

 Score = 307 (108.1 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 54/82 (65%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPV  ++ EVVTLWYRAPDVLMGS+ YST+IDIWS GCI AEM+ G PLFPG +
Sbjct:   151 LARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTN 210

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + +QL  IF I+GTPN   WP+
Sbjct:   211 DEEQLKLIFDIMGTPNESLWPS 232

 Score = 188 (66.2 bits), Expect = 5.4e-14, P = 5.4e-14
 Identities = 38/71 (53%), Positives = 49/71 (69%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----N 193
             GLE    K F  QLL G+A+CH+ ++LHRDLKPQNLLIN+ G+LK+ DFGLAR      N
Sbjct:   101 GLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVN 160

Query:   194 IYVLNIITLEY 226
              +   ++TL Y
Sbjct:   161 TFSSEVVTLWY 171


>pir||OKBY85 protein kinase (EC 2.7.1.37) PHO85 - yeast (Saccharomyces
            cerevisiae)
            Length = 302

  Plus Strand HSPs:

 Score = 307 (108.1 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 54/82 (65%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPV  ++ EVVTLWYRAPDVLMGS+ YST+IDIWS GCI AEM+ G PLFPG +
Sbjct:   151 LARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTN 210

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + +QL  IF I+GTPN   WP+
Sbjct:   211 DEEQLKLIFDIMGTPNESLWPS 232

 Score = 188 (66.2 bits), Expect = 5.4e-14, P = 5.4e-14
 Identities = 38/71 (53%), Positives = 49/71 (69%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----N 193
             GLE    K F  QLL G+A+CH+ ++LHRDLKPQNLLIN+ G+LK+ DFGLAR      N
Sbjct:   101 GLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVN 160

Query:   194 IYVLNIITLEY 226
              +   ++TL Y
Sbjct:   161 TFSSEVVTLWY 171


>sp|P17157|PH85_YEAST NEGATIVE REGULATOR OF THE PHO SYSTEM >gi|2347159 (U44030)
            Pho85p: Protein kinase homolog; negative transcriptional regulator
            [Saccharomyces cerevisiae]
            Length = 305

  Plus Strand HSPs:

 Score = 307 (108.1 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 54/82 (65%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPV  ++ EVVTLWYRAPDVLMGS+ YST+IDIWS GCI AEM+ G PLFPG +
Sbjct:   154 LARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTN 213

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             + +QL  IF I+GTPN   WP+
Sbjct:   214 DEEQLKLIFDIMGTPNESLWPS 235

 Score = 188 (66.2 bits), Expect = 5.8e-14, P = 5.8e-14
 Identities = 38/71 (53%), Positives = 49/71 (69%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----N 193
             GLE    K F  QLL G+A+CH+ ++LHRDLKPQNLLIN+ G+LK+ DFGLAR      N
Sbjct:   104 GLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVN 163

Query:   194 IYVLNIITLEY 226
              +   ++TL Y
Sbjct:   164 TFSSEVVTLWY 174


>sp|P13863|CC2_CHICK CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) >pir||S06011 protein kinase (EC 2.7.1.37) cdc2 - chicken
            >gi|63173 (X16881) CDC2 kinase (AA 1 - 303) [Gallus gallus]
            Length = 303

  Plus Strand HSPs:

 Score = 307 (108.1 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 56/82 (68%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIPVR YTHEVVTLWYR+P+VL+GS  YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPVRVYTHEVVTLWYRSPEVLLGSALYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWPN 605
             E DQL RIFR LGTPN+  WP+
Sbjct:   209 EIDQLFRIFRALGTPNNDVWPD 230

 Score = 187 (65.8 bits), Expect = 7.2e-14, P = 7.2e-14
 Identities = 38/70 (54%), Positives = 49/70 (70%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             L+    KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 LDRSRVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>gnl|PID|e292746 (X97315) cdc2MsD [Medicago sativa]
            Length = 311

  Plus Strand HSPs:

 Score = 307 (108.1 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 55/89 (61%), Positives = 67/89 (75%), Frame = +3

Query:   336 IFLIL*LNISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNG 515
             I  I  L + RAF +P++ YTHE+VTLWYRAP+VL+GS  YST +DIWSVGCIFAEMV  
Sbjct:   158 ILKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSSTYSTGVDIWSVGCIFAEMVRR 217

Query:   516 TPLFPGVSEADQLMRIFRILGTPNSKNWP 602
               LFPG SE  QL+ IF++LGTP  + WP
Sbjct:   218 QALFPGDSEFQQLLNIFKLLGTPTEQQWP 246

 Score = 156 (54.9 bits), Expect = 2.8e-10, P = 2.8e-10
 Identities = 36/71 (50%), Positives = 45/71 (63%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINR-EGELKIADFGLAR*-----N 193
             L +   +SFL QL  G+A+CH   VLHRDLKPQNLL+++ +G LKIAD GL R       
Sbjct:   116 LPNTLVQSFLFQLCKGVAHCHSHGVLHRDLKPQNLLLDQAKGILKIADLGLGRAFTVPLK 175

Query:   194 IYVLNIITLEY 226
              Y   I+TL Y
Sbjct:   176 SYTHEIVTLWY 186


>gnl|PID|d1022331 (D85135) cdc2-related kinase [Bombyx mori]
            Length = 404

  Plus Strand HSPs:

 Score = 203 (71.5 bits), Expect = 9.7e-27, Sum P(2) = 9.7e-27
 Identities = 36/81 (44%), Positives = 52/81 (64%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++R  G P R  T  VVTLWYRAP++L+ S + +  +D+W+ GCI  E++   PL PG +
Sbjct:   198 LARWLGAPARSATPRVVTLWYRAPELLLQSPRQTPALDMWAAGCILGELLANKPLLPGRT 257

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E +QL  I  +LGTP+   WP
Sbjct:   258 EIEQLELIVDLLGTPSDAIWP 278

 Score = 130 (45.8 bits), Expect = 9.7e-27, Sum P(2) = 9.7e-27
 Identities = 25/46 (54%), Positives = 33/46 (71%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K  +LQ+L G+ Y H   ++HRDLK  NLL+  +G +KIADFGLAR
Sbjct:   155 KCLMLQVLKGLKYLHSNFIVHRDLKVSNLLLTDKGCVKIADFGLAR 200


>sp|P54119|CC2_AJECA CELL DIVISION CONTROL PROTEIN 2 (CYCLIN-DEPENDENT PROTEIN
            KINASE) >pir||S36437 protein kinase (EC 2.7.1.37) cdc2 homolog -
            Ajellomyces capsulata >gi|396693 (X74361) cyclin-dependent protein
            kinase [Ajellomyces capsulatus]
            Length = 324

  Plus Strand HSPs:

 Score = 306 (107.7 bits), Expect = 1.2e-26, P = 1.2e-26
 Identities = 50/81 (61%), Positives = 67/81 (82%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+P+R YTHEVVTLWYRAP++L+G ++YST +D+WSVG IFAEM    PLFPG S
Sbjct:   169 LARAFGVPLRTYTHEVVTLWYRAPEILLGGRQYSTGVDMWSVGAIFAEMCTRKPLFPGDS 228

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D++ +IF++LGTP+   WP
Sbjct:   229 EIDEIFKIFKLLGTPDENTWP 249

 Score = 197 (69.3 bits), Expect = 7.2e-15, P = 7.2e-15
 Identities = 41/71 (57%), Positives = 47/71 (66%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----N 193
             GL     K F+ QL+ GI YCH  RVLHRDLKPQNLLI+REG LK+ADFGLAR       
Sbjct:   119 GLGEAMVKKFMAQLVEGIRYCHSHRVLHRDLKPQNLLIDREGNLKLADFGLARAFGVPLR 178

Query:   194 IYVLNIITLEY 226
              Y   ++TL Y
Sbjct:   179 TYTHEVVTLWY 189


>pir||A36074 protein kinase (EC 2.7.1.37) cdc2 - mouse
            Length = 297

  Plus Strand HSPs:

 Score = 306 (107.7 bits), Expect = 1.2e-26, P = 1.2e-26
 Identities = 54/81 (66%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFGIP+R YTHEVVTLWYR+P+VL+GS +YST +DIWS+G IFAE+    PLF G S
Sbjct:   149 LARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D L RIFR LGTPN++ WP
Sbjct:   209 EIDNLFRIFRALGTPNNEVWP 229

 Score = 189 (66.5 bits), Expect = 3.6e-14, P = 3.6e-14
 Identities = 38/70 (54%), Positives = 50/70 (71%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             ++S   KS+L Q+L GI +CH RRVLHRDLKPQNLLI+ +G +K+ADFGLAR       +
Sbjct:   100 MDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRV 159

Query:   197 YVLNIITLEY 226
             Y   ++TL Y
Sbjct:   160 YTHEVVTLWY 169


>sp|P23573|CC2C_DROME CELL DIVISION CONTROL PROTEIN 2 COGNATE >pir||S12007
            protein kinase (EC 2.7.1.37) cdc2 homolog C - fruit fly (Drosophila
            sp.) >gi|7709 (X57486) p34-cdc2 homologue [Drosophila melanogaster]
            Length = 314

  Plus Strand HSPs:

 Score = 306 (107.7 bits), Expect = 1.2e-26, P = 1.2e-26
 Identities = 53/81 (65%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAF +P+R YTHEVVTLWYRAP++L+G+K YST +DIWS+GCIF+EM+    LFPG S
Sbjct:   151 LARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEMIMRRSLFPGDS 210

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL RIFR L TP+  NWP
Sbjct:   211 EIDQLYRIFRTLSTPDETNWP 231

 Score = 168 (59.1 bits), Expect = 1.3e-11, P = 1.3e-11
 Identities = 32/64 (50%), Positives = 47/64 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-NI----YVLNII 214
             KS++ Q+L+ + +CH  R+LHRDLKPQNLL++  G++K+ADFGLAR  N+    Y   ++
Sbjct:   108 KSYMHQILDAVGFCHTNRILHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVV 167

Query:   215 TLEY 226
             TL Y
Sbjct:   168 TLWY 171


>gnl|PID|d1020329 (D64036) protein cdc2 kinase [Oryza sativa]
            Length = 302

  Plus Strand HSPs:

 Score = 306 (107.7 bits), Expect = 1.2e-26, P = 1.2e-26
 Identities = 51/83 (61%), Positives = 67/83 (80%), Frame = +3

Query:   354 LNISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPG 533
             L +SR+F +P++KYTHE++TLWYRAP+VL+G+  YST +DIWSVGCIFAE+    PLF G
Sbjct:   155 LGLSRSFTVPLKKYTHEILTLWYRAPEVLLGAAHYSTPVDIWSVGCIFAELATNQPLFAG 214

Query:   534 VSEADQLMRIFRILGTPNSKNWP 602
              SE  QL+ IF++LGTPN + WP
Sbjct:   215 DSEVQQLLHIFKLLGTPNEQVWP 237

 Score = 146 (51.4 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 34/65 (52%), Positives = 41/65 (63%), Frame = +2

Query:    44 TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREG-ELKIADFGLAR*NIYVLNIITL 220
             T K  + QL  G+A+CH R VLHRDLKP NLL++R+   LKIAD GL+R     L   T 
Sbjct:   111 TVKILMYQLCKGVAFCHGRGVLHRDLKPHNLLMDRKTMALKIADLGLSRSFTVPLKKYTH 170

Query:   221 EYLIL 235
             E L L
Sbjct:   171 EILTL 175


>gi|170869 (M76585) protein kinase [Candida albicans]
           Length = 417

  Plus Strand HSPs:

 Score = 207 (72.9 bits), Expect = 1.4e-26, Sum P(2) = 1.4e-26
 Identities = 36/70 (51%), Positives = 51/70 (72%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++  ++Y+T ID+WSVGCI AEM++G PLFPG    +QL  I  +L
Sbjct:   228 TEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVL 287

Query:   576 GTPNSKNWPN 605
             GTPN +++ N
Sbjct:   288 GTPNMEDYYN 297

 Score = 125 (44.0 bits), Expect = 1.4e-26, Sum P(2) = 1.4e-26
 Identities = 25/44 (56%), Positives = 29/44 (65%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             F+ Q L  +   H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   172 FIYQTLRALKAMHSANVLHRDLKPLNLLLNSNCDLKICDFGLAR 215


>sp|Q02399|CDK5_BOVIN CELL DIVISION PROTEIN KINASE 5 (TAU PROTEIN KINASE II
            CATALYTIC SUBUNIT) (TPKII CATALYTIC SUBUNIT) (PROLINE-DIRECTED
            PROTEIN KINASE 33 KD SUBUNIT) (PDPK) >gi|163261 (L04798)
            proline-directed kinase [Bos taurus]
            Length = 292

  Plus Strand HSPs:

 Score = 305 (107.4 bits), Expect = 1.5e-26, P = 1.5e-26
 Identities = 56/82 (68%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPVR Y+ EVVTLWYR+PDVL G+K YST+ID+WS GCIFAE+ N G PLFPG 
Sbjct:   147 LARAFGIPVRCYSAEVVTLWYRSPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGN 206

Query:   537 SEADQLMRIFRILGTPNSKNWP 602
                DQL RIFR+LGTP  + WP
Sbjct:   207 DVDDQLKRIFRLLGTPTEEQWP 228

 Score = 213 (75.0 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 44/74 (59%), Positives = 50/74 (67%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*--- 190
             C G L+    KSFL QLL G+ +CH R VLHRDLKPQNLLINR GELK+ADFGLAR    
Sbjct:    94 CNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGI 153

Query:   191 --NIYVLNIITLEY 226
                 Y   ++TL Y
Sbjct:   154 PVRCYSAEVVTLWY 167


>sp|P34112|CC2_DICDI CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) >pir||S24386 protein kinase (EC 2.7.1.37) cdc2 homolog -
            slime mold (Dictyostelium discoideum) >gi|167686 (M80808) p34-cdc2
            protein [Dictyostelium discoideum]
            Length = 296

  Plus Strand HSPs:

 Score = 305 (107.4 bits), Expect = 1.5e-26, P = 1.5e-26
 Identities = 53/81 (65%), Positives = 64/81 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA  IPVR YTHE+VTLWYRAP+VL+GSK YS  +D+WSVGCIF EM+N  PLF G  
Sbjct:   150 LARAVSIPVRVYTHEIVTLWYRAPEVLLGSKSYSVPVDMWSVGCIFGEMLNKKPLFSGDC 209

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQ+ RIFR+LGTP+   WP
Sbjct:   210 EIDQIFRIFRVLGTPDDSIWP 230

 Score = 188 (66.2 bits), Expect = 4.7e-14, P = 4.7e-14
 Identities = 39/64 (60%), Positives = 47/64 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NIYVLNII 214
             KS+L QLL G+AY H  R+LHRDLKPQNLLI+R+G LK+ADFGLAR       +Y   I+
Sbjct:   107 KSYLYQLLKGLAYSHGHRILHRDLKPQNLLIDRQGALKLADFGLARAVSIPVRVYTHEIV 166

Query:   215 TLEY 226
             TL Y
Sbjct:   167 TLWY 170


>sp|P25859|CC2B_ARATH CELL DIVISION CONTROL PROTEIN 2 HOMOLOG B >pir||S23096
            protein kinase (EC 2.7.1.37) cdc2 homolog B - Arabidopsis thaliana
            >gnl|PID|d1002099 (D10851) p32 protein serine/threonine
            kinase-related protein [Arabidopsis thaliana]
            Length = 309

  Plus Strand HSPs:

 Score = 305 (107.4 bits), Expect = 1.5e-26, P = 1.5e-26
 Identities = 53/83 (63%), Positives = 65/83 (78%), Frame = +3

Query:   354 LNISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPG 533
             L + RAF +P++ YTHE+VTLWYRAP+VL+GS  YST +D+WSVGCIFAEMV    LFPG
Sbjct:   162 LGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMVRRQALFPG 221

Query:   534 VSEADQLMRIFRILGTPNSKNWP 602
              SE  QL+ IFR+LGTP  + WP
Sbjct:   222 DSEFQQLLHIFRLLGTPTEQQWP 244

 Score = 144 (50.7 bits), Expect = 3.6e-08, P = 3.6e-08
 Identities = 34/71 (47%), Positives = 42/71 (59%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGEL-KIADFGLAR*-----N 193
             LE    +  + QL  G+A+CH   VLHRDLKPQNLL+ ++ EL KIAD GL R       
Sbjct:   114 LEPFLIQKLMFQLCKGVAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLK 173

Query:   194 IYVLNIITLEY 226
              Y   I+TL Y
Sbjct:   174 SYTHEIVTLWY 184


>gi|36621 (X66364) serine/threonine protein kinase [Homo sapiens]
          Length = 292

  Plus Strand HSPs:

 Score = 304 (107.0 bits), Expect = 2.0e-26, P = 2.0e-26
 Identities = 56/83 (67%), Positives = 66/83 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPVR Y+ EVVTLWYR PDVL G+K YST+ID+WS GCIFAE+ N G PLFPG 
Sbjct:   147 LARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGN 206

Query:   537 SEADQLMRIFRILGTPNSKNWPN 605
                DQL RIFR+LGTP  + WP+
Sbjct:   207 DVDDQLKRIFRLLGTPTEEQWPS 229

 Score = 213 (75.0 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 44/74 (59%), Positives = 50/74 (67%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*--- 190
             C G L+    KSFL QLL G+ +CH R VLHRDLKPQNLLINR GELK+ADFGLAR    
Sbjct:    94 CNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGI 153

Query:   191 --NIYVLNIITLEY 226
                 Y   ++TL Y
Sbjct:   154 PVRCYSAEVVTLWY 167


>sp|Q00535|CDK5_HUMAN CELL DIVISION PROTEIN KINASE 5 (TAU PROTEIN KINASE II
            CATALYTIC SUBUNIT) (TPKII CATALYTIC SUBUNIT) (KINASE PSSALRE)
            >pir||S23386 protein kinase (EC 2.7.1.37) cdc2-related PSSALRE -
            human
            Length = 291

  Plus Strand HSPs:

 Score = 304 (107.0 bits), Expect = 2.0e-26, P = 2.0e-26
 Identities = 56/83 (67%), Positives = 66/83 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPVR Y+ EVVTLWYR PDVL G+K YST+ID+WS GCIFAE+ N G PLFPG 
Sbjct:   146 LARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGN 205

Query:   537 SEADQLMRIFRILGTPNSKNWPN 605
                DQL RIFR+LGTP  + WP+
Sbjct:   206 DVDDQLKRIFRLLGTPTEEQWPS 228

 Score = 213 (75.0 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 44/74 (59%), Positives = 50/74 (67%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*--- 190
             C G L+    KSFL QLL G+ +CH R VLHRDLKPQNLLINR GELK+ADFGLAR    
Sbjct:    93 CNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGI 152

Query:   191 --NIYVLNIITLEY 226
                 Y   ++TL Y
Sbjct:   153 PVRCYSAEVVTLWY 166


>sp|Q16539|MP38_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE P38 (MAP KINASE P38)
            (CYTOKINE SUPPRESSIVE ANTI-INFLAMMATORY DRUG BINDING PROTEIN)
            (CSAID BINDING PROTEIN) (CSBP) (MAX-INTERACTING PROTEIN 2) (MAP
            KINASE MXI2) >pir||S53536 p38 MAP kinase - human >gi|529040
            (L35253) MAP kinase [Homo sapiens] >gi|603919 (L35264) CSaids
            binding protein [Homo sapiens] >prf||2111247A p38 mitogen-activated
            protein kinase [Homo sapiens]
            Length = 360

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 2.0e-26, Sum P(2) = 2.0e-26
 Identities = 33/66 (50%), Positives = 45/66 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL  I R++
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 239

Query:   576 GTPNSK 593
             GTP ++
Sbjct:   240 GTPGAE 245

 Score = 137 (48.2 bits), Expect = 2.0e-26, Sum P(2) = 2.0e-26
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   129 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 173


>sp|P70618|MP38_RAT MITOGEN-ACTIVATED PROTEIN KINASE P38 (MAP KINASE P38)
            >gi|1621647 (U73142) p38 mitogen activated protein kinase [Rattus
            norvegicus]
            Length = 360

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 2.0e-26, Sum P(2) = 2.0e-26
 Identities = 33/66 (50%), Positives = 45/66 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL  I R++
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 239

Query:   576 GTPNSK 593
             GTP ++
Sbjct:   240 GTPGAE 245

 Score = 137 (48.2 bits), Expect = 2.0e-26, Sum P(2) = 2.0e-26
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   129 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 173


>gi|1916984 (U91847) p38 mitogen activated protein kinase [Rattus norvegicus]
            Length = 360

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 2.0e-26, Sum P(2) = 2.0e-26
 Identities = 33/66 (50%), Positives = 45/66 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL  I R++
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 239

Query:   576 GTPNSK 593
             GTP ++
Sbjct:   240 GTPGAE 245

 Score = 137 (48.2 bits), Expect = 2.0e-26, Sum P(2) = 2.0e-26
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   129 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 173


>gnl|PID|e353227 (Z99708) mitogen-activated protein kinase 7 [Arabidopsis
            thaliana]
            Length = 361

  Plus Strand HSPs:

 Score = 178 (62.7 bits), Expect = 2.2e-26, Sum P(2) = 2.2e-26
 Identities = 36/77 (46%), Positives = 51/77 (66%), Frame = +3

Query:   372 FGIPVRKY----THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             FG+  R Y    T  VVT WYRAP++L+    Y T+ID+WSVGCIFAE++   P+FPG  
Sbjct:   177 FGL-ARTYEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTE 235

Query:   540 EADQLMRIFRILGTPNSKNW 599
               +QL  I  ++G+   ++W
Sbjct:   236 CLNQLKLIINVVGS--QQDW 253

 Score = 151 (53.2 bits), Expect = 2.2e-26, Sum P(2) = 2.2e-26
 Identities = 29/46 (63%), Positives = 33/46 (71%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K FL QLL G+ Y H   +LHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   136 KYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLAR 181


>pdb|1WFC|  Structure Of Apo, Unphosphorylated, P38 Mitogen Activated Protein
            Kinase P38 (P38 Map Kinase) The Mammalian Homologue Of The Yeast
            Hog1 Protein P38 Map Kinase, SerineTHREONINE PROTEIN KINASE,
            TRANSFERASE Mol_id: 1; Molecule: Mitog...
            Length = 366

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 2.3e-26, Sum P(2) = 2.3e-26
 Identities = 33/66 (50%), Positives = 45/66 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL  I R++
Sbjct:   186 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 245

Query:   576 GTPNSK 593
             GTP ++
Sbjct:   246 GTPGAE 251

 Score = 137 (48.2 bits), Expect = 2.3e-26, Sum P(2) = 2.3e-26
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   135 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 179


>sp|P51166|CDK5_XENLA CELL DIVISION PROTEIN KINASE 5 (NEURONAL CYCLIN-DEPENDENT
            KINASE 5) >gi|886034 (U24397) neuronal cyclin-dependent kinase 5
            [Xenopus laevis]
            Length = 292

  Plus Strand HSPs:

 Score = 303 (106.7 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 56/82 (68%), Positives = 65/82 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPVR Y+ EVVTLWYR PDVL G+K YST+ID+WS GCIFAE+ N G PLFPG 
Sbjct:   147 LARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGN 206

Query:   537 SEADQLMRIFRILGTPNSKNWP 602
                DQL RIFR+LGTP  + WP
Sbjct:   207 DVDDQLKRIFRLLGTPTEEQWP 228

 Score = 214 (75.3 bits), Expect = 6.7e-17, P = 6.7e-17
 Identities = 44/74 (59%), Positives = 51/74 (68%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*--- 190
             C G L+    KSF+ QLL G+A+CH R VLHRDLKPQNLLINR GELK+ADFGLAR    
Sbjct:    94 CNGDLDPEIVKSFMYQLLKGLAFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGI 153

Query:   191 --NIYVLNIITLEY 226
                 Y   ++TL Y
Sbjct:   154 PVRCYSAEVVTLWY 167


>sp|P49615|CDK5_MOUSE CELL DIVISION PROTEIN KINASE 5 (TAU PROTEIN KINASE II
            CATALYTIC SUBUNIT) (TPKII CATALYTIC SUBUNIT) (KINASE PSSALRE)
            (CRK6) >pir||A45091 protein kinase (EC 2.7.1.37) cdc2-related nclk
            - bovine >pir||I49592 protein kinase (EC 2.7.1.37) crk6 - mouse
            >gi|572619 (X82440) tau-protein kinase II [Bos taurus]
            >gnl|PID|d1006710 (D29678) cyclin-dependent kinase 5 [Mus musculus]
            Length = 292

  Plus Strand HSPs:

 Score = 303 (106.7 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 56/82 (68%), Positives = 65/82 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPVR Y+ EVVTLWYR PDVL G+K YST+ID+WS GCIFAE+ N G PLFPG 
Sbjct:   147 LARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGN 206

Query:   537 SEADQLMRIFRILGTPNSKNWP 602
                DQL RIFR+LGTP  + WP
Sbjct:   207 DVDDQLKRIFRLLGTPTEEQWP 228

 Score = 213 (75.0 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 44/74 (59%), Positives = 50/74 (67%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*--- 190
             C G L+    KSFL QLL G+ +CH R VLHRDLKPQNLLINR GELK+ADFGLAR    
Sbjct:    94 CNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGI 153

Query:   191 --NIYVLNIITLEY 226
                 Y   ++TL Y
Sbjct:   154 PVRCYSAEVVTLWY 167


>sp|Q03114|CDK5_RAT CELL DIVISION PROTEIN KINASE 5 (TAU PROTEIN KINASE II
            CATALYTIC SUBUNIT) (TPKII CATALYTIC SUBUNIT) (KINASE PSSALRE)
            >pir||A46365 protein kinase (EC 2.7.1.37) cdc2-related nclk - rat
            >gi|203390 (L02121) cdc2-related protein kinase [Rattus norvegicus]
            Length = 292

  Plus Strand HSPs:

 Score = 303 (106.7 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 56/82 (68%), Positives = 65/82 (79%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPVR Y+ EVVTLWYR PDVL G+K YST+ID+WS GCIFAE+ N G PLFPG 
Sbjct:   147 LARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGN 206

Query:   537 SEADQLMRIFRILGTPNSKNWP 602
                DQL RIFR+LGTP  + WP
Sbjct:   207 DVDDQLKRIFRLLGTPTEEQWP 228

 Score = 207 (72.9 bits), Expect = 3.7e-16, P = 3.7e-16
 Identities = 43/74 (58%), Positives = 49/74 (66%), Frame = +2

Query:    20 CIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*--- 190
             C G L+    KS L QLL G+ +CH R VLHRDLKPQNLLINR GELK+ADFGLAR    
Sbjct:    94 CNGDLDPEIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGI 153

Query:   191 --NIYVLNIITLEY 226
                 Y   ++TL Y
Sbjct:   154 PVRCYSAEVVTLWY 167


>gi|16217 (X57840) p34(cdc2)-like protein [Arabidopsis thaliana]
          Length = 170

  Plus Strand HSPs:

 Score = 303 (106.7 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 53/83 (63%), Positives = 65/83 (78%), Frame = +3

Query:   354 LNISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPG 533
             L + RAF +P++ YTHE+VTLWYRAP+VL+GS  YST +D+WSVGCIFAEMV    LFPG
Sbjct:    23 LGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMVRRQALFPG 82

Query:   534 VSEADQLMRIFRILGTPNSKNWP 602
              SE  QL+ IFR+LGTP  + WP
Sbjct:    83 DSEFRQLLHIFRLLGTPTEQQWP 105

 Score = 90 (31.7 bits), Expect = 0.11, P = 0.10
 Identities = 24/45 (53%), Positives = 28/45 (62%), Frame = +2

Query:   110 HRDLKPQNLLINREGEL-KIADFGLAR*-----NIYVLNIITLEY 226
             HRDLKPQNLL+ ++ EL KIAD GL R        Y   I+TL Y
Sbjct:     1 HRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWY 45


>sp|Q40517|NTF3_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG NTF3 (P43)
            >pir||S39559 mitogen-activated protein kinase 3 homolog ntf3 -
            common tobacco >gi|406751 (X69971) NTF3 gene product [Nicotiana
            tabacum]
            Length = 372

  Plus Strand HSPs:

 Score = 180 (63.4 bits), Expect = 2.5e-26, Sum P(2) = 2.5e-26
 Identities = 33/67 (49%), Positives = 45/67 (67%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+    Y T+ID+WSVGCIFAE++   P+FPG    +QL  I  IL
Sbjct:   191 TEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPVFPGTECLNQLKLIINIL 250

Query:   576 GTPNSKN 596
             G+   ++
Sbjct:   251 GSQREED 257

 Score = 149 (52.5 bits), Expect = 2.5e-26, Sum P(2) = 2.5e-26
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL QLL G+ Y H   +LHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   138 FLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLAR 181


>gi|2196780 (AF003597) p38 mitogen activated protein kinase [Canis familiaris]
            Length = 360

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 2.6e-26, Sum P(2) = 2.6e-26
 Identities = 33/65 (50%), Positives = 44/65 (67%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL  I R++
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 239

Query:   576 GTPNS 590
             GTP +
Sbjct:   240 GTPGA 244

 Score = 137 (48.2 bits), Expect = 2.6e-26, Sum P(2) = 2.6e-26
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   129 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 173


>gi|2408067 (Z99165) protein kinase [Schizosaccharomyces pombe]
            Length = 593

  Plus Strand HSPs:

 Score = 201 (70.8 bits), Expect = 2.9e-26, Sum P(2) = 2.9e-26
 Identities = 33/70 (47%), Positives = 46/70 (65%), Frame = +3

Query:   393 YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRI 572
             YT+ V+TLW+R P++L+G   Y T +DIWS GCI  E+  G P F G  E  QL  I+ +
Sbjct:   432 YTNRVITLWFRPPELLLGETAYDTAVDIWSAGCIVMELFTGKPFFQGRDEISQLEVIYDM 491

Query:   573 LGTPNSKNWP 602
             +GTP+  +WP
Sbjct:   492 MGTPDVHSWP 501

 Score = 135 (47.5 bits), Expect = 2.9e-26, Sum P(2) = 2.9e-26
 Identities = 25/43 (58%), Positives = 31/43 (72%), Frame = +2

Query:    65 QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*N 193
             Q+   +AY H R VLHRD+K  N+L+N  G+LK ADFGLAR N
Sbjct:   382 QIFEALAYLHHRGVLHRDIKGSNILLNNNGDLKFADFGLARFN 424


>bbs|138416 Cdc2E1-4 product {P element-induced G to D mutation at residue 43}
            [Drosophila melanogaster, Peptide Mutagenesis, 297 aa]
            Length = 297

  Plus Strand HSPs:

 Score = 302 (106.3 bits), Expect = 3.2e-26, P = 3.2e-26
 Identities = 54/81 (66%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+FGIPVR YTHE+VTLWYRAP+VL+GS +YS  +DIWS+GCIFAEM    PLF G S
Sbjct:   149 LGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL R+FRIL TP    WP
Sbjct:   209 EIDQLFRMFRILKTPTEDIWP 229

 Score = 178 (62.7 bits), Expect = 7.3e-13, P = 7.3e-13
 Identities = 37/70 (52%), Positives = 48/70 (68%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             +ES   +S+L Q+ + I +CH RRVLHRDLKPQNLLI++ G +K+ADFGL R       I
Sbjct:   100 MESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRI 159

Query:   197 YVLNIITLEY 226
             Y   I+TL Y
Sbjct:   160 YTHEIVTLWY 169


>bbs|138423 Cdc2E1-9 product {P element-induced P to S mutation at residue 242}
            [Drosophila melanogaster, Peptide Mutagenesis, 297 aa]
            Length = 297

  Plus Strand HSPs:

 Score = 302 (106.3 bits), Expect = 3.2e-26, P = 3.2e-26
 Identities = 54/81 (66%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+FGIPVR YTHE+VTLWYRAP+VL+GS +YS  +DIWS+GCIFAEM    PLF G S
Sbjct:   149 LGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL R+FRIL TP    WP
Sbjct:   209 EIDQLFRMFRILKTPTEDIWP 229

 Score = 178 (62.7 bits), Expect = 7.3e-13, P = 7.3e-13
 Identities = 37/70 (52%), Positives = 48/70 (68%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             +ES   +S+L Q+ + I +CH RRVLHRDLKPQNLLI++ G +K+ADFGL R       I
Sbjct:   100 MESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRI 159

Query:   197 YVLNIITLEY 226
             Y   I+TL Y
Sbjct:   160 YTHEIVTLWY 169


>sp|P23572|CC2_DROME CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) >pir||S12009 protein kinase (EC 2.7.1.37) cdc2 - fruit fly
            (Drosophila melanogaster) >gi|7705 (X57496) CDC2 gene product
            [Drosophila melanogaster] >gi|7711 (X57485) p34-cdc2 homologue
            [Drosophila melanogaster]
            Length = 297

  Plus Strand HSPs:

 Score = 302 (106.3 bits), Expect = 3.2e-26, P = 3.2e-26
 Identities = 54/81 (66%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+FGIPVR YTHE+VTLWYRAP+VL+GS +YS  +DIWS+GCIFAEM    PLF G S
Sbjct:   149 LGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL R+FRIL TP    WP
Sbjct:   209 EIDQLFRMFRILKTPTEDIWP 229

 Score = 178 (62.7 bits), Expect = 7.3e-13, P = 7.3e-13
 Identities = 37/70 (52%), Positives = 48/70 (68%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             +ES   +S+L Q+ + I +CH RRVLHRDLKPQNLLI++ G +K+ADFGL R       I
Sbjct:   100 MESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRI 159

Query:   197 YVLNIITLEY 226
             Y   I+TL Y
Sbjct:   160 YTHEIVTLWY 169


>bbs|138417 Cdc2216 product {P element-induced A to V mutation at residue 145}
            [Drosophila melanogaster, Peptide Mutagenesis, 297 aa]
            Length = 297

  Plus Strand HSPs:

 Score = 302 (106.3 bits), Expect = 3.2e-26, P = 3.2e-26
 Identities = 54/81 (66%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+FGIPVR YTHE+VTLWYRAP+VL+GS +YS  +DIWS+GCIFAEM    PLF G S
Sbjct:   149 LGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL R+FRIL TP    WP
Sbjct:   209 EIDQLFRMFRILKTPTEDIWP 229

 Score = 174 (61.3 bits), Expect = 2.1e-12, P = 2.1e-12
 Identities = 36/70 (51%), Positives = 47/70 (67%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             +ES   +S+L Q+ + I +CH RRVLHRDLKPQNLLI++ G +K+ DFGL R       I
Sbjct:   100 MESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVVDFGLGRSFGIPVRI 159

Query:   197 YVLNIITLEY 226
             Y   I+TL Y
Sbjct:   160 YTHEIVTLWY 169


>bbs|138418 Cdc2D57 product {P element-induced G to R mutation at residue 148}
            [Drosophila melanogaster, Peptide Mutagenesis, 297 aa]
            Length = 297

  Plus Strand HSPs:

 Score = 302 (106.3 bits), Expect = 3.2e-26, P = 3.2e-26
 Identities = 54/81 (66%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+FGIPVR YTHE+VTLWYRAP+VL+GS +YS  +DIWS+GCIFAEM    PLF G S
Sbjct:   149 LGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL R+FRIL TP    WP
Sbjct:   209 EIDQLFRMFRILKTPTEDIWP 229

 Score = 170 (59.8 bits), Expect = 6.1e-12, P = 6.1e-12
 Identities = 36/70 (51%), Positives = 47/70 (67%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             +ES   +S+L Q+ + I +CH RRVLHRDLKPQNLLI++ G +K+ADF L R       I
Sbjct:   100 MESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFRLGRSFGIPVRI 159

Query:   197 YVLNIITLEY 226
             Y   I+TL Y
Sbjct:   160 YTHEIVTLWY 169


>sp|Q40531|NTF6_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG NTF6 (P43)
            >pir||S51320 mitogen-activated protein kinase 6 (EC 2.7.1.-) -
            common tobacco >pir||S68189 serine/threonine protein kinase p43 -
            common tobacco >gi|634068 (X83879) p43Nft6 serine/threonine protein
            kinase [Nicotiana tabacum]
            Length = 371

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.2e-26, Sum P(2) = 3.2e-26
 Identities = 33/67 (49%), Positives = 43/67 (64%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+   +Y+  IDIWSVGCI  E++   PLFPG   A QL  I  +L
Sbjct:   196 TEYVVTRWYRAPELLLNCTEYTAAIDIWSVGCILMELIKREPLFPGRDYAQQLGLIIALL 255

Query:   576 GTPNSKN 596
             G+P   +
Sbjct:   256 GSPEDSD 262

 Score = 149 (52.5 bits), Expect = 3.2e-26, Sum P(2) = 3.2e-26
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL QLL G+ Y H   VLHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   144 FLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKICDFGLAR 187


>sp|P47812|MP38_XENLA MITOGEN-ACTIVATED PROTEIN KINASE 2 (MAP KINASE 2) (MPK2)
            >pir||A54805 protein kinase Mpk2 (EC 2.7.1.-) - African clawed frog
            >gi|557680 (X80751) MAP kinase [Xenopus laevis]
            Length = 361

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 3.5e-26, Sum P(2) = 3.5e-26
 Identities = 33/63 (52%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL  I R++
Sbjct:   181 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV 240

Query:   576 GTP 584
             GTP
Sbjct:   241 GTP 243

 Score = 137 (48.2 bits), Expect = 3.5e-26, Sum P(2) = 3.5e-26
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   130 FLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLAR 174


>gnl|PID|e323538 (Y12785) MAP kinase I [Petroselinum crispum]
            Length = 371

  Plus Strand HSPs:

 Score = 175 (61.6 bits), Expect = 3.5e-26, Sum P(2) = 3.5e-26
 Identities = 30/63 (47%), Positives = 42/63 (66%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+ S  Y+  ID+WSVGCI+ E++N  PLF G     Q+  +  +L
Sbjct:   197 TEYVVTRWYRAPELLLNSSDYTVAIDVWSVGCIYMELMNRKPLFAGKDHVHQMRLLTELL 256

Query:   576 GTP 584
             G+P
Sbjct:   257 GSP 259

 Score = 153 (53.9 bits), Expect = 3.5e-26, Sum P(2) = 3.5e-26
 Identities = 30/55 (54%), Positives = 36/55 (65%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*N 193
             GL     + FL QLL G+ Y H   ++HRDLKP NLL+N   +LKI DFGLAR N
Sbjct:   136 GLSEEHCQYFLYQLLRGLKYIHSANIIHRDLKPSNLLLNANCDLKICDFGLARHN 190


>pir||I78840 protein kinase (EC 2.7.1.37) cdk2-beta - black rat
            >gnl|PID|d1006499 (D28754) cyclin dependent kinase 2-beta [Rattus
            rattus]
            Length = 346

  Plus Strand HSPs:

 Score = 221 (77.8 bits), Expect = 3.7e-26, Sum P(2) = 3.7e-26
 Identities = 37/49 (75%), Positives = 45/49 (91%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEM 506
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEM
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEM 196

 Score = 198 (69.7 bits), Expect = 2.6e-23, Sum P(2) = 2.6e-23
 Identities = 42/79 (53%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + GL     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASALTGLPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168

 Score = 98 (34.5 bits), Expect = 3.7e-26, Sum P(2) = 3.7e-26
 Identities = 19/27 (70%), Positives = 20/27 (74%), Frame = +3

Query:   522 LFPGVSEADQLMRIFRILGTPNSKNWP 602
             LFPG SE DQL RIFR LGTP+   WP
Sbjct:   250 LFPGDSEIDQLFRIFRTLGTPDEVVWP 276


>pir||I48157 protein kinase (EC 2.7.1.37) cdk2L - golden hamster
            >gnl|PID|d1004685 (D17351) cdk2L [Mesocricetus auratus]
            Length = 346

  Plus Strand HSPs:

 Score = 221 (77.8 bits), Expect = 3.7e-26, Sum P(2) = 3.7e-26
 Identities = 37/49 (75%), Positives = 45/49 (91%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEM 506
             ++RAFG+PVR YTHEVVTLWYRAP++L+G K YST +DIWS+GCIFAEM
Sbjct:   148 LARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEM 196

 Score = 197 (69.3 bits), Expect = 3.4e-23, Sum P(2) = 3.4e-23
 Identities = 41/79 (51%), Positives = 50/79 (63%), Frame = +2

Query:     5 FYKLHCIGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLA 184
             F     + G+     KS+L QLL G+A+CH  RVLHRDLKPQNLLIN EG +K+ADFGLA
Sbjct:    90 FMDASAVTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLA 149

Query:   185 R*-----NIYVLNIITLEY 226
             R        Y   ++TL Y
Sbjct:   150 RAFGVPVRTYTHEVVTLWY 168

 Score = 98 (34.5 bits), Expect = 3.7e-26, Sum P(2) = 3.7e-26
 Identities = 19/27 (70%), Positives = 20/27 (74%), Frame = +3

Query:   522 LFPGVSEADQLMRIFRILGTPNSKNWP 602
             LFPG SE DQL RIFR LGTP+   WP
Sbjct:   250 LFPGDSEIDQLFRIFRTLGTPDEVVWP 276


>gnl|PID|d1005708 (D26178) serine/threonine protein kinase [Rattus norvegicus]
            Length = 629

  Plus Strand HSPs:

 Score = 217 (76.4 bits), Expect = 4.0e-26, Sum P(2) = 4.0e-26
 Identities = 38/70 (54%), Positives = 49/70 (70%), Frame = +3

Query:   393 YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRI 572
             YT  V T WYRAP+VL+ S  YS+ ID+W+VGCI AE+    PLFPG SE D + +I ++
Sbjct:   156 YTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQV 215

Query:   573 LGTPNSKNWP 602
             LGTP   +WP
Sbjct:   216 LGTPKKTDWP 225

 Score = 118 (41.5 bits), Expect = 4.0e-26, Sum P(2) = 4.0e-26
 Identities = 23/46 (50%), Positives = 31/46 (67%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             ++ + Q+L G+A+ H     HRDLKP+NLL      +KIADFGLAR
Sbjct:   103 RNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAR 148


>gi|2599387 (AF027300) positive transcription elongation factor b small subunit
            [Drosophila melanogaster]
            Length = 404

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 4.5e-26, Sum P(2) = 4.5e-26
 Identities = 35/85 (41%), Positives = 51/85 (60%), Frame = +3

Query:   360 ISRAFGIPVR----KYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLF 527
             ++RAF IP      +YT+ VVTLWYR P++L+G + Y   +D+W  GCI AEM   +P+ 
Sbjct:   202 LARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIM 261

Query:   528 PGVSEADQLMRIFRILGTPNSKNWP 602
              G +E  QL  I ++ G+     WP
Sbjct:   262 QGNTEQQQLTFISQLCGSFTPDVWP 286

 Score = 142 (50.0 bits), Expect = 4.5e-26, Sum P(2) = 4.5e-26
 Identities = 26/46 (56%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K  + QLLNG+ Y H  ++LHRD+K  N+LI + G LK+ADFGLAR
Sbjct:   159 KKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLAR 204


>sp|P50750|KPL1_HUMAN SERINE/THREONINE PROTEIN KINASE PITALRE >pir||A55262
            protein kinase (EC 2.7.1.37) cdc2-related PITALRE - human
            >gi|493130 (L25676) CDC2-related kinase [Homo sapiens]
            Length = 372

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 4.5e-26, Sum P(2) = 4.5e-26
 Identities = 35/86 (40%), Positives = 52/86 (60%), Frame = +3

Query:   360 ISRAFGIPVR----KYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLF 527
             ++RAF +       +YT+ VVTLWYR P++L+G + Y   ID+W  GCI AEM   +P+ 
Sbjct:   170 LARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIM 229

Query:   528 PGVSEADQLMRIFRILGTPNSKNWPN 605
              G +E  QL  I ++ G+   + WPN
Sbjct:   230 QGNTEQHQLALISQLCGSITPEVWPN 255

 Score = 140 (49.3 bits), Expect = 4.5e-26, Sum P(2) = 4.5e-26
 Identities = 26/46 (56%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K  +  LLNG+ Y H  ++LHRD+K  N+LI R+G LK+ADFGLAR
Sbjct:   127 KRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLAR 172


>bbs|138419 Cdc2E10 product {P element-induced L to Q mutation at residue 176}
            [Drosophila melanogaster, Peptide Mutagenesis, 297 aa]
            Length = 297

  Plus Strand HSPs:

 Score = 300 (105.6 bits), Expect = 5.2e-26, P = 5.2e-26
 Identities = 54/81 (66%), Positives = 62/81 (76%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+FGIPVR YTHE+VTLWYRAP+VL GS +YS  +DIWS+GCIFAEM    PLF G S
Sbjct:   149 LGRSFGIPVRIYTHEIVTLWYRAPEVLQGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL R+FRIL TP    WP
Sbjct:   209 EIDQLFRMFRILKTPTEDIWP 229

 Score = 178 (62.7 bits), Expect = 7.3e-13, P = 7.3e-13
 Identities = 37/70 (52%), Positives = 48/70 (68%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             +ES   +S+L Q+ + I +CH RRVLHRDLKPQNLLI++ G +K+ADFGL R       I
Sbjct:   100 MESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRI 159

Query:   197 YVLNIITLEY 226
             Y   I+TL Y
Sbjct:   160 YTHEIVTLWY 169


>sp|P34556|CC2_CAEEL CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) >pir||S41003 protein kinase (EC 2.7.1.37) cdc2 homolog -
            Caenorhabditis elegans >gi|6660 (X68384) p34 cdc2-like protein
            [Caenorhabditis elegans] >gi|414644 (Z27079) T05G5.3
            [Caenorhabditis elegans]
            Length = 332

  Plus Strand HSPs:

 Score = 300 (105.6 bits), Expect = 5.2e-26, P = 5.2e-26
 Identities = 51/80 (63%), Positives = 64/80 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RA GIP+R YTHEVVTLWYRAP++LMG+++YS  +D+WS+GCIFAEM    PLF G S
Sbjct:   167 LARAIGIPIRVYTHEVVTLWYRAPEILMGAQRYSMGVDMWSIGCIFAEMATKKPLFQGDS 226

Query:   540 EADQLMRIFRILGTPNSKNW 599
             E D+L RIFR+LGTP    W
Sbjct:   227 EIDELFRIFRVLGTPTELEW 246

 Score = 175 (61.6 bits), Expect = 2.6e-12, P = 2.6e-12
 Identities = 33/66 (50%), Positives = 45/66 (68%), Frame = +2

Query:    44 TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NIYVLN 208
             T KS+  Q+L  + +CH RRV+HRDLKPQNLL++  G +K+ADFGLAR       +Y   
Sbjct:   122 TLKSYTFQILQAMCFCHQRRVIHRDLKPQNLLVDNNGAIKLADFGLARAIGIPIRVYTHE 181

Query:   209 IITLEY 226
             ++TL Y
Sbjct:   182 VVTLWY 187


>gnl|PID|e292753 (X97317) cdc2MsF [Medicago sativa]
            Length = 316

  Plus Strand HSPs:

 Score = 300 (105.6 bits), Expect = 5.2e-26, P = 5.2e-26
 Identities = 51/83 (61%), Positives = 66/83 (79%), Frame = +3

Query:   354 LNISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPG 533
             L ++RAF +P++KYTHE++TLWYRAP+VL+G+  YS  +D+WSV CIFAE+V  T LFPG
Sbjct:   169 LGLARAFTVPLKKYTHEILTLWYRAPEVLLGATHYSMAVDMWSVACIFAELVTKTALFPG 228

Query:   534 VSEADQLMRIFRILGTPNSKNWP 602
              SE  QL+ IFR+LGTPN   WP
Sbjct:   229 DSELQQLLHIFRLLGTPNEDVWP 251

 Score = 143 (50.3 bits), Expect = 6.6e-08, P = 6.6e-08
 Identities = 33/65 (50%), Positives = 40/65 (61%), Frame = +2

Query:    44 TAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGE-LKIADFGLAR*NIYVLNIITL 220
             T K  + QL  G+A+CH   +LHRDLKP NLL++R+   LKIAD GLAR     L   T 
Sbjct:   125 TIKGLMYQLCKGVAFCHGHGILHRDLKPHNLLMDRKTMMLKIADLGLARAFTVPLKKYTH 184

Query:   221 EYLIL 235
             E L L
Sbjct:   185 EILTL 189


>sp|Q39027|MPK7_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 7 (MAP KINASE 7)
            (ATMPK7) >pir||S40473 mitogen-activated protein kinase 7 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005405 (D21843) MAP
            kinase [Arabidopsis thaliana]
            Length = 368

  Plus Strand HSPs:

 Score = 175 (61.6 bits), Expect = 5.4e-26, Sum P(2) = 5.4e-26
 Identities = 31/62 (50%), Positives = 43/62 (69%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+    Y T+ID+WSVGCIFAE++   P+FPG    +QL  I  ++
Sbjct:   191 TEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTECLNQLKLIINVV 250

Query:   576 GT 581
             G+
Sbjct:   251 GS 252

 Score = 151 (53.2 bits), Expect = 5.4e-26, Sum P(2) = 5.4e-26
 Identities = 29/46 (63%), Positives = 33/46 (71%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K FL QLL G+ Y H   +LHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   136 KYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLAR 181


>sp|Q39022|MPK2_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 2 (MAP KINASE 2)
            (ATMPK2) >gnl|PID|d1004047 (D14714) ATMPK2 [Arabidopsis thaliana]
            Length = 376

  Plus Strand HSPs:

 Score = 178 (62.7 bits), Expect = 5.7e-26, Sum P(2) = 5.7e-26
 Identities = 32/67 (47%), Positives = 45/67 (67%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+    Y T+ID+WSVGCIFAE++   P+FPG    +Q+  I  IL
Sbjct:   191 TEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPVFPGTECLNQIKLIINIL 250

Query:   576 GTPNSKN 596
             G+   ++
Sbjct:   251 GSQREED 257

 Score = 148 (52.1 bits), Expect = 5.7e-26, Sum P(2) = 5.7e-26
 Identities = 28/44 (63%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL QLL G+ Y H   +LHRDLKP NLL+N   +LKI DFGLAR
Sbjct:   138 FLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLAR 181


>gnl|PID|e292751 (X97316) cdc2MsE [Medicago sativa]
            Length = 414

  Plus Strand HSPs:

 Score = 192 (67.6 bits), Expect = 5.8e-26, Sum P(2) = 5.8e-26
 Identities = 36/92 (39%), Positives = 60/92 (65%), Frame = +3

Query:   360 ISRAFGIPVRKYTHE--VVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPG 533
             ++R +  P++  +    VVT+W RAP++L+G+K Y++ +D+W+VGCIFAE++   PLF G
Sbjct:   124 LARIYLAPLKPLSENGVVVTIWCRAPELLLGAKHYTSAVDMWAVGCIFAELLTLKPLFQG 183

Query:   534 VS--------EADQLMRIFRILGTPNSKNWPN 605
                       + DQL +IF++LG P  + WP+
Sbjct:   184 AEVKATPNPFQLDQLDKIFKVLGHPTLEKWPS 215

 Score = 135 (47.5 bits), Expect = 5.8e-26, Sum P(2) = 5.8e-26
 Identities = 29/59 (49%), Positives = 40/59 (67%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGE----LKIADFGLAR*NIY 199
             +   T KS L QLLNG+ Y H   ++HRD+KP N+L+  +GE    +K+AD GLAR  IY
Sbjct:    71 INQYTVKSILWQLLNGLNYLHSNWIVHRDVKPSNILVMGDGEEHGVVKVADCGLAR--IY 128

Query:   200 V 202
             +
Sbjct:   129 L 129


>sp|Q00646|CC2_EMENI CELL DIVISION CONTROL PROTEIN 2 (CYCLIN-DEPENDENT PROTEIN
            KINASE) >gi|458716 (U07169) protein kinase functional homolog of
            cdc2 [Emericella nidulans]
            Length = 323

  Plus Strand HSPs:

 Score = 299 (105.3 bits), Expect = 6.6e-26, P = 6.6e-26
 Identities = 50/81 (61%), Positives = 66/81 (81%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             ++RAFG+P+R YTHEVVTLWYR+P++L+G ++YST +D+WS G IFAEM    PLFPG S
Sbjct:   168 LARAFGVPLRTYTHEVVTLWYRSPEILLGGRQYSTGVDMWSCGAIFAEMCTRKPLFPGDS 227

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E D++ +IFRILGTP+   WP
Sbjct:   228 EIDEIFKIFRILGTPDETIWP 248

 Score = 191 (67.2 bits), Expect = 3.5e-14, P = 3.5e-14
 Identities = 39/71 (54%), Positives = 47/71 (66%), Frame = +2

Query:    29 GLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----N 193
             GL     K F+ QL+ GI +CH  RVLHRDLKPQNLLI+R+G LK+ADFGLAR       
Sbjct:   118 GLGDAMVKKFMAQLIEGIRFCHSHRVLHRDLKPQNLLIDRDGNLKLADFGLARAFGVPLR 177

Query:   194 IYVLNIITLEY 226
              Y   ++TL Y
Sbjct:   178 TYTHEVVTLWY 188


>gi|1326389 (U58752) strong similarity to CDC2/CDC28 subfamily of ser/thr
            protein kinases [Caenorhabditis elegans]
            Length = 377

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 7.3e-26, Sum P(2) = 7.3e-26
 Identities = 32/66 (48%), Positives = 44/66 (66%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+D+WSVGCI AE++ G  LFPG    DQL RI  + 
Sbjct:   191 TGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVT 250

Query:   576 GTPNSK 593
             GTP+ +
Sbjct:   251 GTPDEE 256

 Score = 134 (47.2 bits), Expect = 7.3e-26, Sum P(2) = 7.3e-26
 Identities = 25/45 (55%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP N+ +N + ELKI DFGLAR
Sbjct:   140 FLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLAR 184


>gnl|PID|e284865 (Z83244) W06F12.d [Caenorhabditis elegans]
            Length = 454

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 7.4e-26, Sum P(2) = 7.4e-26
 Identities = 34/66 (51%), Positives = 48/66 (72%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             THEVVT +YRAP++LMG+++Y+  +DIWSVGCIFAE++    LF      +QL  I  +L
Sbjct:   220 THEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLL 279

Query:   576 GTPNSK 593
             GTP+ +
Sbjct:   280 GTPSQE 285

 Score = 137 (48.2 bits), Expect = 7.4e-26, Sum P(2) = 7.4e-26
 Identities = 26/46 (56%), Positives = 32/46 (69%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             K F+ Q+L G+ Y H   +LHRD+KP NLL+N    LKI DFGLAR
Sbjct:   164 KVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLAR 209


>sp|Q90336|MP38_CYPCA MITOGEN-ACTIVATED PROTEIN KINASE P38 (MAP KINASE P38)
            >gnl|PID|d1012548 (D83274) mitogen-activated protein kinase (p38)
            [Cyprinus carpio]
            Length = 361

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 7.7e-26, Sum P(2) = 7.7e-26
 Identities = 32/63 (50%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    +QL +I R+ 
Sbjct:   181 TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT 240

Query:   576 GTP 584
             GTP
Sbjct:   241 GTP 243

 Score = 137 (48.2 bits), Expect = 7.7e-26, Sum P(2) = 7.7e-26
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   130 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 174


>sp|P20793|MAK_RAT SERINE/THREONINE-PROTEIN KINASE MAK (MALE GERM
            CELL-ASSOCIATED KINASE) >pir||A34711 kinase-related protein mak -
            rat >gi|205278 (M35862) male germ cell-associated kinase (mak)
            [Rattus norvegicus]
            Length = 622

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 8.1e-26, Sum P(2) = 8.1e-26
 Identities = 37/70 (52%), Positives = 49/70 (70%), Frame = +3

Query:   393 YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRI 572
             YT  V T WYRAP+VL+ S  YS+ ID+W+VG I AE+    PLFPG SE D++ +I ++
Sbjct:   156 YTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYTFRPLFPGTSEVDEIFKICQV 215

Query:   573 LGTPNSKNWP 602
             LGTP   +WP
Sbjct:   216 LGTPKKSDWP 225

 Score = 119 (41.9 bits), Expect = 8.1e-26, Sum P(2) = 8.1e-26
 Identities = 25/51 (49%), Positives = 34/51 (66%), Frame = +2

Query:    35 ESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             ESV  ++ + Q+L G+A+ H     HRD+KP+NLL      +KIADFGLAR
Sbjct:    99 ESVI-RNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAR 148


>sp|Q04859|MAK_MOUSE SERINE/THREONINE-PROTEIN KINASE MAK (MALE GERM
            CELL-ASSOCIATED KINASE) (PROTEIN KINASE RCK) >pir||I48733 protein
            kinase rck (EC 2.7.1.-) - mouse >gi|53914 (X66983) rck gene product
            [Mus musculus]
            Length = 622

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 8.1e-26, Sum P(2) = 8.1e-26
 Identities = 37/70 (52%), Positives = 49/70 (70%), Frame = +3

Query:   393 YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRI 572
             YT  V T WYRAP+VL+ S  YS+ ID+W+VG I AE+    PLFPG SE D++ +I ++
Sbjct:   156 YTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYTFRPLFPGTSEVDEIFKICQV 215

Query:   573 LGTPNSKNWP 602
             LGTP   +WP
Sbjct:   216 LGTPKKSDWP 225

 Score = 119 (41.9 bits), Expect = 8.1e-26, Sum P(2) = 8.1e-26
 Identities = 25/51 (49%), Positives = 34/51 (66%), Frame = +2

Query:    35 ESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             ESV  ++ + Q+L G+A+ H     HRD+KP+NLL      +KIADFGLAR
Sbjct:    99 ESVI-RNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAR 148


>bbs|138420 Cdc2E1-23 product {P element-induced G to D mutation at residue
            206} [Drosophila melanogaster, Peptide Mutagenesis, 297 aa]
            Length = 297

  Plus Strand HSPs:

 Score = 298 (104.9 bits), Expect = 8.5e-26, P = 8.5e-26
 Identities = 53/81 (65%), Positives = 63/81 (77%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS 539
             + R+FGIPVR YTHE+VTLWYRAP+VL+GS +YS  +DIWS+GCIFA+M    PLF G S
Sbjct:   149 LGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAKMATRKPLFQGDS 208

Query:   540 EADQLMRIFRILGTPNSKNWP 602
             E DQL R+FRIL TP    WP
Sbjct:   209 EIDQLFRMFRILKTPTEDIWP 229

 Score = 178 (62.7 bits), Expect = 7.3e-13, P = 7.3e-13
 Identities = 37/70 (52%), Positives = 48/70 (68%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*-----NI 196
             +ES   +S+L Q+ + I +CH RRVLHRDLKPQNLLI++ G +K+ADFGL R       I
Sbjct:   100 MESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRI 159

Query:   197 YVLNIITLEY 226
             Y   I+TL Y
Sbjct:   160 YTHEIVTLWY 169


>sp|Q40884|MAPK_PETHY MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 1 (PMEK1)
            >pir||S52989 mitogen-activated, extracelluar-regulated protein
            kinase 1 (EC 2.7.1.-) - garden petunia >gi|603871 (X83440) MAP/ERK
            kinase 1 [Petunia hybrida]
            Length = 384

  Plus Strand HSPs:

 Score = 176 (62.0 bits), Expect = 8.5e-26, Sum P(2) = 8.5e-26
 Identities = 32/67 (47%), Positives = 45/67 (67%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP++L+    Y T+ID+WSVGCIFA+++   P+FPG    +QL  I  IL
Sbjct:   191 TEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFADVLGRKPVFPGTECLNQLKLIINIL 250

Query:   576 GTPNSKN 596
             G+   ++
Sbjct:   251 GSQREED 257

 Score = 149 (52.5 bits), Expect = 8.5e-26, Sum P(2) = 8.5e-26
 Identities = 29/44 (65%), Positives = 32/44 (72%), Frame = +2

Query:    56 FLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL QLL G+ Y H   +LHRDLKP NLLIN   +LKI DFGLAR
Sbjct:   138 FLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLAR 181


>sp|P43068|MKC1_CANAL MITOGEN-ACTIVATED PROTEIN KINASE MKC1 (MAP KINASE MKC1)
            >gi|619450 (X76708) MAP kinase Mkc1 [Candida albicans]
            Length = 501

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 9.4e-26, Sum P(2) = 9.4e-26
 Identities = 34/63 (53%), Positives = 42/63 (66%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+  IDIWSVGCI AE++ G PLF G    DQL +I  IL
Sbjct:   211 TEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGKPLFRGKDYVDQLNQILMIL 270

Query:   576 GTP 584
             GTP
Sbjct:   271 GTP 273

 Score = 143 (50.3 bits), Expect = 9.4e-26, Sum P(2) = 9.4e-26
 Identities = 28/46 (60%), Positives = 35/46 (76%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             +SF+ Q+L G+ + H   VLHRDLKP NLL+N + ELKI DFGLAR
Sbjct:   152 QSFIYQVLCGLNFIHSADVLHRDLKPGNLLVNADCELKICDFGLAR 197


>sp|Q09892|STY1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE STY1 (MAP KINASE STY1)
            >pir||S57930 MAP kinase - fission yeast (Schizosaccharomyces pombe)
            >pir||S62551 STY1 protein - fission yeast (Schizosaccharomyces
            pombe) >bbs|175803 Phh1p=Hog1-like MAP kinase [Schizosaccharomyces
            pombe=fission yeast, L972, Peptide, 349 aa] >gi|897810 (X89262) MAP
            kinase [Schizosaccharomyces pombe] >gi|1022685 (U26739) Spc1p
            [Schizosaccharomyces pombe] >gi|1061294 (Z67757) Sty1p
            [Schizosaccharomyces pombe]
            Length = 349

  Plus Strand HSPs:

 Score = 178 (62.7 bits), Expect = 9.6e-26, Sum P(2) = 9.6e-26
 Identities = 32/63 (50%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T +YRAP++++  +KY+  +DIWS GCIFAEM+ G PLFPG    +Q   I  +L
Sbjct:   171 TGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRDHVNQFSIITELL 230

Query:   576 GTP 584
             GTP
Sbjct:   231 GTP 233

 Score = 144 (50.7 bits), Expect = 9.6e-26, Sum P(2) = 9.6e-26
 Identities = 28/52 (53%), Positives = 36/52 (69%), Frame = +2

Query:    32 LESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             LE+   + FL Q+L G+ + H   V+HRDLKP N+LIN   +LKI DFGLAR
Sbjct:   113 LETQFIQYFLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDFGLAR 164


>gi|1772646 (U66243) p38gamma MAP Kinase [Homo sapiens]
            Length = 367

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 1.0e-25, Sum P(2) = 1.0e-25
 Identities = 34/63 (53%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP+V++   +Y+ T+DIWSVGCI AEM+ G  LF G    DQL  I ++ 
Sbjct:   183 TGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVT 242

Query:   576 GTP 584
             GTP
Sbjct:   243 GTP 245

 Score = 132 (46.5 bits), Expect = 1.0e-25, Sum P(2) = 1.0e-25
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   132 FLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLAR 176


>gnl|PID|e291136 (Y10487) stress-activated protein kinase-3 [Homo sapiens]
            Length = 367

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 1.0e-25, Sum P(2) = 1.0e-25
 Identities = 34/63 (53%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP+V++   +Y+ T+DIWSVGCI AEM+ G  LF G    DQL  I ++ 
Sbjct:   183 TGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVT 242

Query:   576 GTP 584
             GTP
Sbjct:   243 GTP 245

 Score = 132 (46.5 bits), Expect = 1.0e-25, Sum P(2) = 1.0e-25
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   132 FLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLAR 176


>gnl|PID|d1020522 (D83073) p38b [Mus musculus]
            Length = 360

  Plus Strand HSPs:

 Score = 185 (65.1 bits), Expect = 1.0e-25, Sum P(2) = 1.0e-25
 Identities = 32/63 (50%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    +QL +I R+ 
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRMT 239

Query:   576 GTP 584
             GTP
Sbjct:   240 GTP 242

 Score = 137 (48.2 bits), Expect = 1.0e-25, Sum P(2) = 1.0e-25
 Identities = 26/45 (57%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   ++HRDLKP NL +N + ELKI DFGLAR
Sbjct:   129 FLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAR 173


>pir||S51008 protein kinase (EC 2.7.1.37) cdk5 homolog - fruit fly (Drosophila
            melanogaster) >prf||2102275A Cdk5 gene [Drosophila melanogaster]
            Length = 294

  Plus Strand HSPs:

 Score = 297 (104.5 bits), Expect = 1.1e-25, P = 1.1e-25
 Identities = 53/82 (64%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPV+ Y+ EVVTLWYR PDVL G+K Y+T+ID+WS GCI AE+ + G PLFPG 
Sbjct:   147 LARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILAELADAGRPLFPGS 206

Query:   537 SEADQLMRIFRILGTPNSKNWP 602
                DQLM+IFR+LGTPN  +WP
Sbjct:   207 DVLDQLMKIFRVLGTPNEDSWP 228

 Score = 202 (71.1 bits), Expect = 1.3e-15, P = 1.3e-15
 Identities = 40/72 (55%), Positives = 50/72 (69%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*----- 190
             G ++    +SF+LQLL G+A+CH   VLHRDLKPQNLLIN+ GELK+ADFGLAR      
Sbjct:    96 GEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLKPQNLLINKNGELKLADFGLARAFGIPV 155

Query:   191 NIYVLNIITLEY 226
               Y   ++TL Y
Sbjct:   156 KCYSAEVVTLWY 167


>gnl|PID|e255551 (X99511) CDK5 kinase [Drosophila melanogaster]
            Length = 294

  Plus Strand HSPs:

 Score = 297 (104.5 bits), Expect = 1.1e-25, P = 1.1e-25
 Identities = 53/82 (64%), Positives = 66/82 (80%), Frame = +3

Query:   360 ISRAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GTPLFPGV 536
             ++RAFGIPV+ Y+ EVVTLWYR PDVL G+K Y+T+ID+WS GCI AE+ + G PLFPG 
Sbjct:   147 LARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCILAELADAGRPLFPGS 206

Query:   537 SEADQLMRIFRILGTPNSKNWP 602
                DQLM+IFR+LGTPN  +WP
Sbjct:   207 DVLDQLMKIFRVLGTPNEDSWP 228

 Score = 202 (71.1 bits), Expect = 1.3e-15, P = 1.3e-15
 Identities = 40/72 (55%), Positives = 50/72 (69%), Frame = +2

Query:    26 GGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR*----- 190
             G ++    +SF+LQLL G+A+CH   VLHRDLKPQNLLIN+ GELK+ADFGLAR      
Sbjct:    96 GEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLKPQNLLINKNGELKLADFGLARAFGIPV 155

Query:   191 NIYVLNIITLEY 226
               Y   ++TL Y
Sbjct:   156 KCYSAEVVTLWY 167


>gi|2072361 (AF001008) p38Beta2 MAP Kinase [Homo sapiens] >gi|2232138
            (AF001174) p38beta2 MAP kinase [Homo sapiens] >gnl|PID|e332879
            (Y14440) stress activated protein kinase-2b [Homo sapiens]
            Length = 364

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 1.2e-25, Sum P(2) = 1.2e-25
 Identities = 33/64 (51%), Positives = 44/64 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL RI  ++
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVV 239

Query:   576 GTPN 587
             GTP+
Sbjct:   240 GTPS 243

 Score = 132 (46.5 bits), Expect = 1.2e-25, Sum P(2) = 1.2e-25
 Identities = 25/45 (55%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ QLL G+ Y H   ++HRDLKP N+ +N + EL+I DFGLAR
Sbjct:   129 FLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLAR 173


>gi|2316012 (U92268) mitogen activated protein kinase p38-2 [Homo sapiens]
            Length = 364

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 1.2e-25, Sum P(2) = 1.2e-25
 Identities = 33/64 (51%), Positives = 44/64 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL RI  ++
Sbjct:   180 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVV 239

Query:   576 GTPN 587
             GTP+
Sbjct:   240 GTPS 243

 Score = 132 (46.5 bits), Expect = 1.2e-25, Sum P(2) = 1.2e-25
 Identities = 25/45 (55%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ QLL G+ Y H   ++HRDLKP N+ +N + EL+I DFGLAR
Sbjct:   129 FLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLAR 173


>gnl|PID|e340014 (Z98977) protein kniase [Schizosaccharomyces pombe]
            Length = 352

  Plus Strand HSPs:

 Score = 180 (63.4 bits), Expect = 1.2e-25, Sum P(2) = 1.2e-25
 Identities = 33/86 (38%), Positives = 52/86 (60%), Frame = +3

Query:   378 IPVRKYTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVS------ 539
             +P       VVT+WYRAP++L+G+  Y+  ID+W++GCI+ EM+  +PLF G        
Sbjct:   170 LPFYSSDRVVVTIWYRAPELLLGAHDYTPAIDVWAIGCIYGEMLALSPLFKGDEIKMEDK 229

Query:   540 -----EADQLMRIFRILGTPNSKNWP 602
                  ++ Q++RI  +LGTP  + WP
Sbjct:   230 KVVPFQSTQMLRIMELLGTPTEERWP 255

 Score = 141 (49.6 bits), Expect = 1.2e-25, Sum P(2) = 1.2e-25
 Identities = 24/46 (52%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             KS L Q++NG+AY H+  ++HRDLKP N++I   G++KI D GL R
Sbjct:   118 KSILWQIINGVAYLHENWIMHRDLKPANIMITATGKVKIGDLGLGR 163


>gnl|PID|e320986 (Y13439) stress-activated protein kinase-3 [Mus musculus]
            Length = 367

  Plus Strand HSPs:

 Score = 188 (66.2 bits), Expect = 1.3e-25, Sum P(2) = 1.3e-25
 Identities = 35/63 (55%), Positives = 43/63 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  VVT WYRAP+V++   +Y+ T+DIWSVGCI AEM+ G  LF G    DQL  I +I 
Sbjct:   183 TGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKIT 242

Query:   576 GTP 584
             GTP
Sbjct:   243 GTP 245

 Score = 133 (46.8 bits), Expect = 1.3e-25, Sum P(2) = 1.3e-25
 Identities = 27/45 (60%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ Q+L G+ Y H   V+HRDLKP NL +N + ELKI DFGLAR
Sbjct:   132 FLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLAR 176


>sp|Q15759|M38B_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE P38 BETA (MAP KINASE P38
            BETA) >gi|1469306 (U53442) p38B MAP kinase [Homo sapiens]
            Length = 372

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 1.4e-25, Sum P(2) = 1.4e-25
 Identities = 33/64 (51%), Positives = 44/64 (68%), Frame = +3

Query:   396 THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRIL 575
             T  V T WYRAP++++    Y+ T+DIWSVGCI AE++ G  LFPG    DQL RI  ++
Sbjct:   188 TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVV 247

Query:   576 GTPN 587
             GTP+
Sbjct:   248 GTPS 251

 Score = 132 (46.5 bits), Expect = 1.4e-25, Sum P(2) = 1.4e-25
 Identities = 25/45 (55%), Positives = 33/45 (73%), Frame = +2

Query:    56 FLL-QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             FL+ QLL G+ Y H   ++HRDLKP N+ +N + EL+I DFGLAR
Sbjct:   137 FLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLAR 181


>sp|P39073|UME5_YEAST MEIOTIC MRNA STABILITY PROTEIN KINASE UME5 >gi|662800
            (U20222) Srb10p [Saccharomyces cerevisiae] >prf||2107321A RNA
            polymerase II regulatory protein [Saccharomyces cerevisiae]
            Length = 541

  Plus Strand HSPs:

 Score = 196 (69.0 bits), Expect = 1.5e-25, Sum P(2) = 1.5e-25
 Identities = 40/97 (41%), Positives = 61/97 (62%), Frame = +3

Query:   354 LNISRAFGIPVRK-YTHE--VVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPL 524
             L ++R F   ++  YT +  VVT+WYRAP++L+G++ Y+  +D+WSVGCIFAE++   P+
Sbjct:   291 LGLARKFHNMLQTLYTGDKVVVTIWYRAPELLLGARHYTPAVDLWSVGCIFAELIGLQPI 350

Query:   525 FPGVS-----------EADQLMRIFRILGTPNSKNWP 602
             F G             + +QL RI  +LGTP+ K WP
Sbjct:   351 FKGEEAKLDSKKTVPFQVNQLQRILEVLGTPDQKIWP 387

 Score = 132 (46.5 bits), Expect = 1.5e-25, Sum P(2) = 1.5e-25
 Identities = 24/46 (52%), Positives = 34/46 (73%), Frame = +2

Query:    50 KSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLAR 187
             +S + QLL+G++Y H   VLHRDLKP N+++  +G +KI D GLAR
Sbjct:   250 RSIMWQLLDGVSYLHQNWVLHRDLKPANIMVTIDGCVKIGDLGLAR 295


WARNING:  HSPs involving 2651 database sequences were not reported due to the
          limiting value of parameter B = 250.


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.99
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.379   0.178   0.700
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.357   0.163   0.583
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.371   0.172   0.656
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.362   0.168   0.613
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.361   0.166   0.570
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.361   0.166   0.624
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      201       201      10. 62 3  12 22   0.094 35
                                                  31    0.10 38
   +2      0      202       202      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   +1      0      202       202      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   -1      0      202       202      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   -2      0      202       202      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   -3      0      201       201      10. 62 3  12 22   0.094 35
                                                  31    0.10 38


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  2901
  No. of states in DFA:  594 (59 KB)
  Total size of DFA:  222 KB (256 KB)
  Time to generate neighborhood:  0.03u 0.00s 0.03t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  143.13u 0.60s 143.73t  Elapsed: 00:00:38
  Total cpu time:  143.38u 0.73s 144.11t  Elapsed: 00:00:38
  Start:  Fri Feb  6 22:03:50 1998   End:  Fri Feb  6 22:04:28 1998

WARNINGS ISSUED:  2

Date: 14:47:28 on Sun 17 Dec 117.