blastx_gbnr_files/1200374_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1200374
        (361 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A pir||S51910          cryptogene protein G4 - Sauroleis... -2   113  3.4e-06   1
A gi|340613            (L07545) A 'c' was inserted after... -3   119  4.5e-06   1
A gi|1947171           (AF000299) E03H12.5 gene product ... +1   108  2.2e-05   1
A gnl|PID|e16326       (X15081) MURF2 protein (AA 1-348)... -3   108  6.9e-05   1
A pir||C30010          hypothetical ORF-6 protein - Saur... -2   104  9.5e-05   1
A gi|1825739           (U88309) T23B3.5 gene product [Ca... +1   102  0.00011   1
A pir||A05235          hypothetical protein A-288 - Tryp... -2   104  0.00013   1
A sp|P15577|NU2M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CH... -3   100  0.00014   1
A pir||JS0233          NADH dehydrogenase (ubiquinone) (... -3   100  0.00014   1
A pir||B26696          hypothetical protein 1 (CYb-COII ... -3   105  0.00021   1
A sp|P15605|YM04_PARTE HYPOTHETICAL 18.8 KD PROTEIN (ORF... -2    94  0.00035   1
A pir||F22845          hypothetical protein 6 - Trypanos... -2   101  0.00040   1
A sp|P36079|YKI3_YEAST HYPOTHETICAL 23.7 KD PROTEIN IN M... -3    83  0.00057   2
A pir||A56657          PfEMP2/MESA protein (clone 9025/1... +1    90  0.00093   1
A gi|1022918           (U38184) ATPase subunit 6 [Trypan... -3    94  0.0011    1
A gi|436923            (U01849) ORF1 [Trypanosoma brucei]   -2    89  0.0012    1
A pir||E22845          hypothetical protein 4 - Trypanos... -2    98  0.0012    1
A gi|897642            (M14820) ORF2 bases 1807-2850; fi... -2    94  0.0015    1
A pir||S49427          hypothetical protein - Lactobacil... +1    88  0.0015    1
A sp|P24499|ATP6_TRYBB ATP SYNTHASE A CHAIN (PROTEIN 6)     -3    91  0.0023    1
A gi|343544            (M33228) ATPase 6 [Trypanosoma br... -3    91  0.0023    1
A pir||A35349          H+-transporting ATP synthase (EC ... -3    90  0.0026    1
A gnl|PID|d1000903     (D00570) open reading frame (196 ... -3    89  0.0027    1
A gnl|PID|d1000902     (D00570) open reading frame (251 ... -3    91  0.0027    1
A gi|294749            (L08174) NADH dehydrogenase subun... -2    85  0.0031    1
A gi|1216394           (U40265) ATPase subunit 6 [Trypan... -3    87  0.0032    1
A gi|2619013           (AF027868) sensor kinase [Bacillu... -2    93  0.0032    1
A gi|1890784           (U88489) NADH dehydrogenase 1 [Fl... -3    91  0.0040    1
A gnl|PID|e348257      (Z81048) C41G7.6 [Caenorhabditis ... +1    88  0.0047    1
A sp|P27571|XIST_MOUSE X INACTIVE SPECIFIC TRANSCRIPT PR... -3    90  0.0049    1
A gi|1255425           (U53154) C33G8.2 gene product [Ca... +1    91  0.0058    1
A sp|P25805|CYSP_PLAFA THROPHOZOITE CYSTEINE PROTEINASE ... +1    93  0.0059    1
A gi|1519343           (U66363) Pdd1p [Tetrahymena therm... +1    92  0.0064    1
A sp|P36043|YKU1_YEAST 64.6 KD PROTEIN IN TOR2-PAS1 INTE... +1    92  0.0070    1
A pir||A54503          51k merozoite surface antigen - P... +1    86  0.0071    1
A pir||S51911          cryptogene protein G5(ND3) - Saur... -2    81  0.0083    1
A sp|Q37355|COX3_TRYBO CYTOCHROME C OXIDASE POLYPEPTIDE ... -3    87  0.0097    1
A pir||S72692          probable membrane protein Q0320 -... -1    80  0.011     1
A gnl|PID|e321505      (Y10687) purine NTPase [Sulfolobu... +1    91  0.016     1
A pir||A45612          ATPase 6 - Sauroleishmania tarent... -3    86  0.017     1
A gi|457146            (L27838) rhoptry protein [Plasmod... +1    95  0.017     1
A gnl|PID|d1012343     (D83006) gene required for phosph... +1    92  0.018     1
A gi|501027            (U01849) ORF2 [Trypanosoma brucei]   -2    84  0.019     1
A gi|1439631           (U64598) coded for by C. elegans ... +1    91  0.024     1
A gi|160409            (M69183) mature-parasite-infected... +1    90  0.038     1
A pir||A45605          mature-parasite-infected erythroc... +1    90  0.038     1
A gi|1209842           (U45423) minus strand repeat moti... -3    82  0.051     1
A pir||B30010          hypothetical ORF-5 protein - Saur... -2    75  0.057     1
A gi|527431            (Z35663) T04A8.13 [Caenorhabditis... +1    87  0.072     1
A gi|496191            (L19858) NADH dehydrogenase [Plan... -3    72  0.072     1
A pir||S51908          cryptogene protein G1(ND9) - Saur... -3    83  0.074     1
A gi|495719            (L19837) NADH dehydrogenase [Ambl... -3    71  0.091     1
A gi|456389            (U05816) 3'-end [Crithidia fascic... -3    70  0.11      1
A gi|495764            (L19838) NADH dehydrogenase [Delt... -3    70  0.11      1
A pir||A25877          cytochrome-c oxidase (EC 1.9.3.1)... -2    84  0.12      1
A gi|2622329           (AE000889) unknown [Methanobacter... +1    83  0.12      1
A gi|495761            (L19842) NADH dehydrogenase [Dalt... -3    69  0.14      1
A gi|2072771           (U47023) unknown [Methanococcus m... -3    69  0.14      1
A gi|1255424           (U53154) C33G8.3 gene product [Ca... +1    79  0.15      1
A pir||S49423          hypothetical protein - Lactobacil... +1    79  0.15      1
A gi|1825637           (U88172) ZK354.7 gene product [Ca... +1    82  0.16      1
A pir||S34960          NADH dehydrogenase (ubiquinone) (... -2    85  0.16      1
A pir||S43597          coiled-coil protein homolog R07E5... +1    85  0.16      1
A gi|1890780           (U88487) NADH dehydrogenase 1 [Fl... -3    83  0.17      1
A gi|1890842           (U88518) NADH dehydrogenase 1 [Fl... -3    83  0.17      1
A pir||S60846          M protein precursor - Streptococc... +1    70  0.17      1
A sp|P14546|COX3_LEITA CYTOCHROME C OXIDASE POLYPEPTIDE ... -2    83  0.17      1
A gi|340588            (L07539) cytochrome oxidase [Leis... -2    83  0.17      1
A sp|Q58507|YB07_METJA HYPOTHETICAL PROTEIN MJ1107 >pir|... +1    79  0.18      1
A sp|P53911|YNN6_YEAST HYPOTHETICAL 49.4 KD PROTEIN IN N... +1    84  0.20      1
A gi|2621149           (AE000801) unknown [Methanobacter... -2    67  0.22      1
A sp|Q03525|YM8H_YEAST HYPOTHETICAL 16.2 KD PROTEIN IN P... +1    78  0.23      1
A pir||F30010          NADH dehydrogenase (ubiquinone) (... -3    83  0.26      1
A gi|1825636           (U88172) ZK354.3 gene product [Ca... +1    82  0.27      1
A gi|2196513           (U77778) putative membrane protei... -2    82  0.29      1
A gi|1209830           (U45421) minus strand repeat moti... -3    77  0.30      1
A sp|Q09863|YAFA_SCHPO HYPOTHETICAL 122.9 KD PROTEIN C29... +1    85  0.31      1
A pir||S61462          p83/p100 protein - Lyme disease s... +1    84  0.33      1
A gi|495843            (L19849) NADH dehydrogenase [Gram... -3    65  0.34      1
A gi|495846            (L19852) NADH dehydrogenase [Hald... -3    65  0.34      1
A gi|496166            (L19856) NADH dehydrogenase [Mend... -3    65  0.34      1
A gi|496288            (L19863) NADH dehydrogenase [Uner... -3    65  0.34      1
A pir||I40141          p93 protein - Lyme disease spiroc... +1    84  0.34      1
A gi|1707051           (U80447) strong similarity to pro... +1    83  0.35      1
A sp|P50532|XCPC_XENLA CHROMOSOME ASSEMBLY PROTEIN XCAP-... +1    85  0.36      1
A gi|1890800           (U88497) NADH dehydrogenase 1 [Fl... -3    81  0.36      1
A gi|1890810           (U88502) NADH dehydrogenase 1 [Fl... -3    81  0.36      1
A gnl|PID|e349281      (Z99280) Y57G11B.1 [Caenorhabditi... +1    81  0.38      1
A sp|P15911|VFP3_FOWPV PROTEIN FP3 >pir||WMVZP3 F3 prote... -2    68  0.38      1
A gnl|PID|d1021580     (AB001684) ORF54d [Chlorella vulg... -3    64  0.41      1
A gi|2447150           (U42580) a580R [Paramecium bursar... -3    64  0.41      1
A pir||A28782          cytochrome-c oxidase (EC 1.9.3.1)... -2    78  0.42      1
A gi|343596            (M20379) cytochrome c oxidase III... -3    80  0.44      1
A sp|P52531|VU79_HSV7J PROTEIN U79 >gi|1139680 (U43400) ... +1    79  0.46      1
A gi|1890778           (U88486) NADH dehydrogenase 1 [Fl... -3    80  0.47      1
A gi|1890790           (U88492) NADH dehydrogenase 1 [Fl... -3    80  0.47      1
A gi|1890798           (U88496) NADH dehydrogenase 1 [Fl... -3    80  0.47      1
A gi|1890818           (U88506) NADH dehydrogenase 1 [Fl... -3    80  0.47      1
A gi|563136            (U11682) unassigned reading frame... -2    63  0.50      1
A gi|780433            (U18466) pC84L [African swine fev... +1    63  0.50      1
A pir||S54621          probable membrane protein YOR015w... -3    73  0.51      1
A pir||C26696          hypothetical protein (CYb-COII in... -3    78  0.51      1
A gi|1209856           (U45425) minus strand repeat moti... -3    76  0.56      1
A gi|2444428           (AF020657) ErpX protein [Borrelia... +1    80  0.56      1
A gi|1294785           (L76262) ND3 gene product [Meloid... -2    69  0.57      1
A sp|P25808|SPB4_YEAST ATP-DEPENDENT RRNA HELICASE SPB4 ... +1    76  0.57      2
A sp|P13816|GARP_PLAFF GLUTAMIC ACID-RICH PROTEIN PRECUR... +1    82  0.59      1
A pir||E64456          hypothetical protein MJ1254 - Met... +1    81  0.59      1
A gi|1142588           (U05313) CR3 [Trypanosoma brucei]    -2    62  0.59      1
A pir||S60823          M protein precursor - Streptococc... +1    62  0.59      1
A gi|1890796           (U88495) NADH dehydrogenase 1 [Fl... -3    79  0.60      1
A gi|1890848           (U88521) NADH dehydrogenase 1 [Fl... -3    79  0.60      1
A gi|454844            (M74170) ORF 3 [Schistosoma mansoni] -2    80  0.63      1
A sp|P04540|NU5M_TRYBB NADH-UBIQUINONE OXIDOREDUCTASE CH... -3    81  0.66      1
A gnl|PID|e214803      (Z68300) T22B3.3 [Caenorhabditis ... +1    76  0.67      1
A gi|495722            (L19839) NADH dehydrogenase [Ampl... -3    61  0.69      1
A gnl|PID|d1021467     (AB001684) ORF49b [Chlorella vulg... +1    61  0.70      1
A gi|1890846           (U88520) NADH dehydrogenase 1 [Fl... -3    69  0.72      2
A gi|1199810           (X95665) cDNA6 gene product [Brug... -3    75  0.74      1
A sp|P06719|KNOB_PLAFN KNOB-ASSOCIATED HISTIDINE-RICH PR... +1    81  0.75      1
A gi|1890782           (U88488) NADH dehydrogenase 1 [Fl... -3    78  0.75      1
A gi|1890804           (U88499) NADH dehydrogenase 1 [Fl... -3    78  0.75      1
A pir||S72690          probable membrane protein Q0270 -... -2    71  0.75      1
A sp|P23271|OLF8_RAT   OLFACTORY RECEPTOR-LIKE PROTEIN I... -3    78  0.75      1
A pir||A64465          hypothetical protein MJ1322 - Met... +1    82  0.75      1
A gi|677198            (L03188) putative [Saccharomyces ... +1    82  0.76      1
A gi|1209848           (U45424) minus strand repeat moti... -3    74  0.77      1
A sp|P34849|NU2M_APIME NADH-UBIQUINONE OXIDOREDUCTASE CH... -2    70  0.78      2
A pir||S52960          NADH dehydrogenase chain 2 - hone... -2    70  0.78      2
A gi|496096            (L19853) NADH dehydrogenase [Kans... -3    60  0.79      1
A gi|496251            (L19862) NADH dehydrogenase [Sanc... -3    60  0.79      1
A sp|Q36426|NU2M_LOCMI NADH-UBIQUINONE OXIDOREDUCTASE CH... -3    78  0.80      1
A gi|829333            (X15081) ctyochrome c oxidase sub... -2    60  0.80      1
A gi|2621454           (AE000824) unknown [Methanobacter... -2    60  0.80      1
A gi|1294789           (L76261) ND3 gene product [Meloid... -2    68  0.80      1
A gnl|PID|e327003      (Z97341) membrane protein homolog... +1    80  0.81      1
A gi|2258370           (AF007261) haem lyase [Reclinomon... -3    80  0.81      1
A sp|P14873|MAPB_MOUSE MICROTUBULE-ASSOCIATED PROTEIN 1B... +1    84  0.82      1
A gnl|PID|e309969      (Z93389) T13F3.e [Caenorhabditis ... +1    74  0.82      1
A sp|P34859|NULM_APIME NADH-UBIQUINONE OXIDOREDUCTASE CH... -2    62  0.84      1
A gnl|PID|e308403      (Z74105) ORF YDL058w [Saccharomyc... +1    82  0.84      1
A pir||S49604          hypothetical protein 126 - euglen... -2    71  0.84      1
A gi|1890788           (U88491) NADH dehydrogenase 1 [Fl... -3    77  0.85      1
A gi|1890802           (U88498) NADH dehydrogenase 1 [Fl... -3    77  0.85      1
A gi|1890820           (U88507) NADH dehydrogenase 1 [Fl... -3    77  0.85      1
A gi|1890840           (U88517) NADH dehydrogenase 1 [Fl... -3    77  0.85      1
A pir||B21124          Bkm-like sex-determining region h... -2    68  0.86      1
A gi|1151158           (U43145) repeat organellar protei... +1    83  0.86      1
A sp|Q09286|YQK2_CAEEL HYPOTHETICAL 59.9 KD PROTEIN C56G... +1    70  0.86      2
A gi|2314724           (AE000652) toxR-activated gene (t... +1    77  0.87      1
A gi|2547186           (AF023537) NADH dehydrogenase sub... -3    59  0.88      1
A pir||S20422          zinc-binding protein - rat >gi|57... +1    68  0.88      1
A gnl|PID|e317373      (Z79755) F43G9.12 [Caenorhabditis... +1    74  0.88      2
A gnl|PID|e304571      (Z35851) ORF YBL091c [Saccharomyc... +1    59  0.88      1
A gnl|PID|e275694      (Z81068) F25H5.a [Caenorhabditis ... +1    79  0.88      1
A pir||S34959          NADH dehydrogenase (ubiquinone) (... -3    78  0.89      1
A pir||C64468          hypothetical protein MJ1348 - Met... +1    77  0.90      1
A gnl|PID|e349668      (Z99292) hypothetical protein [Sc... -3    75  0.90      1
A sp|P48278|YC38_CYAPA HYPOTHETICAL 33.3 KD PROTEIN YCF3... -3    76  0.91      1
A pir||D64506          hypothetical protein MJ1654 - Met... +1    75  0.91      1
A gi|476024            (L32150) carbamoyl phosphate synt... +1    83  0.91      1
A pir||S30782          integrin homolog - yeast (Sacchar... +1    82  0.92      1
A gi|1890814           (U88504) NADH dehydrogenase 1 [Fl... -3    76  0.93      1
A gi|1890828           (U88511) NADH dehydrogenase 1 [Fl... -3    76  0.93      1
A gi|1890838           (U88516) NADH dehydrogenase 1 [Fl... -3    76  0.93      1
A gnl|PID|e264286      (Z79755) F43G9.10 [Caenorhabditis... +1    78  0.93      1
A gi|1397347           (U61956) R13H7.1 gene product [Ca... -2    76  0.93      1
A sp|P25386|USO1_YEAST INTRACELLULAR PROTEIN TRANSPORT P... +1    82  0.93      1
A pir||S67593          transport protein USO1 - yeast (S... +1    82  0.93      1
A bbs|162669           (S76367) heat shock protein 90, h... +1    58  0.94      1
A gi|2622752           (AE000921) phosphoserine phosphat... +1    78  0.94      1
A gi|437639            (L04159) [Plasmodium falciparum 3... +1    78  0.94      1
A gi|2314527           (AE000636) competence locus E (co... -3    77  0.94      1
A gi|2313448           (AE000551) H. pylori predicted co... +1    68  0.94      1
A gi|1066807           (L47285) heat shock protein 82 [A... +1    79  0.95      1
A gnl|PID|e293723      (Y10137) homologue [Mycoplasma my... +1    77  0.95      1
A gi|806319            (M22580) unknown protein [Sacchar... +1    63  0.96      2
A gi|347377            (L22179) MLL-AF4 der(11) fusion p... +1    79  0.96      2
A bbs|83873            neurofilament protein M [rats, Pe... +1    77  0.96      1
A sp|P24889|NU2M_CAEEL NADH-UBIQUINONE OXIDOREDUCTASE CH... -3    75  0.96      1
A sp|P06266|NU6C_MARPO NADH-PLASTOQUINONE OXIDOREDUCTASE... -2    73  0.97      1
A sp|P39532|YJU2_YEAST HYPOTHETICAL 12.9 KD PROTEIN IN P... -3    68  0.97      1
A pir||S67087          hypothetical protein YOR195w - ye... +1    79  0.97      1
A pir||S72689          probable membrane protein Q0225 -... -2    67  0.97      1
A gi|2313204           (AE000533) H. pylori predicted co... +1    77  0.97      1
A gi|495840            (L19851) NADH dehydrogenase [Gram... -3    57  0.97      1
A gi|496230            (L19861) NADH dehydrogenase [Reve... -3    57  0.97      1
A pir||S44136          NADH dehydrogenase (ubiquinone) (... -3    57  0.97      1
A gi|2314322           (AE000622) tetracycline resistanc... -3    76  0.97      1
A sp|P44300|YH36_HAEIN HYPOTHETICAL PROTEIN HI1736 >pir|... -2    57  0.97      1
A pir||S60816          M protein precursor - Streptococc... +1    57  0.97      1
A gi|1890794           (U88494) NADH dehydrogenase 1 [Fl... -3    75  0.98      1
A gi|1890812           (U88503) NADH dehydrogenase 1 [Fl... -3    75  0.98      1
A gnl|PID|e284877      (Z83246) ZK795.a [Caenorhabditis ... +1    76  0.98      1
A sp|P05513|NU1M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CH... -3    74  0.98      1
A pir||A41464          hemolysin secretion protein CylB ... -3    78  0.98      1
A gi|309695            (M77713) major merozoite surface ... +1    73  0.99      1
A gi|309708            (M77720) major merozoite surface ... +1    73  0.99      1
A gnl|PID|e310324      (Z81557) F59A1.e [Caenorhabditis ... -1    75  0.99      1
A sp|P35600|GNF1_DROME GERMLINE TRANSCRIPTION FACTOR 1 >... +1    79  0.99      1
A gi|2121267           (U97685) replication factor C lar... +1    79  0.99      1
A sp|P24873|NU6M_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CH... -2    70  0.99      1
A bbs|121322           (S51495) 42 kda antigenic protein... -3    74  0.99      1
A sp|P15583|NU5M_LEITA NADH-UBIQUINONE OXIDOREDUCTASE CH... -2    65  0.990     1
A pir||S36956          cytochrome-c oxidase (EC 1.9.3.1)... -3    74  0.990     1
A pir||S36953          cytochrome-c oxidase (EC 1.9.3.1)... -3    74  0.990     1
A gi|833602            (X54277) cardiac tropomyosin [Cot... +1    74  0.992     1
A gi|1045294           (Z66527) cardiac tropomyosin [Sal... +1    74  0.992     1
A gi|1209836           (U45422) minus strand repeat moti... -3    71  0.992     1
A gi|1890808           (U88501) NADH dehydrogenase 1 [Fl... -3    74  0.994     1
A sp|P41512|TOP1_XENLA DNA TOPOISOMERASE I >gi|214834 (L... +1    78  0.995     1
A sp|P37748|RFC_ECOLI  O-ANTIGEN POLYMERASE >pir||I69644... -3    68  0.995     2
A gi|552199            (M63269) malaria antigen [Plasmod... +1    69  0.995     1
A pir||A56577          microtubule-associated protein MA... +1    81  0.996     1
A sp|Q05019|S40B_CHITE SALIVARY GLAND SP38-40.B PROTEIN ... +1    73  0.997     1
A gi|1657845           (U73211) cold acclimation protein... +1    61  0.997     2
A gi|2088720           (AF003139) F53G12.8 gene product ... +1    74  0.997     1
A gi|1123053           (U41994) F59A6.2 gene product [Ca... +1    67  0.997     1
A gi|2353181           (AF015565) VacA [Dictyostelium di... +1    77  0.998     1
A gnl|PID|e1168590     (Z99168) hypothetical protein [Sc... +1    69  0.998     1
A pir||S43286          MURF4 protein - Trypanosoma cruzi... -3    55  0.998     1
A sp|P21536|ATP8_SCHPO ATP SYNTHASE PROTEIN 8 (A6L) >gnl... -3    55  0.998     1
A gi|1809305           (U72241) histone H1-3 [Arabidopsi... +1    70  0.999     1
A pir||PQ0818          expressed sequence tag R80 - rape... +1    64  0.999     1
A pir||S61312          cap protein 1, merozoite - Plasmo... +1    74  0.999     1
A sp|Q10175|YAV6_SCHPO PROBABLE PEPTIDYL-PROLYL CIS-TRAN... +1    74  0.999     1
A gi|1513319           (U67068) CCAAT/enhancer-binding p... +1    66  0.9993    1
A gi|860681            (U27312) F26A1.5 gene product [Ca... +1    61  0.9993    1
A pir||I30010          NADH dehydrogenase (ubiquinone) (... -3    75  0.9994    1
A pir||A45669          neurofilament triplet M protein -... +1    77  0.9994    1
A gi|56752             (Z12152) Neurofilament protein mi... +1    77  0.9994    1
A sp|P12839|NFM_RAT    NEUROFILAMENT TRIPLET M PROTEIN (... +1    77  0.9994    1
A gi|833603            (X54278) cytoskeletal tropomyosin... +1    72  0.9994    1
A gnl|PID|d1010105     (D50867) troponin T [Halocynthia ... +1    72  0.9994    1
A gi|1786037           (U72284) NADH dehydrogenase subun... -2    72  0.9994    1
A gi|1890830           (U88512) NADH dehydrogenase 1 [Fl... -3    73  0.9994    1
A gi|662259            (L39769) ORF1 [Plasmid pIP501]       +1    76  0.9994    1
A pir||S22183          lysine/aspartic acid-rich protein... +1    62  0.9994    2
A gnl|PID|e219154      (Z68879) K08F4.5 [Caenorhabditis ... +1    71  0.9996    1
A sp|P28540|SECY_PAVLU PREPROTEIN TRANSLOCASE SECY SUBUN... -3    74  0.9996    1
A gi|2190539           (AC001229) F5I14.2 gene product [... +1    74  0.9997    1
A pir||S26025          NADH dehydrogenase (ubiquinone) (... -3    57  0.9997    2
A sp|P52582|VEGF_COTJA VASCULAR ENDOTHELIAL GROWTH FACTO... +1    67  0.9997    1
A gi|495747            (L19841) NADH dehydrogenase [Comm... -3    54  0.9997    1
A gi|495834            (L19848) NADH dehydrogenase [Flex... -3    54  0.9997    1
A gi|606881            (U12395) unknown [Trypanosoma bru... -3    54  0.9997    1
A gi|1345111           (U36383) ORF72;  Method: conceptu... -3    54  0.9997    1
A gi|495790            (L19847) NADH dehydrogenase [Exit... -1    54  0.9998    1
A gi|496104            (L19854) NADH dehydrogenase [Laev... -1    54  0.9998    1
gi|1208822           (U49945) coded for by C. elegans ... +1    75  0.9998    1
gi|179830            (M64110) caldesmon [Homo sapiens]    +1    75  0.9998    1
sp|P53335|YG5W_YEAST HYPOTHETICAL 31.3 KD PROTEIN IN T... +1    72  0.9998    1
sp|P47381|Y135_MYCGE HYPOTHETICAL PROTEIN MG135 >pir||... -3    72  0.9998    1
pir||S67128          probable membrane protein YOR235w... -3    64  0.9998    1
sp|P24884|NU5M_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CH... -3    57  0.9998    2
gnl|PID|d1003917     (D14540) MLL [Homo sapiens]          +1    79  0.9999    1
gnl|PID|e329895      (AJ000496) cyclic nucleotide-gate... +1    78  0.9999    1
pir||D22848          hypothetical ORF-10 protein - Sau... -3    63  0.99991   1
pir||A42771          reticulocyte-binding protein 1 - ... +1    80  0.99993   1
gnl|PID|e311491      (Z93937) unknown [Bacillus subtilis] -3    70  0.99993   1
sp|Q00798|RBP1_PLAVB RETICULOCYTE BINDING PROTEIN 1 PR... +1    80  0.99994   1
sp|P07709|NU6M_DROYA NADH-UBIQUINONE OXIDOREDUCTASE CH... -2    69  0.99994   1
gi|2554915           (AF019085) BRDT [Homo sapiens]       +1    68  0.99994   2
gnl|PID|e244556      (Z73427) F58B3.4 [Caenorhabditis ... +1    75  0.99995   1
pir||S53863          H(+)-transporting ATPase chain 6 ... -2    71  0.99995   1



>pir||S51910 cryptogene protein G4 - Sauroleishmania tarentolae (strain LEM125)
            Length = 169

  Minus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 3.4e-06, P = 3.4e-06
 Identities = 31/90 (34%), Positives = 52/90 (57%), Frame = -2

Query:   336 FIFII-IYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFL 160
             F+FI  +++F+ LF    W++F   FF F++  +   +F F ++  +   F G  +F+  
Sbjct:    77 FLFIFWVFIFLLLF----WFVFGFLFFFFYVCVL---IFYFEFLFMLFFVFCGFLLFVMF 129

Query:   159 FLIFLSIC*HIFLV---LLFVYVFLF--IDFFIFLL 67
              L F+S    I LV   LLF++VF F  + F I +L
Sbjct:   130 ILFFISFFVLIVLVFCWLLFIFVFRFFCMTFCILIL 165

 Score = 111 (39.1 bits), Expect = 5.5e-06, P = 5.5e-06
 Identities = 33/103 (32%), Positives = 53/103 (51%), Frame = -2

Query:   354 CSLFLSFIFIIIYLF-----I*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQY 190
             C +F  F  III+ F     + +F    W++F   FF F++  +   +F F ++  +   
Sbjct:    63 CIVFFLFTVIIIFFFLFIFWVFIFLLLFWFVFGFLFFFFYVCVL---IFYFEFLFMLFFV 119

Query:   189 FVGNNIFLFLFLIFLSIC*HIFLV---LLFVYVFLF--IDFFIFLL 67
             F G  +F+   L F+S    I LV   LLF++VF F  + F I +L
Sbjct:   120 FCGFLLFVMFILFFISFFVLIVLVFCWLLFIFVFRFFCMTFCILIL 165

 Score = 92 (32.4 bits), Expect = 0.00075, P = 0.00075
 Identities = 25/90 (27%), Positives = 43/90 (47%), Frame = -2

Query:   336 FIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLF 157
             F+F +I +F  LF      IF +  FL     +   +F F Y+  ++ YF       FLF
Sbjct:    67 FLFTVIIIFFFLF------IFWVFIFLLLFWFVFGFLFFFFYVCVLIFYFE------FLF 114

Query:   156 LIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             ++F   C  +  V+   ++  FI FF+ ++
Sbjct:   115 MLFFVFCGFLLFVM---FILFFISFFVLIV 141

 Score = 92 (32.4 bits), Expect = 0.00075, P = 0.00075
 Identities = 30/95 (31%), Positives = 51/95 (53%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C LF+   +++I L    F+   +++F +    FF+      +F +V+I  +L +FV  
Sbjct:    45 VC-LFVLVCYVVILLLC--FDCIVFFLFTVIIIFFFL-----FIF-WVFIFLLLFWFV-- 93

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIF 73
               F FLF  F  +C     VL+F + FLF+ FF+F
Sbjct:    94 --FGFLFFFFY-VC-----VLIFYFEFLFMLFFVF 120

 Score = 92 (32.4 bits), Expect = 0.00075, P = 0.00075
 Identities = 28/110 (25%), Positives = 55/110 (50%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C LF+   +++I L    F+   +++F +    FF+      +F +V+I  +L +FV  
Sbjct:    45 VC-LFVLVCYVVILLLC--FDCIVFFLFTVIIIFFFL-----FIF-WVFIFLLLFWFVFG 95

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYV--FLFIDFFIFLL*YNHIIITDRCMW 28
              +F F ++  L        +L FV+    LF+ F +F + +  +I+   C W
Sbjct:    96 FLFFFFYVCVLIFYFEFLFMLFFVFCGFLLFVMFILFFISFFVLIVLVFC-W 146

 Score = 85 (29.9 bits), Expect = 0.015, P = 0.015
 Identities = 27/97 (27%), Positives = 51/97 (52%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE- 180
             F +++F+  +  F C F F +    +    ++  F  + ++  Y  + IL +CF+ ++  
Sbjct:    12 FFMYYFVCCIFYF-CFF-FCLFDLCVMVYFIYIAFVCLFVLVCY--VVILLLCFDCIVFF 67

Query:   179 -----IIYFFFFFLYSFLFVDIF-FLSSFLSMSF--CLSIF 81
                  II+FF F  + F+F+ +F F+  FL   F  C+ IF
Sbjct:    68 LFTVIIIFFFLFIFWVFIFLLLFWFVFGFLFFFFYVCVLIF 108

 Score = 83 (29.2 bits), Expect = 0.052, P = 0.050
 Identities = 34/94 (36%), Positives = 48/94 (51%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFN-LSILSICF-NIL 186
             + ++FFFL     FI    FL+L   +F   LFF F    LI  YF  L +L   F   L
Sbjct:    71 VIIIFFFLFIFWVFI----FLLLFWFVFGF-LFFFFYVCVLI-FYFEFLFMLFFVFCGFL 124

Query:   185 LEIIYFFFFFLYSFLFVDIF------FLSSFLSMSFCLSI 84
             L +++  FF  +  L V +F      F+  F  M+FC+ I
Sbjct:   125 LFVMFILFFISFFVLIVLVFCWLLFIFVFRFFCMTFCILI 164

 Score = 80 (28.2 bits), Expect = 0.19, P = 0.17
 Identities = 30/93 (32%), Positives = 44/93 (47%), Frame = -3

Query:   359 IFVLF-FFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             +FVL  + +  LL F C+  FL     IF   LF  +  I L+  +F    L   F + +
Sbjct:    47 LFVLVCYVVILLLCFDCIVFFLFTVIIIFFF-LFIFWVFIFLLLFWFVFGFLFFFFYVCV 105

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIF 81
              I YF F F+  F+F    FL   + + F +S F
Sbjct:   106 LIFYFEFLFMLFFVFCG--FLLFVMFILFFISFF 137

 Score = 76 (26.8 bits), Expect = 0.88, P = 0.59
 Identities = 28/104 (26%), Positives = 51/104 (49%), Frame = -2

Query:   354 CSLFLSFIFIIIYLFI*LFNPPPWY-IFQITFFLFFINTINSHVF*FV-YIIYMLQYFVG 181
             C   + F F + Y    +F    ++ +F +   ++FI      +F  V Y++ +L  F  
Sbjct:     4 CKSVVVFGFFMYYFVCCIFYFCFFFCLFDLCVMVYFIYIAFVCLFVLVCYVVILLLCFDC 63

Query:   180 NNIFLF-LFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIII 46
                FLF + +IF  +   IF V +F+ +F F+  F+F   Y  ++I
Sbjct:    64 IVFFLFTVIIIFFFL--FIFWVFIFLLLFWFVFGFLFFFFYVCVLI 107

 Score = 74 (26.0 bits), Expect = 1.7, P = 0.82
 Identities = 25/114 (21%), Positives = 51/114 (44%), Frame = -3

Query:   353 VLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEII 174
             V+ +F+   ++F+CLF  L+    I    L  CF  I     +F  +++ I F + +  +
Sbjct:    35 VMVYFI--YIAFVCLF-VLVCYVVI----LLLCFDCI----VFFLFTVIIIFFFLFIFWV 83

Query:   173 YFF---FFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
             + F   F+F++ FLF   +         F   +F   C     +  ++     F+++
Sbjct:    84 FIFLLLFWFVFGFLFFFFYVCVLIFYFEFLFMLFFVFCGFLLFVMFILFFISFFVLI 140

 Score = 69 (24.3 bits), Expect = 9.1, P = 1.0
 Identities = 25/73 (34%), Positives = 40/73 (54%), Frame = -2

Query:   285 WYIFQITFFLFFINTINSHVF*-FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLF 109
             +++  I +F FF    +  V   F+YI ++   FV     + L L F  I   +F V++ 
Sbjct:    16 YFVCCIFYFCFFFCLFDLCVMVYFIYIAFVC-LFVLVCYVVILLLCFDCIVFFLFTVII- 73

Query:   108 VYVFLFIDF-FIFLL 67
             ++ FLFI + FIFLL
Sbjct:    74 IFFFLFIFWVFIFLL 88


>gi|340613 (L07545) A 'c' was inserted after nt 369 (=nt 10459 in genomic
           sequence (M10126)) to correct -1 frameshift probably due to gel
           compression [Leishmania tarentolae]
           Length = 355

  Minus Strand HSPs:

 Score = 119 (41.9 bits), Expect = 4.5e-06, P = 4.5e-06
 Identities = 34/116 (29%), Positives = 54/116 (46%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             +FVL FFL    SF+ +  F++   G+FS    +    I  I   +N      CF+I L 
Sbjct:    56 VFVLGFFLRIFFSFVFVLLFIVFF-GLFSLSFLYTGYFIYYIYILYNFICYFFCFSIALY 114

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSF-CLSIFSSSCCSTTILSSLIDVCGLFIMV 12
              I FF + L  F+F+D    S+ L   F  +++F+   CS         +C +F  +
Sbjct:   115 YIEFFTYLL-CFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCFI 170

 Score = 104 (36.6 bits), Expect = 0.00020, P = 0.00020
 Identities = 39/110 (35%), Positives = 56/110 (50%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             CS LF  F FII ++F  +F         I  FLFF     I+ +   +    YI ++L 
Sbjct:   152 CSYLFCLFYFIICFIFCFIFFVIRCLFVIIYDFLFFNFDIYISFLMCDIIYIDYICFLLI 211

Query:   192 YFVGNNIFLFL--FLIFLSIC*HIFLVLLFV----YVFLFIDF--FIFLL*Y 61
             YF    IF F+  F  F+ +  ++FLVL FV    + FLF+ +  F FL+ Y
Sbjct:   212 YF--GFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYY 261

 Score = 103 (36.3 bits), Expect = 0.00025, P = 0.00025
 Identities = 30/95 (31%), Positives = 49/95 (51%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFV--GNNI 172
             F  FIF++ Y+F+ LF     + F   F  + + T   + F ++YIIY    F+   + +
Sbjct:   223 FFCFIFVLNYVFLVLFFVLALF-FGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVV 281

Query:   171 FLFLFLIFLSIC*HIFLVLLFVYVFL--FIDFFIFL 70
               F FL F      +FL++LF+  F   F+  F+FL
Sbjct:   282 IFFKFLYFDVFFIFVFLLILFIICFFGFFLKDFLFL 317

 Score = 99 (34.8 bits), Expect = 0.00068, P = 0.00068
 Identities = 27/116 (23%), Positives = 59/116 (50%), Frame = -2

Query:   348 LFLSFIFIIIYL-FI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             +F SF+F+++++ F  LF+    Y     ++++ +     + F F   +Y +++F    +
Sbjct:    65 IFFSFVFVLLFIVFFGLFSLSFLYTGYFIYYIYILYNFICYFFCFSIALYYIEFFT--YL 122

Query:   171 FLFLFLIFLSIC*HIF----LVLLFVYVF---LF-IDFFIFLL*YNHIIITDRCMWSI 22
               F+F+ F+S   H+     ++ +F  +F   LF + +FI    +  I    RC++ I
Sbjct:   123 LCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCFIFFVIRCLFVI 180

 Score = 98 (34.5 bits), Expect = 0.00088, P = 0.00088
 Identities = 28/79 (35%), Positives = 43/79 (54%), Frame = -3

Query:   359 IFVLFFFLS-SLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI-CFNIL 186
             +F  F FLS  L +F+  + F +    I+S+  F    S+ +   +    +  I  F ++
Sbjct:   243 LFFGFLFLSYGLFTFLIYYFFWLYI--IYSRSCFILLQSVVIFFKFLYFDVFFIFVFLLI 300

Query:   185 LEIIYFFFFFLYSFLFVDIFF 123
             L II FF FFL  FLF++IFF
Sbjct:   301 LFIICFFGFFLKDFLFLNIFF 321

 Score = 92 (32.4 bits), Expect = 0.0039, P = 0.0039
 Identities = 35/118 (29%), Positives = 55/118 (46%), Frame = -3

Query:   359 IFVL-FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             IFVL + FL         F FL L  G+F+  L + F  + +I   ++ S    CF ILL
Sbjct:   227 IFVLNYVFLVLFFVLALFFGFLFLSYGLFTF-LIYYFFWLYII---YSRS----CF-ILL 277

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMVKI 6
             + +  FF FLY     D+FF+  FL + F +  F         L+   D+  + ++  +
Sbjct:   278 QSVVIFFKFLY----FDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDV 332

 Score = 87 (30.6 bits), Expect = 0.027, P = 0.027
 Identities = 25/109 (22%), Positives = 52/109 (47%), Frame = -2

Query:   348 LFLSFIFIIIYL-FI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             +F SF+F+++++ F  LF+    Y     ++++ +     + F F   +Y +++F    +
Sbjct:    65 IFFSFVFVLLFIVFFGLFSLSFLYTGYFIYYIYILYNFICYFFCFSIALYYIEFFT--YL 122

Query:   171 FLFLFLIFLSIC*HI----------------FLVLLFVYVFLFIDFFIFLL 67
               F+F+ F+S   H+                +L  LF ++  FI  FIF +
Sbjct:   123 LCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCFIFFV 173

 Score = 84 (29.6 bits), Expect = 0.14, P = 0.13
 Identities = 28/99 (28%), Positives = 46/99 (46%), Frame = -3

Query:   359 IFVL-FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             IFVL + FL         F FL L  G+F+  +++ F    +      + + S+   I  
Sbjct:   227 IFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVV--IFF 284

Query:   182 EIIYFFFFFLYSFLFVDI------FFLSSFLSMSFCLSIFS 78
             + +YF  FF++ FL +        FFL  FL ++    +FS
Sbjct:   285 KFLYFDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFS 325

 Score = 83 (29.2 bits), Expect = 0.26, P = 0.23
 Identities = 30/97 (30%), Positives = 52/97 (53%), Frame = -2

Query:   360 HICSL--FLSFIFIII---YLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYML 196
             +IC L  +  FIF  I   + FI + N    Y+F + FF+  +       F F+++ Y L
Sbjct:   205 YICFLLIYFGFIFSFITGFFCFIFVLN----YVFLVLFFVLAL------FFGFLFLSYGL 254

Query:   195 QYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFID-FFIFL 70
               F+    F +L++I+   C  +   ++  + FL+ D FFIF+
Sbjct:   255 FTFL-IYYFFWLYIIYSRSCFILLQSVVIFFKFLYFDVFFIFV 296

 Score = 80 (28.2 bits), Expect = 0.86, P = 0.58
 Identities = 35/113 (30%), Positives = 62/113 (54%), Frame = -2

Query:   357 ICSLFLSFI-F---IIIYL-FI*LFNPPPW-YIFQITFFLFFINTINSHVF*FVYIIYML 196
             +C +F+ FI F   +I Y   I +FN     Y+F +  F F I  I   +F  +  ++++
Sbjct:   123 LCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCL--FYFIICFIFCFIFFVIRCLFVI 180

Query:   195 QY---FVGNNIFL-FLF--LIFLS-IC*HIFLVLLFVYVFLFID-FFIFLL*YNHIII 46
              Y   F   +I++ FL   +I++  IC   FL++ F ++F FI  FF F+   N++ +
Sbjct:   181 IYDFLFFNFDIYISFLMCDIIYIDYIC---FLLIYFGFIFSFITGFFCFIFVLNYVFL 235

 Score = 78 (27.5 bits), Expect = 1.7, P = 0.81
 Identities = 36/126 (28%), Positives = 54/126 (42%), Frame = -3

Query:   356 FVLFFFLSSL-LSFICLFSFLILPPGI----FSK*LFFCFSSIRLIPTYFNLSILSICFN 192
             F+ +FF  S+ L +I  F++L+    I    FS  L   F  I +    F  S L   F 
Sbjct:   102 FICYFFCFSIALYYIEFFTYLLCFIFIDFISFSNHLISYFGIINMFNVIF-CSYLFCLFY 160

Query:   191 ILLEIIYFFFFFLYSFLFVDIF-FL----SSFLSMSFCLSIFSSSCCSTTILSSLID--V 33
              ++  I+ F FF+   LFV I+ FL      ++S   C  I+    C   I    I   +
Sbjct:   161 FIICFIFCFIFFVIRCLFVIIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFI 220

Query:    32 CGLFIMV 12
              G F  +
Sbjct:   221 TGFFCFI 227

 Score = 77 (27.1 bits), Expect = 2.5, P = 0.92
 Identities = 35/104 (33%), Positives = 53/104 (50%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             CS LF  F FII ++F  +F         I  FLFF     I+ +   +    YI ++L 
Sbjct:   152 CSYLFCLFYFIICFIFCFIFFVIRCLFVIIYDFLFFNFDIYISFLMCDIIYIDYICFLLI 211

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIIT 43
             YF G   F+F F+     C   F+ +L  YVFL + FF+  L +  + ++
Sbjct:   212 YF-G---FIFSFITGF-FC---FIFVLN-YVFLVL-FFVLALFFGFLFLS 251

 Score = 76 (26.8 bits), Expect = 3.4, P = 0.97
 Identities = 27/101 (26%), Positives = 50/101 (49%), Frame = -2

Query:   354 CSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYII-YMLQYFVGN 178
             CS     + +  Y FI L+    W+      + F  + +    F FV+++ + L+ F  +
Sbjct:    15 CSRVFDLLCVRSYDFI-LW----WFDLDFILYDFVFDFVVCITFIFVFVLGFFLRIFF-S 68

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHI 52
              +F+ LF++F  +       L F+Y   FI ++I++L YN I
Sbjct:    69 FVFVLLFIVFFGL-----FSLSFLYTGYFI-YYIYIL-YNFI 103

 Score = 74 (26.0 bits), Expect = 6.3, P = 1.0
 Identities = 28/93 (30%), Positives = 48/93 (51%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             +F LF+F+   + FI  F F ++   +F     F F +  +  ++    I+ I +   L 
Sbjct:   155 LFCLFYFI---ICFIFCFIFFVIRC-LFVIIYDFLFFNFDIYISFLMCDIIYIDYICFL- 209

Query:   179 IIYFFFFFLY-SFLFVDIFFLSS-FLSMSFCLSIF 81
             +IYF F F + +  F  IF L+  FL + F L++F
Sbjct:   210 LIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALF 244

 Score = 74 (26.0 bits), Expect = 6.7, P = 1.0
 Identities = 32/109 (29%), Positives = 52/109 (47%), Frame = -2

Query:   354 CSLF--LSFIFIIIYLFI*LFNPPPW---------YIFQITFFLFFINTINSHVF*FVYI 208
             C +F  +  +F+IIY F+  FN   +         YI  I F L +   I S +  F   
Sbjct:   168 CFIFFVIRCLFVIIYDFL-FFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCF 226

Query:   207 IYMLQY-FVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFF--IFLL 67
             I++L Y F+     L LF  FL +   +F  L++ + +L+I +    F+L
Sbjct:   227 IFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFIL 276

 Score = 74 (26.0 bits), Expect = 6.7, P = 1.0
 Identities = 37/120 (30%), Positives = 60/120 (50%), Frame = -2

Query:   348 LF-LSFIF---IIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIY------M 199
             LF LSF++    I Y++I L+N    Y F  +  L++I    +++  F++I +      +
Sbjct:    81 LFSLSFLYTGYFIYYIYI-LYNFI-CYFFCFSIALYYIEFF-TYLLCFIFIDFISFSNHL 137

Query:   198 LQYF----VGNNIFL-FLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITDRC 34
             + YF    + N IF  +LF +F  I   IF  + FV   LF+  + FL  +N  I     
Sbjct:   138 ISYFGIINMFNVIFCSYLFCLFYFIICFIFCFIFFVIRCLFVIIYDFLF-FNFDIYISFL 196

Query:    33 MWSI 22
             M  I
Sbjct:   197 MCDI 200


>gi|1947171 (AF000299) E03H12.5 gene product [Caenorhabditis elegans]
            Length = 210

  Plus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 2.2e-05, P = 2.2e-05
 Identities = 31/93 (33%), Positives = 52/93 (55%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++ED+K D++KD DKK++KK+    + E KK  KK     K  K  +  +K K    +  
Sbjct:   101 KKEDDKKDEKKDEDKKDEKKDADEKKDEEKKDDKKD--EKKDEKKDEKKEKSKKSKKSSK 158

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKK 345
              +K KKS  E     + K+ +K+ +D KD++K+
Sbjct:   159 SKKSKKSKREKKDEDK-KEDDKKEDDKKDDKKE 190

 Score = 89 (31.3 bits), Expect = 0.0032, P = 0.0032
 Identities = 31/100 (31%), Positives = 51/100 (51%), Frame = +1

Query:    46 DDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLK 225
             DD     + ED+K D++KD D+K+D++    ++K+ KK +KK     K  K   +    K
Sbjct:   104 DDKKDEKKDEDKK-DEKKDADEKKDEEKKD-DKKDEKKDEKKDEKKEKSKKSKKSSKSKK 161

Query:   226 YVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKK 345
                  R  EK+ +   E+      KK +K+ +D KD+ KK
Sbjct:   162 SKKSKR--EKKDEDKKEDDKKEDDKKDDKKEDDKKDDEKK 199

 Score = 88 (31.0 bits), Expect = 0.0041, P = 0.0041
 Identities = 27/91 (29%), Positives = 46/91 (50%), Frame = +1

Query:    76 DEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEK 255
             DEK D++K  DKK++KK+   + K+ K KK K    +K  K      K +     + D+K
Sbjct:   123 DEKKDEEKKDDKKDEKKDEKKDEKKEKSKKSKKSSKSKKSKKSKREKKDED---KKEDDK 179

Query:   256 QKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             ++    ++      K   K+ +D KD+ KK+
Sbjct:   180 KEDDKKDDKKEDDKKDDEKKDDDKKDDEKKE 210


>gnl|PID|e16326 (X15081) MURF2 protein (AA 1-348) [Crithidia fasciculata]
            Length = 347

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 6.9e-05, P = 6.9e-05
 Identities = 31/96 (32%), Positives = 55/96 (57%), Frame = -3

Query:   359 IFVLFFFLS-SLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPT--YFNLSILSICFNI 189
             +F  F FLS  L  F+C ++F +    I+++  +    S+ +     YFN+  + + F +
Sbjct:   235 LFFGFIFLSYGLALFLCCYTFWLFM--IYTRSCYVLLPSVLIFFKFLYFNVFFIFV-FLL 291

Query:   188 LLEIIYFFFFFLYSFLFVDIFF--LSSFLSMS-FCLSIF 81
             +L I+ FF FFL  FLF+++FF   +SF++    C + F
Sbjct:   292 ILFIVCFFGFFLKDFLFLNLFFDMFTSFINYDVLCYNGF 330

 Score = 99 (34.8 bits), Expect = 0.00066, P = 0.00066
 Identities = 32/97 (32%), Positives = 50/97 (51%), Frame = -2

Query:   348 LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*-FVYIIYMLQYFVGNNI 172
             L L F+  + + FI L      ++   TF+LF I T + +V    V I +   YF  N  
Sbjct:   227 LLLFFVLALFFGFIFLSYGLALFLCCYTFWLFMIYTRSCYVLLPSVLIFFKFLYF--NVF 284

Query:   171 FLFLFLIFLSI-C*HIFLVLLFVYVFLFIDFFIFLL*YN 58
             F+F+FL+ L I C   F +  F+++ LF D F   + Y+
Sbjct:   285 FIFVFLLILFIVCFFGFFLKDFLFLNLFFDMFTSFINYD 323

 Score = 93 (32.7 bits), Expect = 0.0029, P = 0.0029
 Identities = 35/99 (35%), Positives = 50/99 (50%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             CS LF  F FI+ +LF  +F         I  FLFF     I+ +   +    +I ++L 
Sbjct:   144 CSYLFCLFYFIVCFLFCFIFFVIRCLFVIIYDFLFFNFDLYISFLMCDLIYVDFICFLLL 203

Query:   192 YFVGNNIFLFL--FLIFLSIC*HIFLVLLFVYVFLFIDFFIFL 70
             YF    IF F+  F  F+ +  ++FL+L FV    F   FIFL
Sbjct:   204 YF--GFIFCFISGFFCFIFVLNYVFLLLFFVLALFF--GFIFL 242

 Score = 89 (31.3 bits), Expect = 0.0080, P = 0.0080
 Identities = 34/95 (35%), Positives = 44/95 (46%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             +FVL FFL    SF+ +  F++   G+FS  L F    I  I   +N      CF  L  
Sbjct:    46 VFVLGFFLRIFFSFVFVLLFIVFF-GLFSLALTFTGYYIYYIYILYNFICFFFCFG-LSY 103

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSS 75
             I+YF  FF Y   F  +FF   F+S       FSS
Sbjct:   104 ILYFIEFFTYVSFF--LFF--DFVS-------FSS 127

 Score = 87 (30.6 bits), Expect = 0.013, P = 0.013
 Identities = 25/91 (27%), Positives = 47/91 (51%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFN----I 189
             F+L+ F+   +  +C+    +   G F + +FF F  + L   +F L  L++ F      
Sbjct:    28 FILYDFVFDFV--VCITFIFVFVLGFFLR-IFFSFVFVLLFIVFFGLFSLALTFTGYYIY 84

Query:   188 LLEIIYFF--FFFLYSFLFVDIFFLSSFLSMSFCL 90
              + I+Y F  FFF +   ++ ++F+  F  +SF L
Sbjct:    85 YIYILYNFICFFFCFGLSYI-LYFIEFFTYVSFFL 118

 Score = 87 (30.6 bits), Expect = 0.026, P = 0.026
 Identities = 34/96 (35%), Positives = 55/96 (57%), Frame = -2

Query:   357 ICSLFLSFIFIIIYL-----FI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQ 193
             IC L L F FI  ++     FI + N    Y+F + FF+  +       F F+++ Y L 
Sbjct:   198 ICFLLLYFGFIFCFISGFFCFIFVLN----YVFLLLFFVLAL------FFGFIFLSYGLA 247

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFL--VLLFVYVFLFID-FFIFL 70
              F+    F +LF+I+   C ++ L  VL+F + FL+ + FFIF+
Sbjct:   248 LFLCCYTF-WLFMIYTRSC-YVLLPSVLIF-FKFLYFNVFFIFV 288

 Score = 82 (28.9 bits), Expect = 0.37, P = 0.31
 Identities = 28/95 (29%), Positives = 47/95 (49%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C  F+ F+F++ + F+ +F    + +  I FF  F   +    + ++Y IY+L  F+  
Sbjct:    39 VCITFI-FVFVLGF-FLRIFFSFVFVLLFIVFFGLFSLALTFTGY-YIYYIYILYNFI-- 93

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYV--FLFIDFFIF 73
                 F F   LS    ++ +  F YV  FLF DF  F
Sbjct:    94 ---CFFFCFGLSYI--LYFIEFFTYVSFFLFFDFVSF 125

 Score = 78 (27.5 bits), Expect = 1.6, P = 0.80
 Identities = 31/114 (27%), Positives = 47/114 (41%), Frame = -3

Query:   359 IFVL-FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             IFVL + FL         F F+ L  G+    LF C  +  L   Y        C+ +L 
Sbjct:   219 IFVLNYVFLLLFFVLALFFGFIFLSYGLA---LFLCCYTFWLFMIYTRS-----CYVLLP 270

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFI 18
              ++ FF      FL+ ++FF+  FL + F +  F         L+   D+   FI
Sbjct:   271 SVLIFF-----KFLYFNVFFIFVFLLILFIVCFFGFFLKDFLFLNLFFDMFTSFI 320

 Score = 78 (27.5 bits), Expect = 1.8, P = 0.83
 Identities = 27/101 (26%), Positives = 49/101 (48%), Frame = -2

Query:   348 LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIF 169
             +F S++F + Y  +          F   F  F I  +   ++ F++  + L  ++    F
Sbjct:   142 IFCSYLFCLFYFIV---------CFLFCFIFFVIRCLFVIIYDFLFFNFDL--YIS---F 187

Query:   168 LFLFLIFLS-IC*HIFLVLLFVYVFLFID-FFIFLL*YNHIII 46
             L   LI++  IC   FL+L F ++F FI  FF F+   N++ +
Sbjct:   188 LMCDLIYVDFIC---FLLLYFGFIFCFISGFFCFIFVLNYVFL 227

 Score = 77 (27.1 bits), Expect = 2.4, P = 0.91
 Identities = 34/105 (32%), Positives = 54/105 (51%), Frame = -2

Query:   351 SLFLSFI-FIIIYLFI*LFNPPPWYI-FQITFFLFFIN--TINSHVF*FVYIIYM--LQY 190
             SL L+F  + I Y++I L+N   ++  F +++ L+FI   T  S    F ++ +   L  
Sbjct:    73 SLALTFTGYYIYYIYI-LYNFICFFFCFGLSYILYFIEFFTYVSFFLFFDFVSFSSHLTT 131

Query:   189 FVG--NN---IFL-FLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFL 70
             F G  NN   IF  +LF +F  I   +F  + FV   LF+  + FL
Sbjct:   132 FFGLTNNFSVIFCSYLFCLFYFIVCFLFCFIFFVIRCLFVIIYDFL 177

 Score = 73 (25.7 bits), Expect = 9.2, P = 1.0
 Identities = 35/112 (31%), Positives = 54/112 (48%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQ--ITFF----LFFINTINSHVF*FVYIIYML 196
             IC  F   +  I+Y FI  F    +++F   ++F      FF  T N  V  F   ++ L
Sbjct:    93 ICFFFCFGLSYILY-FIEFFTYVSFFLFFDFVSFSSHLTTFFGLTNNFSVI-FCSYLFCL 150

Query:   195 QYFVGNNIFLFLFLIF--LSIC*HIFLVLLF-VYV-FL-----FIDFFIFLL*Y 61
              YF+   +F F+F +   L +  + FL   F +Y+ FL     ++DF  FLL Y
Sbjct:   151 FYFIVCFLFCFIFFVIRCLFVIIYDFLFFNFDLYISFLMCDLIYVDFICFLLLY 204


>pir||C30010 hypothetical ORF-6 protein - Sauroleishmania tarentolae
            mitochondrion (SGC6)
            Length = 245

  Minus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 9.5e-05, P = 9.5e-05
 Identities = 39/110 (35%), Positives = 56/110 (50%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             CS LF  F FII ++F  +F         I  FLFF     I+ +   +    YI ++L 
Sbjct:    42 CSYLFCLFYFIICFIFCFIFFVIRCLFVIIYDFLFFNFDIYISFLMCDIIYIDYICFLLI 101

Query:   192 YFVGNNIFLFL--FLIFLSIC*HIFLVLLFV----YVFLFIDF--FIFLL*Y 61
             YF    IF F+  F  F+ +  ++FLVL FV    + FLF+ +  F FL+ Y
Sbjct:   102 YF--GFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYY 151

 Score = 103 (36.3 bits), Expect = 0.00012, P = 0.00012
 Identities = 30/95 (31%), Positives = 49/95 (51%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFV--GNNI 172
             F  FIF++ Y+F+ LF     + F   F  + + T   + F ++YIIY    F+   + +
Sbjct:   113 FFCFIFVLNYVFLVLFFVLALF-FGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVV 171

Query:   171 FLFLFLIFLSIC*HIFLVLLFVYVFL--FIDFFIFL 70
               F FL F      +FL++LF+  F   F+  F+FL
Sbjct:   172 IFFKFLYFDVFFIFVFLLILFIICFFGFFLKDFLFL 207

 Score = 98 (34.5 bits), Expect = 0.00044, P = 0.00044
 Identities = 28/79 (35%), Positives = 43/79 (54%), Frame = -3

Query:   359 IFVLFFFLS-SLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI-CFNIL 186
             +F  F FLS  L +F+  + F +    I+S+  F    S+ +   +    +  I  F ++
Sbjct:   133 LFFGFLFLSYGLFTFLIYYFFWLYI--IYSRSCFILLQSVVIFFKFLYFDVFFIFVFLLI 190

Query:   185 LEIIYFFFFFLYSFLFVDIFF 123
             L II FF FFL  FLF++IFF
Sbjct:   191 LFIICFFGFFLKDFLFLNIFF 211

 Score = 92 (32.4 bits), Expect = 0.0020, P = 0.0020
 Identities = 35/118 (29%), Positives = 55/118 (46%), Frame = -3

Query:   359 IFVL-FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             IFVL + FL         F FL L  G+F+  L + F  + +I   ++ S    CF ILL
Sbjct:   117 IFVLNYVFLVLFFVLALFFGFLFLSYGLFTF-LIYYFFWLYII---YSRS----CF-ILL 167

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMVKI 6
             + +  FF FLY     D+FF+  FL + F +  F         L+   D+  + ++  +
Sbjct:   168 QSVVIFFKFLY----FDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDV 222

 Score = 84 (29.6 bits), Expect = 0.079, P = 0.076
 Identities = 28/99 (28%), Positives = 46/99 (46%), Frame = -3

Query:   359 IFVL-FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             IFVL + FL         F FL L  G+F+  +++ F    +      + + S+   I  
Sbjct:   117 IFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVV--IFF 174

Query:   182 EIIYFFFFFLYSFLFVDI------FFLSSFLSMSFCLSIFS 78
             + +YF  FF++ FL +        FFL  FL ++    +FS
Sbjct:   175 KFLYFDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFS 215

 Score = 83 (29.2 bits), Expect = 0.14, P = 0.13
 Identities = 30/97 (30%), Positives = 52/97 (53%), Frame = -2

Query:   360 HICSL--FLSFIFIII---YLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYML 196
             +IC L  +  FIF  I   + FI + N    Y+F + FF+  +       F F+++ Y L
Sbjct:    95 YICFLLIYFGFIFSFITGFFCFIFVLN----YVFLVLFFVLAL------FFGFLFLSYGL 144

Query:   195 QYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFID-FFIFL 70
               F+    F +L++I+   C  +   ++  + FL+ D FFIF+
Sbjct:   145 FTFL-IYYFFWLYIIYSRSCFILLQSVVIFFKFLYFDVFFIFV 186

 Score = 80 (28.2 bits), Expect = 0.48, P = 0.38
 Identities = 35/113 (30%), Positives = 62/113 (54%), Frame = -2

Query:   357 ICSLFLSFI-F---IIIYL-FI*LFNPPPW-YIFQITFFLFFINTINSHVF*FVYIIYML 196
             +C +F+ FI F   +I Y   I +FN     Y+F +  F F I  I   +F  +  ++++
Sbjct:    13 LCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCL--FYFIICFIFCFIFFVIRCLFVI 70

Query:   195 QY---FVGNNIFL-FLF--LIFLS-IC*HIFLVLLFVYVFLFID-FFIFLL*YNHIII 46
              Y   F   +I++ FL   +I++  IC   FL++ F ++F FI  FF F+   N++ +
Sbjct:    71 IYDFLFFNFDIYISFLMCDIIYIDYIC---FLLIYFGFIFSFITGFFCFIFVLNYVFL 125

 Score = 77 (27.1 bits), Expect = 1.4, P = 0.75
 Identities = 35/104 (33%), Positives = 53/104 (50%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             CS LF  F FII ++F  +F         I  FLFF     I+ +   +    YI ++L 
Sbjct:    42 CSYLFCLFYFIICFIFCFIFFVIRCLFVIIYDFLFFNFDIYISFLMCDIIYIDYICFLLI 101

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIIT 43
             YF G   F+F F+     C   F+ +L  YVFL + FF+  L +  + ++
Sbjct:   102 YF-G---FIFSFITGF-FC---FIFVLN-YVFLVL-FFVLALFFGFLFLS 141

 Score = 74 (26.0 bits), Expect = 3.6, P = 0.97
 Identities = 28/93 (30%), Positives = 48/93 (51%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             +F LF+F+   + FI  F F ++   +F     F F +  +  ++    I+ I +   L 
Sbjct:    45 LFCLFYFI---ICFIFCFIFFVIRC-LFVIIYDFLFFNFDIYISFLMCDIIYIDYICFL- 99

Query:   179 IIYFFFFFLY-SFLFVDIFFLSS-FLSMSFCLSIF 81
             +IYF F F + +  F  IF L+  FL + F L++F
Sbjct:   100 LIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALF 134

 Score = 74 (26.0 bits), Expect = 3.8, P = 0.98
 Identities = 32/109 (29%), Positives = 52/109 (47%), Frame = -2

Query:   354 CSLF--LSFIFIIIYLFI*LFNPPPW---------YIFQITFFLFFINTINSHVF*FVYI 208
             C +F  +  +F+IIY F+  FN   +         YI  I F L +   I S +  F   
Sbjct:    58 CFIFFVIRCLFVIIYDFL-FFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCF 116

Query:   207 IYMLQY-FVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFF--IFLL 67
             I++L Y F+     L LF  FL +   +F  L++ + +L+I +    F+L
Sbjct:   117 IFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFIL 166

 Score = 72 (25.3 bits), Expect = 6.9, P = 1.0
 Identities = 30/119 (25%), Positives = 50/119 (42%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             F+   F+S     I  F  + +   IF   LF  F  I      F   ++   F I+ + 
Sbjct:    15 FIFIDFISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCFIFFVIRCLFVIIYDF 74

Query:   176 IYFFFFFLYSFLFVDIFFLS--SFLSM--SFCLSIFSSSCCSTTILSSLIDVCGLFIMVK 9
             ++F F    SFL  DI ++    FL +   F  S  +   C   +L+ +  V  LF ++ 
Sbjct:    75 LFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFIFVLNYVFLV--LFFVLA 132

Query:     8 I 6
             +
Sbjct:   133 L 133


>gi|1825739 (U88309) T23B3.5 gene product [Caenorhabditis elegans]
            Length = 211

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.00011, P = 0.00011
 Identities = 32/94 (34%), Positives = 52/94 (55%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++ED+K D++KD DKK++KK+    + E KK  KK    ++  K  +  D+ K       
Sbjct:   101 KKEDDKKDEKKDEDKKDEKKDADEKKDEEKKDDKK----DE--KKDEKKDEKK------- 147

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             DEK++KS  ++    + KK  K   + KDE KK+
Sbjct:   148 DEKKEKSK-KSKKSSKSKKSKKSKREKKDEEKKE 180

 Score = 99 (34.8 bits), Expect = 0.00024, P = 0.00024
 Identities = 33/94 (35%), Positives = 52/94 (55%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKIL-KHIDNIDKLKYVGIN- 240
             ++E++K +++KD DKKED K     + E KK +KK     K   K  D  D+ K    + 
Sbjct:    87 KEEEKKDEEKKDGDKKEDDKK-DEKKDEDKKDEKKDADEKKDEEKKDDKKDEKKDEKKDE 145

Query:   241 RIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             + DEK++KS  ++    + KK  K   + KDE KK+
Sbjct:   146 KKDEKKEKSK-KSKKSSKSKKSKKSKREKKDEEKKE 180

 Score = 91 (32.0 bits), Expect = 0.0019, P = 0.0019
 Identities = 28/93 (30%), Positives = 49/93 (52%), Frame = +1

Query:    70 QEDEK--IDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINR 243
             ++DEK   D++KD +KK+DKK+   + K+ +KK +K   S K  K   +    K     +
Sbjct:   115 KKDEKKDADEKKDEEKKDDKKDEKKDEKKDEKKDEKKEKSKKSKKSSKSKKSKKSKREKK 174

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQINDNKDERK 342
              +EK++    E+      K+  K+ +D KD+ K
Sbjct:   175 DEEKKEDDKKEDDKKDDKKEDEKKDDDKKDDEK 207

 Score = 74 (26.0 bits), Expect = 2.9, P = 0.94
 Identities = 30/95 (31%), Positives = 50/95 (52%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++E++K +++KD DKKED K     +K+  KK +K     K  K  +  D  K       
Sbjct:    87 KEEEKKDEEKKDGDKKEDDKK--DEKKDEDKKDEKKDADEK--KDEEKKDDKK------- 135

Query:   247 DEK--QKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             DEK  +KK   ++    + KK +K+ + +K  +K KR
Sbjct:   136 DEKKDEKKDEKKDEKKEKSKK-SKKSSKSKKSKKSKR 171


>pir||A05235 hypothetical protein A-288 - Trypanosoma brucei mitochondrion
            (SGC6)
            Length = 288

  Minus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.00013, P = 0.00013
 Identities = 35/106 (33%), Positives = 57/106 (53%), Frame = -2

Query:   357 ICSLFLSFI-FIIIYLFI*LFNPPPWYI-FQITFFLFFINT---INSHVF*FVYIIYMLQ 193
             ICSL + F  + I Y++I L+N   ++  F I F +++I     I  H+F F +I +   
Sbjct:    12 ICSLTMLFTGYYIYYIYI-LYNFICFFFAFGINFLIYYIEFFIFITFHIF-FDFISFS-N 68

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITD 40
             Y    N F  L++  +  C ++F +  FV  FLF  F  F++    I+I D
Sbjct:    69 YIY--NYFGILYMFNVMFCAYLFCLFYFVIYFLFC-FIFFVIRCLFIVIMD 116

 Score = 94 (33.1 bits), Expect = 0.0017, P = 0.0017
 Identities = 28/93 (30%), Positives = 45/93 (48%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQ-YFVGNNIF 169
             F SF+ I+  LF+ LF     + F  TF ++ I  I  +   ++Y+IY    Y +   I 
Sbjct:   156 FFSFVIILGLLFLLLFLVINLF-FGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAIL 214

Query:   168 LFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             +F   I+  +    F V +F+ +   I FF F L
Sbjct:   215 IFFKFIYFDV----FFVFVFILILFIISFFSFFL 244

 Score = 91 (32.0 bits), Expect = 0.0036, P = 0.0036
 Identities = 34/110 (30%), Positives = 53/110 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFS----SIRLIPTYFNLSILSI----CF 195
             +F F+    SF+ +   L L   +    LFF F+     I++I  Y+   +  I    C+
Sbjct:   149 IFNFIYGFFSFVIILGLLFLLLFLVIN-LFFGFTFLVYGIQIILLYYVYWLYMIYSRSCY 207

Query:   194 NILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCG 27
              IL+  I  FF F+Y     D+FF+  F+ + F +S FS        LS   D+ G
Sbjct:   208 -ILMPAILIFFKFIY----FDVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFG 258

 Score = 88 (31.0 bits), Expect = 0.0076, P = 0.0076
 Identities = 33/107 (30%), Positives = 52/107 (48%), Frame = -3

Query:   347 FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI----CFNILLE 180
             FF    +L  + L  FL++   +F    F  +  I++I  Y+   +  I    C+ IL+ 
Sbjct:   156 FFSFVIILGLLFLLLFLVI--NLFFGFTFLVYG-IQIILLYYVYWLYMIYSRSCY-ILMP 211

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCG 27
              I  FF F+Y   F D+FF+  F+ + F +S FS        LS   D+ G
Sbjct:   212 AILIFFKFIY---F-DVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFG 258

 Score = 86 (30.3 bits), Expect = 0.038, P = 0.037
 Identities = 26/93 (27%), Positives = 48/93 (51%), Frame = -2

Query:   348 LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIF 169
             L+ +FIF  IY F          I  + F L F+  IN   F F +++Y +Q  +   ++
Sbjct:   144 LYFNFIFNFIYGFFSFV-----IILGLLFLLLFL-VINLF-FGFTFLVYGIQIILLYYVY 196

Query:   168 LFLFLIFLSIC*HIFLVLLFVYVFLFID-FFIFL 70
              +L++I+   C  +   +L  + F++ D FF+F+
Sbjct:   197 -WLYMIYSRSCYILMPAILIFFKFIYFDVFFVFV 229

 Score = 86 (30.3 bits), Expect = 0.038, P = 0.037
 Identities = 37/113 (32%), Positives = 55/113 (48%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             C+ LF  F F+I +LF  +F         I  FLFF     ++ +   +    +I  +L 
Sbjct:    85 CAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLL 144

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFI---FLL*YNHIIITDRCMW 28
             YF  N IF F++  F  +   I L LLF+ +FL I+ F    FL+    II+     W
Sbjct:   145 YF--NFIFNFIYGFFSFV---IILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYW 197

 Score = 81 (28.5 bits), Expect = 0.40, P = 0.33
 Identities = 29/90 (32%), Positives = 46/90 (51%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIP-TYFN-LSILSICFNILL 183
             FV++F L   + F+    F+++   +F    F  F SI L    Y + +S+L + FN + 
Sbjct:    94 FVIYF-LFCFIFFVIRCLFIVIMDFLFFN--FDIFVSILLCDIVYLDFISLLLLYFNFIF 150

Query:   182 EIIYFFF--------FFLYSFLFVDIFFLSSFL 108
               IY FF         FL  FL +++FF  +FL
Sbjct:   151 NFIYGFFSFVIILGLLFLLLFLVINLFFGFTFL 183

 Score = 80 (28.2 bits), Expect = 0.57, P = 0.44
 Identities = 30/113 (26%), Positives = 55/113 (48%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI-CFNILL 183
             +F  F FL   +  I L+    L   I+S+  +    +I +   +    +  +  F ++L
Sbjct:   176 LFFGFTFLVYGIQIILLYYVYWLYM-IYSRSCYILMPAILIFFKFIYFDVFFVFVFILIL 234

Query:   182 EIIYFFFFFLYSFLFVDIFF-----LSSFLSMSFCLSIFSSS-CCSTTILSSLI 39
              II FF FFL  FLF+ ++F     L ++  +S+ +  + ++  C T +LS  I
Sbjct:   235 FIISFFSFFLKDFLFLSLYFDIFGSLYNYDILSYSIFYYQNNQFCLTQLLSIYI 288

 Score = 78 (27.5 bits), Expect = 1.3, P = 0.73
 Identities = 36/118 (30%), Positives = 58/118 (49%), Frame = -1

Query:   361 SYLFSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFVFHQYD*FPRILIC-LYYL-YASIF 188
             +YLF   +F +Y+ LF ++ F    L  F     F+F  +D F  IL+C + YL + S+ 
Sbjct:    86 AYLFCLFYFVIYF-LFCFIFFVIRCL--FIVIMDFLFFNFDIFVSILLCDIVYLDFISLL 142

Query:   187 CWK*YISFSFSYI-PFYLLTYFSCPPFCLCLFVYRFFH---LLV----VVQPYYHH*SMY 32
                 Y +F F++I  F+         F L   V   F     LV    ++  YY +  +Y
Sbjct:   143 LL--YFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVY-WLY 199

Query:    31 VVYS 20
             ++YS
Sbjct:   200 MIYS 203

 Score = 76 (26.8 bits), Expect = 2.5, P = 0.92
 Identities = 22/96 (22%), Positives = 46/96 (47%), Frame = -1

Query:   352 FSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFV-FHQYD*FPRILICLYYLYASIFCWK* 176
             + +  + LY  +  + AF  + L+Y+   F F+ FH +  F      +Y  +  ++ +  
Sbjct:    23 YIYYIYILYNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMFN- 81

Query:   175 YISF-SFSYIPFYLLTYFSCPPFCLCLFVYRFFHLLVV 65
              + F ++ +  FY + YF    FC   FV R   ++++
Sbjct:    82 -VMFCAYLFCLFYFVIYFL---FCFIFFVIRCLFIVIM 115

 Score = 74 (26.0 bits), Expect = 4.6, P = 0.99
 Identities = 27/101 (26%), Positives = 42/101 (41%), Frame = -3

Query:   356 FVLFFFLSSLLSFICL---FSFLILPPGIFSK*LFFCFSSIRLIPT--YFNLSILSICFN 192
             FV+   L  LL F+ +   F F  L  GI    L++ +    +     Y  +  + I F 
Sbjct:   159 FVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFK 218

Query:   191 ILLEIIYFFFFFLYSFLFVDIF--FLSSFLSMSFCLSIFSS 75
              +   ++F F F+     +  F  FL  FL +S    IF S
Sbjct:   219 FIYFDVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFGS 259

 Score = 73 (25.7 bits), Expect = 7.0, P = 1.0
 Identities = 32/104 (30%), Positives = 54/104 (51%), Frame = -2

Query:   360 HICSLFLSF------IFIIIYLFI*LFNPPPWYIFQITFF-LFFINTINSHVF*FVYIIY 202
             HI   F+SF       F I+Y+F  +F     Y+F + +F ++F+      V   ++I+ 
Sbjct:    58 HIFFDFISFSNYIYNYFGILYMFNVMFCA---YLFCLFYFVIYFLFCFIFFVIRCLFIVI 114

Query:   201 MLQYFVGNNIFLFLFLIFLSIC*HIFLVLL-FVYVFLFI-DFFIFLL 67
             M   F   +IF+ + L  +     I L+LL F ++F FI  FF F++
Sbjct:   115 MDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVI 161

 Score = 72 (25.3 bits), Expect = 9.0, P = 1.0
 Identities = 27/92 (29%), Positives = 47/92 (51%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIP-TYFN-LSILSICFNILL 183
             FV++F L   + F+    F+++   +F    F  F SI L    Y + +S+L + FN + 
Sbjct:    94 FVIYF-LFCFIFFVIRCLFIVIMDFLFFN--FDIFVSILLCDIVYLDFISLLLLYFNFIF 150

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIF 81
               IY FF F+   + + + FL  FL     +++F
Sbjct:   151 NFIYGFFSFV---IILGLLFLLLFL----VINLF 177


>sp|P15577|NU2M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 2 >pir||S07734 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - Paramecium
            tetraurelia mitochondrion (SGC6) >gi|515876 (X15917) ND2 protein
            (AA 1-193) (unusual start codon) [Paramecium aurelia] >gi|1019630
            (M26930) NADH dehydrogenase subunit 2 [Paramecium aurelia]
            Length = 193

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.00014, P = 0.00014
 Identities = 32/89 (35%), Positives = 46/89 (51%), Frame = -3

Query:   353 VLFFFLSSLLSFICLF----SFLILPPGIFSK*LFFCFSSIRLIPTYFNLSIL-SICFNI 189
             +L FFL  L+ F   F    +F+++  G     LFF  S+++        S+L S  F I
Sbjct:    98 LLGFFLKFLIFFFLFFKTNLAFILIFLGFNMATLFFYLSTVKSFVNRKQASVLNSFNFFI 157

Query:   188 LLEIIYFFFF-FLYSFLFVDIFFL-SSFL 108
               E+ + +FF F Y FLF   FFL S+FL
Sbjct:   158 RAELSFLYFFNFFYFFLFFAFFFLDSTFL 186


>pir||JS0233 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - Paramecium
            tetraurelia mitochondrion (SGC6)
            Length = 193

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.00014, P = 0.00014
 Identities = 32/89 (35%), Positives = 46/89 (51%), Frame = -3

Query:   353 VLFFFLSSLLSFICLF----SFLILPPGIFSK*LFFCFSSIRLIPTYFNLSIL-SICFNI 189
             +L FFL  L+ F   F    +F+++  G     LFF  S+++        S+L S  F I
Sbjct:    98 LLGFFLKFLIFFFLFFKTNLAFILIFLGFNMATLFFYLSTVKSFVNRKQASVLNSFNFFI 157

Query:   188 LLEIIYFFFF-FLYSFLFVDIFFL-SSFL 108
               E+ + +FF F Y FLF   FFL S+FL
Sbjct:   158 RAELSFLYFFNFFYFFLFFAFFFLDSTFL 186


>pir||B26696 hypothetical protein 1 (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6) (fragment)
            >gi|896286 (M10126) NH2 terminus uncertain [Leishmania tarentolae]
            Length = 443

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.00021, P = 0.00021
 Identities = 34/113 (30%), Positives = 55/113 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIP-TYFNLSILS--ICFNILLE 180
             LF +L  ++ F+ L+SF+IL    ++   +  F  I LI      L+IL   ICF  LL 
Sbjct:     3 LFLYLIHIILFLLLYSFIILCD--YTSLFYLSFDLIWLIIINIIILTILDSYICFIFLL- 59

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
             +  F FFFL+ FL  D  F+   + M + +            +S L ++  L + +
Sbjct:    60 LFLFCFFFLFCFLNFDTRFVFMIIIMQYIIIFMFLHVIHILFISILFELFSLLLFL 115

 Score = 91 (32.0 bits), Expect = 0.0070, P = 0.0069
 Identities = 32/104 (30%), Positives = 54/104 (51%), Frame = -2

Query:   360 HICSLFLS-FIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFV 184
             +IC +FL  F+F   +LF  L N    ++F I    + I  +  HV   ++I  + + F 
Sbjct:    52 YICFIFLLLFLFCFFFLFCFL-NFDTRFVFMIIIMQYIIIFMFLHVIHILFISILFELF- 109

Query:   183 GNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFI-FLL*YNHII 49
               ++ LFL LI  S   +  L+L + Y+   I+F + F+L Y  I+
Sbjct:   110 --SLLLFLILIS-SRFGYKILILWYYYMINLINFILLFVLLYYMIL 152

 Score = 85 (29.9 bits), Expect = 0.12, P = 0.12
 Identities = 34/103 (33%), Positives = 59/103 (57%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLF-FINTINSHVF*FVYIIYMLQYFVG 181
             I   ++ FIF++++LF           F   FFLF F+N  ++    FV++I ++QY + 
Sbjct:    48 ILDSYICFIFLLLFLFC----------F---FFLFCFLN-FDTR---FVFMIIIMQYII- 89

Query:   180 NNIFLFLFLI---FLSIC*HIFLVLLF-VYVFLFIDFFIFLL*YNHII 49
               IF+FL +I   F+SI   +F +LLF + +     + I +L Y ++I
Sbjct:    90 --IFMFLHVIHILFISILFELFSLLLFLILISSRFGYKILILWYYYMI 135

 Score = 84 (29.6 bits), Expect = 0.24, P = 0.21
 Identities = 30/103 (29%), Positives = 51/103 (49%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYI-IYMLQYFVG 181
             I  + L + FI+  +F   +N   +++    FF FF N + S +   +++ I  +    G
Sbjct:   298 IILIILYYFFIVYNMFDIKYNEN-YFLINFIFFSFFNNLLISIMIACIFLCIGSIPIVFG 356

Query:   180 N--NIF-LFLFLIFLSIC*HIFLV--LLFVYVFLF---IDFFIF 73
                 +F L L L +L IC   F +  L+ +Y+F F   I+ FIF
Sbjct:   357 FFLKVFCLLLHLSYLGICIVFFSIIWLIIIYIFYFRLIINIFIF 400

 Score = 83 (29.2 bits), Expect = 0.30, P = 0.26
 Identities = 29/82 (35%), Positives = 42/82 (51%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIY 171
             LF +L  ++ F+ L+SF+IL    ++   +  F  I LI    N+ IL+I  +      Y
Sbjct:     3 LFLYLIHIILFLLLYSFIILCD--YTSLFYLSFDLIWLI--IINIIILTILDS------Y 52

Query:   170 FFFFFLYSFLFVDIFFLSSFLS 105
               F FL  FLF   FFL  FL+
Sbjct:    53 ICFIFLLLFLFC-FFFLFCFLN 73

 Score = 83 (29.2 bits), Expect = 0.30, P = 0.26
 Identities = 31/114 (27%), Positives = 53/114 (46%), Frame = -3

Query:   338 LSSLLSFICLFSFLILPPGIFSK*LFFCFSSIR--LIPTYFNLSILSICFNILLEIIYFF 165
             L  L SF  +    +L    FS  LF  F S +  +   Y N  ++     I+L I+Y+F
Sbjct:   248 LIGLNSFAIVSLLFVLSVNNFSF-LFLIFISTKNYIFYMYLNFHLIYSLSLIILIILYYF 306

Query:   164 F--FFLYSFLFVDIFFLSSFLSMSFCLSIFSSS--CCSTTILSSLIDVCGLFIMV 12
             F  + ++   + + +FL +F+  SF  ++  S    C    + S+  V G F+ V
Sbjct:   307 FIVYNMFDIKYNENYFLINFIFFSFFNNLLISIMIACIFLCIGSIPIVFGFFLKV 361

 Score = 83 (29.2 bits), Expect = 0.35, P = 0.30
 Identities = 34/97 (35%), Positives = 52/97 (53%), Frame = -2

Query:   360 HICSLFLSFIFII--IYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYF 187
             HI  LF+S +F +  + LF+ L +    Y   I ++ + IN IN     F+ +  +L Y 
Sbjct:    98 HI--LFISILFELFSLLLFLILISSRFGYKILILWYYYMINLIN-----FILLFVLLYYM 150

Query:   186 VGNNIFL---FLFLIF----LSI-C*HIFLVLLF-VYVFLFIDF 82
             + N  F    F FLIF    L I C    L++LF +Y+ + I F
Sbjct:   151 ILNYCFYLCDFCFLIFDEEWLGILCLFYILLILFKLYIAILILF 194

 Score = 82 (28.9 bits), Expect = 0.52, P = 0.40
 Identities = 28/105 (26%), Positives = 49/105 (46%), Frame = -2

Query:   360 HICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*F-VYIIYMLQYFV 184
             ++ + ++ F FI+I L I        Y + I   L  I +I   +     + I  L + +
Sbjct:   209 YMLTFYVLFCFILIILLICFI-----YFYIIFIKLIIIQSITCVLIGLNSFAIVSLLFVL 263

Query:   183 GNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIII 46
               N F FLFLIF+S   +IF + L  ++   +   I ++ Y   I+
Sbjct:   264 SVNNFSFLFLIFISTKNYIFYMYLNFHLIYSLSLIILIILYYFFIV 309

 Score = 78 (27.5 bits), Expect = 2.3, P = 0.90
 Identities = 35/117 (29%), Positives = 58/117 (49%), Frame = -3

Query:   356 FVLFFFLSSLLSFI---CLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC---F 195
             F+ F F ++LL  I   C+F  +   P +F    FF    +++     +LS L IC   F
Sbjct:   326 FIFFSFFNNLLISIMIACIFLCIGSIPIVFG---FF----LKVFCLLLHLSYLGICIVFF 378

Query:   194 NIL-LEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSS--CCSTTILSSLIDVCGL 24
             +I+ L IIY F+F L   +F+  +    F  +   +  FS+     S +I     D+  L
Sbjct:   379 SIIWLIIIYIFYFRLIINIFIFSYQFIGFWVVRLHILGFSNLFFILSFSIFILFFDIINL 438

Query:    23 FIMV 12
             F ++
Sbjct:   439 FDLI 442

 Score = 77 (27.1 bits), Expect = 3.4, P = 0.97
 Identities = 28/91 (30%), Positives = 50/91 (54%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWY--IFQITFFLFFINTINSHVF*FV--YIIYM-LQYF 187
             SLFL  I II++L +  F     Y  +F ++F L ++  IN  +   +  YI ++ L  F
Sbjct:     2 SLFLYLIHIILFLLLYSFIILCDYTSLFYLSFDLIWLIIINIIILTILDSYICFIFLLLF 61

Query:   186 VGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFI 88
             +    FLF FL F +    +F++++  Y+ +F+
Sbjct:    62 LFCFFFLFCFLNFDTR--FVFMIIIMQYIIIFM 92

 Score = 76 (26.8 bits), Expect = 4.3, P = 0.99
 Identities = 33/100 (33%), Positives = 48/100 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIP-TYFNLSILS--ICFNILLE 180
             LF +L  ++ F+ L+SF+IL    ++   +  F  I LI      L+IL   ICF  LL 
Sbjct:     3 LFLYLIHIILFLLLYSFIILCD--YTSLFYLSFDLIWLIIINIIILTILDSYICFIFLL- 59

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSFC-----------LSI 84
             +  F FFFL+ FL  D  F+   + M +            L I
Sbjct:    60 LFLFCFFFLFCFLNFDTRFVFMIIIMQYIIIFMFLHVIHILFI 102

 Score = 76 (26.8 bits), Expect = 4.6, P = 0.99
 Identities = 16/64 (25%), Positives = 40/64 (62%), Frame = -2

Query:   258 LFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLI--FLSIC*HIFLVLLFVYVFLFID 85
             LF+I  I   ++  + I+++ Q ++   +F+F++++  ++  C  I ++LL  +++ +I 
Sbjct:   176 LFYILLILFKLYIAILILFLEQLYIRLGVFIFIYMLTFYVLFC-FILIILLICFIYFYI- 233

Query:    84 FFIFLL 67
              FI L+
Sbjct:   234 IFIKLI 239

 Score = 74 (26.0 bits), Expect = 8.5, P = 1.0
 Identities = 34/102 (33%), Positives = 55/102 (53%), Frame = -3

Query:   356 FVLFFFLSSLLSFI---CLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC---F 195
             F+ F F ++LL  I   C+F  +   P +F    FF    +++     +LS L IC   F
Sbjct:   326 FIFFSFFNNLLISIMIACIFLCIGSIPIVFG---FF----LKVFCLLLHLSYLGICIVFF 378

Query:   194 NIL-LEIIYFFFF------FLYSFLFVDIFFLS----SFLSMSFCLSIFS 78
             +I+ L IIY F+F      F++S+ F+  + +      F ++ F LS FS
Sbjct:   379 SIIWLIIIYIFYFRLIINIFIFSYQFIGFWVVRLHILGFSNLFFILS-FS 427


>sp|P15605|YM04_PARTE HYPOTHETICAL 18.8 KD PROTEIN (ORF4) >pir||S07729
            hypothetical protein 4 - Paramecium tetraurelia mitochondrion
            (SGC6) >gi|13261 (X15917) ORF4 protein (AA 1-156) [Paramecium
            aurelia]
            Length = 156

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.00035, P = 0.00035
 Identities = 33/110 (30%), Positives = 51/110 (46%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             SLF +F FI     +     PP++ F+I  +      +   V  F  + +   Y  G   
Sbjct:    40 SLFFTF-FIFFLAAVFKLGLPPFFFFKIEVY----KGLPLFVTFFYSVFFFFNYLSG--- 91

Query:   171 FLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*-YNHIIITDRCMWSI 22
             F FLF +F +     F  LLF +V +F+ FF F L  Y+++     C +SI
Sbjct:    92 FFFLFFVFFTSFFVYFSYLLFFFVPVFVLFFFFYLTTYDNL----NCFFSI 138

 Score = 74 (26.0 bits), Expect = 1.4, P = 0.74
 Identities = 29/96 (30%), Positives = 52/96 (54%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             +FV FF+  S+  F   F++L    G F   LFF F +   +  YF+     + F  +  
Sbjct:    74 LFVTFFY--SVFFF---FNYL---SGFFF--LFFVFFTSFFV--YFSY----LLFFFVPV 117

Query:   179 IIYFFFFFLYSFLFVDIFF-LSSFLSMSFCLSIFSSS 72
              + FFFF+L ++  ++ FF +SS ++ +F + + +SS
Sbjct:   118 FVLFFFFYLTTYDNLNCFFSISSVINSTFLVYLLASS 154


>pir||F22845 hypothetical protein 6 - Trypanosoma brucei mitochondrion (SGC6)
            Length = 347

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.00040, P = 0.00040
 Identities = 35/106 (33%), Positives = 57/106 (53%), Frame = -2

Query:   357 ICSLFLSFI-FIIIYLFI*LFNPPPWYI-FQITFFLFFINT---INSHVF*FVYIIYMLQ 193
             ICSL + F  + I Y++I L+N   ++  F I F +++I     I  H+F F +I +   
Sbjct:    71 ICSLTMLFTGYYIYYIYI-LYNFICFFFAFGINFLIYYIEFFIFITFHIF-FDFISFS-N 127

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITD 40
             Y    N F  L++  +  C ++F +  FV  FLF  F  F++    I+I D
Sbjct:   128 YIY--NYFGILYMENVMFCAYLFCLFYFVIYFLFC-FIFFVIRCLFIVIMD 175

 Score = 94 (33.1 bits), Expect = 0.0023, P = 0.0023
 Identities = 28/93 (30%), Positives = 45/93 (48%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQ-YFVGNNIF 169
             F SF+ I+  LF+ LF     + F  TF ++ I  I  +   ++Y+IY    Y +   I 
Sbjct:   215 FFSFVIILGLLFLLLFLVINLF-FGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAIL 273

Query:   168 LFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             +F   I+  +    F V +F+ +   I FF F L
Sbjct:   274 IFFKFIYFDV----FFVFVFILILFIISFFSFFL 303

 Score = 91 (32.0 bits), Expect = 0.0049, P = 0.0048
 Identities = 34/110 (30%), Positives = 53/110 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFS----SIRLIPTYFNLSILSI----CF 195
             +F F+    SF+ +   L L   +    LFF F+     I++I  Y+   +  I    C+
Sbjct:   208 IFNFIYGFFSFVIILGLLFLLLFLVIN-LFFGFTFLVYGIQIILLYYVYWLYMIYSRSCY 266

Query:   194 NILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCG 27
              IL+  I  FF F+Y     D+FF+  F+ + F +S FS        LS   D+ G
Sbjct:   267 -ILMPAILIFFKFIY----FDVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFG 317

 Score = 88 (31.0 bits), Expect = 0.010, P = 0.010
 Identities = 25/89 (28%), Positives = 48/89 (53%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFN----I 189
             F+L+ F+   +  +C+    I   G F + +FF F  + L  T+F +  L++ F      
Sbjct:    28 FILYDFVFDFV--VCITFIFIFVLGFFIR-IFFSFVFVLLFITFFGICSLTMLFTGYYIY 84

Query:   188 LLEIIYFF--FFFLYSFLFVDIFFLSSFLSMSF 96
              + I+Y F  FFF +   F+ I+++  F+ ++F
Sbjct:    85 YIYILYNFICFFFAFGINFL-IYYIEFFIFITF 116

 Score = 88 (31.0 bits), Expect = 0.010, P = 0.010
 Identities = 33/107 (30%), Positives = 52/107 (48%), Frame = -3

Query:   347 FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI----CFNILLE 180
             FF    +L  + L  FL++   +F    F  +  I++I  Y+   +  I    C+ IL+ 
Sbjct:   215 FFSFVIILGLLFLLLFLVI--NLFFGFTFLVYG-IQIILLYYVYWLYMIYSRSCY-ILMP 270

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCG 27
              I  FF F+Y   F D+FF+  F+ + F +S FS        LS   D+ G
Sbjct:   271 AILIFFKFIY---F-DVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFG 317

 Score = 86 (30.3 bits), Expect = 0.051, P = 0.050
 Identities = 26/93 (27%), Positives = 48/93 (51%), Frame = -2

Query:   348 LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIF 169
             L+ +FIF  IY F          I  + F L F+  IN   F F +++Y +Q  +   ++
Sbjct:   203 LYFNFIFNFIYGFFSFV-----IILGLLFLLLFL-VINLF-FGFTFLVYGIQIILLYYVY 255

Query:   168 LFLFLIFLSIC*HIFLVLLFVYVFLFID-FFIFL 70
              +L++I+   C  +   +L  + F++ D FF+F+
Sbjct:   256 -WLYMIYSRSCYILMPAILIFFKFIYFDVFFVFV 288

 Score = 86 (30.3 bits), Expect = 0.051, P = 0.050
 Identities = 33/110 (30%), Positives = 54/110 (49%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C  F+ FIF++ + FI +F    + +  ITFF     T+    + ++Y IY+L  F+  
Sbjct:    39 VCITFI-FIFVLGF-FIRIFFSFVFVLLFITFFGICSLTMLFTGY-YIYYIYILYNFI-- 93

Query:   177 NIFLFLFLI-FLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITDRCMW 28
               F F F I FL      F+ + F   F FI F  ++  Y  I+  +  M+
Sbjct:    94 -CFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMENVMF 143

 Score = 86 (30.3 bits), Expect = 0.051, P = 0.050
 Identities = 37/113 (32%), Positives = 55/113 (48%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             C+ LF  F F+I +LF  +F         I  FLFF     ++ +   +    +I  +L 
Sbjct:   144 CAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLL 203

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFI---FLL*YNHIIITDRCMW 28
             YF  N IF F++  F  +   I L LLF+ +FL I+ F    FL+    II+     W
Sbjct:   204 YF--NFIFNFIYGFFSFV---IILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYW 256

 Score = 81 (28.5 bits), Expect = 0.53, P = 0.41
 Identities = 26/84 (30%), Positives = 37/84 (44%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             IFVL FF+    SF+ +  F+    GI S  + F    I  I   +N       F I   
Sbjct:    46 IFVLGFFIRIFFSFVFVLLFITFF-GICSLTMLFTGYYIYYIYILYNFICFFFAFGINFL 104

Query:   179 IIYFFFFFLYSF-LFVDIFFLSSFL 108
             I Y  FF   +F +F D    S+++
Sbjct:   105 IYYIEFFIFITFHIFFDFISFSNYI 129

 Score = 81 (28.5 bits), Expect = 0.53, P = 0.41
 Identities = 29/90 (32%), Positives = 46/90 (51%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIP-TYFN-LSILSICFNILL 183
             FV++F L   + F+    F+++   +F    F  F SI L    Y + +S+L + FN + 
Sbjct:   153 FVIYF-LFCFIFFVIRCLFIVIMDFLFFN--FDIFVSILLCDIVYLDFISLLLLYFNFIF 209

Query:   182 EIIYFFF--------FFLYSFLFVDIFFLSSFL 108
               IY FF         FL  FL +++FF  +FL
Sbjct:   210 NFIYGFFSFVIILGLLFLLLFLVINLFFGFTFL 242

 Score = 80 (28.2 bits), Expect = 0.76, P = 0.53
 Identities = 30/113 (26%), Positives = 55/113 (48%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI-CFNILL 183
             +F  F FL   +  I L+    L   I+S+  +    +I +   +    +  +  F ++L
Sbjct:   235 LFFGFTFLVYGIQIILLYYVYWLYM-IYSRSCYILMPAILIFFKFIYFDVFFVFVFILIL 293

Query:   182 EIIYFFFFFLYSFLFVDIFF-----LSSFLSMSFCLSIFSSS-CCSTTILSSLI 39
              II FF FFL  FLF+ ++F     L ++  +S+ +  + ++  C T +LS  I
Sbjct:   294 FIISFFSFFLKDFLFLSLYFDIFGSLYNYDILSYSIFYYQNNQFCLTQLLSIYI 347

 Score = 78 (27.5 bits), Expect = 1.8, P = 0.83
 Identities = 25/96 (26%), Positives = 45/96 (46%), Frame = -1

Query:   352 FSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFV-FHQYD*FPRILICLY-YLYASIFCWK 179
             + +  + LY  +  + AF  + L+Y+   F F+ FH +  F  I    Y Y Y  I   +
Sbjct:    82 YIYYIYILYNFICFFFAFGINFLIYYIEFFIFITFHIF--FDFISFSNYIYNYFGILYME 139

Query:   178 *YISFSFSYIPFYLLTYFSCPPFCLCLFVYRFFHLLVV 65
               +  ++ +  FY + YF    FC   FV R   ++++
Sbjct:   140 NVMFCAYLFCLFYFVIYFL---FCFIFFVIRCLFIVIM 174

 Score = 78 (27.5 bits), Expect = 1.8, P = 0.83
 Identities = 36/118 (30%), Positives = 58/118 (49%), Frame = -1

Query:   361 SYLFSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFVFHQYD*FPRILIC-LYYL-YASIF 188
             +YLF   +F +Y+ LF ++ F    L  F     F+F  +D F  IL+C + YL + S+ 
Sbjct:   145 AYLFCLFYFVIYF-LFCFIFFVIRCL--FIVIMDFLFFNFDIFVSILLCDIVYLDFISLL 201

Query:   187 CWK*YISFSFSYI-PFYLLTYFSCPPFCLCLFVYRFFH---LLV----VVQPYYHH*SMY 32
                 Y +F F++I  F+         F L   V   F     LV    ++  YY +  +Y
Sbjct:   202 LL--YFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVY-WLY 258

Query:    31 VVYS 20
             ++YS
Sbjct:   259 MIYS 262

 Score = 76 (26.8 bits), Expect = 3.3, P = 0.96
 Identities = 28/99 (28%), Positives = 57/99 (57%), Frame = -2

Query:   348 LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLF-FI-NTINSHVF*FVYII-YMLQYFVGN 178
             L+LS +F +  L I  ++   W+ F + F L+ F+ + +    F F++++ + ++ F  +
Sbjct:     3 LWLSRVFDL--LCIRTYDFILWW-FDLDFILYDFVFDFVVCITFIFIFVLGFFIRIFF-S 58

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHI 52
              +F+ LF+ F  IC    L +LF   +++   +I++L YN I
Sbjct:    59 FVFVLLFITFFGIC---SLTMLFTGYYIY---YIYIL-YNFI 93

 Score = 74 (26.0 bits), Expect = 6.1, P = 1.0
 Identities = 27/101 (26%), Positives = 42/101 (41%), Frame = -3

Query:   356 FVLFFFLSSLLSFICL---FSFLILPPGIFSK*LFFCFSSIRLIPT--YFNLSILSICFN 192
             FV+   L  LL F+ +   F F  L  GI    L++ +    +     Y  +  + I F 
Sbjct:   218 FVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFK 277

Query:   191 ILLEIIYFFFFFLYSFLFVDIF--FLSSFLSMSFCLSIFSS 75
              +   ++F F F+     +  F  FL  FL +S    IF S
Sbjct:   278 FIYFDVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFGS 318


>sp|P36079|YKI3_YEAST HYPOTHETICAL 23.7 KD PROTEIN IN MDH1-VMA5 INTERGENIC
            REGION >pir||S37908 hypothetical protein YKL083w - yeast
            (Saccharomyces cerevisiae) >gi|486120 (Z28082) ORF YKL083w
            [Saccharomyces cerevisiae]
            Length = 204

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.084, P = 0.080
 Identities = 36/106 (33%), Positives = 49/106 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             + LF F S L  F+ L SFLIL    FS  L FC S I    T    S+ SI     L  
Sbjct:    63 YFLFIF-SCLFLFLPLLSFLILR---FSS-LLFCLSDIVSSTTLLR-SLHSIAD--FLFC 114

Query:   176 IYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSC-CSTTILSSLI 39
               F F  L S     +  + S  +++FC   FS    CS++  +S++
Sbjct:   115 ASFLFIALRSSFSSSLILIPSACNIAFCHFSFSFCLICSSSSFASIL 161

 Score = 81 (28.5 bits), Expect = 0.00057, Sum P(2) = 0.00057
 Identities = 27/77 (35%), Positives = 37/77 (48%), Frame = -3

Query:   224 FNL-SILSICFNILLEIIYFFFFFLYSFLFVDI--FFLSSFLSMSFCLSIFSSSCCSTTI 54
             FNL S  ++ F   L   YF F F   FLF+ +  F +  F S+ FCLS   SS      
Sbjct:    46 FNLPSNPALFFGTALPT-YFLFIFSCLFLFLPLLSFLILRFSSLLFCLSDIVSSTTLLRS 104

Query:    53 LSSLIDV--CGLFIMVKI 6
             L S+ D   C  F+ + +
Sbjct:   105 LHSIADFLFCASFLFIAL 122

 Score = 74 (26.0 bits), Expect = 2.7, P = 0.93
 Identities = 17/80 (21%), Positives = 39/80 (48%), Frame = -2

Query:   285 WYIFQ-ITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLF------LIFLSIC*HI 127
             WYI++ I  +++    ++++++ +    Y   Y++G   FL +F       +F       
Sbjct:     3 WYIYRYIYIYMYLYIYVHTYIYIYYCCYYYRDYYLGPPFFLPVFNLPSNPALFFGTALPT 62

Query:   126 FLVLLFVYVFLFIDFFIFLL 67
             + + +F  +FLF+    FL+
Sbjct:    63 YFLFIFSCLFLFLPLLSFLI 82

 Score = 48 (16.9 bits), Expect = 0.00057, Sum P(2) = 0.00057
 Identities = 4/20 (20%), Positives = 14/20 (70%), Frame = -1

Query:   358 YLFSFSFFHLYYHLFVYLAF 299
             Y++ + + ++Y H ++Y+ +
Sbjct:     8 YIYIYMYLYIYVHTYIYIYY 27

 Score = 38 (13.4 bits), Expect = 0.0059, Sum P(2) = 0.0059
 Identities = 3/17 (17%), Positives = 13/17 (76%), Frame = -1

Query:   358 YLFSFSFFHLYYHLFVY 308
             Y++ + + ++Y +++V+
Sbjct:     4 YIYRYIYIYMYLYIYVH 20

 Score = 36 (12.7 bits), Expect = 0.0094, Sum P(2) = 0.0093
 Identities = 3/16 (18%), Positives = 12/16 (75%), Frame = -1

Query:   352 FSFSFFHLYYHLFVYL 305
             + + + ++Y +L++Y+
Sbjct:     4 YIYRYIYIYMYLYIYV 19


>pir||A56657 PfEMP2/MESA protein (clone 9025/15) - Plasmodium falciparum
            (fragment) >bbs|122453 (S52457) PfEMP2, MESA, PP330=large antigenic
            protein {repeating structure} [Plasmodium falciparum, Malayan Camp
            isolate, Peptide Partial, 126 aa] [Plasmodium falciparum]
            Length = 126

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.00093, P = 0.00093
 Identities = 26/88 (29%), Positives = 49/88 (55%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E E++ +++++ +KE+ K   T  K+ + +++K     K +K  D  +K K +G   I 
Sbjct:     7 KEKEEVKEKEEVKEKEEVKEKDTESKDKEIEQEKEKEEVKEVKEKDTENKDKVIGQEIII 66

Query:   250 EKQKKSYLENIPGGRIKKLNKQINDNKD 333
             E+ KK   +     R+KK N + N+NKD
Sbjct:    67 EEIKKEVKK-----RVKKRNNK-NENKD 88


>gi|1022918 (U38184) ATPase subunit 6 [Trypanosoma cruzi]
            Length = 233

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.0011, P = 0.0011
 Identities = 37/104 (35%), Positives = 52/104 (50%), Frame = -3

Query:   350 LFFFLSSLLSFI--CLFSFL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSIL-SICFNILL 183
             L F L  L SFI  CLF  L  +   ++S  L++C        TY NL +L  I F   +
Sbjct:    42 LLFCLFDLYSFIGLCLFLLLWFMLFNLYSLILYYCI-------TYLNLYLLFCIVFLYYM 94

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSF-----C-LSIFSSSC-CSTTIL 51
               ++ F F L  FLF ++    +F+ + F     C L  FS  C C +T L
Sbjct:    95 SFLFLFCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSLLCRCLSTFL 145

 Score = 85 (29.9 bits), Expect = 0.033, P = 0.033
 Identities = 34/113 (30%), Positives = 51/113 (45%), Frame = -3

Query:   350 LFFFLSSLLSFI--CLFSFL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L SFI  CLF  L  +   ++S  L++C + + L   +  + +  + F  L  
Sbjct:    42 LLFCLFDLYSFIGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLYYMSFLFLFC 101

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSCCST------TILSS 45
              +  FF F   L    F+D+FF+   L    C S+    C ST       +LSS
Sbjct:   102 FLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSLLCR-CLSTFLRLFCNLLSS 154

 Score = 83 (29.2 bits), Expect = 0.13, P = 0.12
 Identities = 22/68 (32%), Positives = 35/68 (51%), Frame = -2

Query:   267 TFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFL-FLIFLSIC*HIFLVLLFVYVFLF 91
             TF   F N ++SH    ++  ++  +FV    F FL FL+F+     +F   L  Y FL+
Sbjct:   143 TFLRLFCNLLSSHFLLLMFFDFLYFFFVFFIFFCFLDFLVFILFI-FVFCFCLLFYGFLY 201

Query:    90 I-DFFIFLL 67
             + D F  +L
Sbjct:   202 LLDLFAAIL 210

 Score = 82 (28.9 bits), Expect = 0.17, P = 0.15
 Identities = 31/92 (33%), Positives = 45/92 (48%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             F+  FF+  LL F+  FS L      F +   FC     L+ ++F   +L + F+ L   
Sbjct:   118 FMDVFFIRFLLCFLECFSLLCRCLSTFLR--LFC----NLLSSHF---LLLMFFDFL--- 165

Query:   176 IYFFFFFLYSFLFVD--IFFLSSFLSMSFCLSIF 81
              YFFF F   F F+D  +F L  F+   FCL  +
Sbjct:   166 -YFFFVFFIFFCFLDFLVFILFIFV-FCFCLLFY 197

 Score = 76 (26.8 bits), Expect = 1.7, P = 0.83
 Identities = 29/94 (30%), Positives = 47/94 (50%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSH---VF*FVYIIYMLQYFV- 184
             +L+L F  + +Y    LF     + F + FFLF    +  +   VF   +++  L+ F  
Sbjct:    81 NLYLLFCIVFLYYMSFLF----LFCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSL 136

Query:   183 ---GNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIF 73
                  + FL LF   LS   H  L++ F +++ F  FFIF
Sbjct:   137 LCRCLSTFLRLFCNLLSS--HFLLLMFFDFLYFFFVFFIF 174

 Score = 75 (26.4 bits), Expect = 2.4, P = 0.91
 Identities = 28/86 (32%), Positives = 42/86 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIY 171
             L++ + S L F+  F+ L+L   IF   LF  F     I     L +  + FN+   I+Y
Sbjct:    18 LYYCVWSRLCFVVYFNCLLL---IFDFLLFCLFDLYSFIGLCLFLLLWFMLFNLYSLILY 74

Query:   170 FFFFFLYSFLFVDIFFL--SSFLSMSFC 93
             +   +L  +L   I FL   SFL + FC
Sbjct:    75 YCITYLNLYLLFCIVFLYYMSFLFL-FC 101

 Score = 75 (26.4 bits), Expect = 2.4, P = 0.91
 Identities = 35/114 (30%), Positives = 52/114 (45%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFC--FSSIRLIPTYFN------LSILSI 201
             F+  FF+  LL F+  FS L      F +   FC   SS  L+  +F+      +  +  
Sbjct:   118 FMDVFFIRFLLCFLECFSLLCRCLSTFLR--LFCNLLSSHFLLLMFFDFLYFFFVFFIFF 175

Query:   200 CFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLF 21
             CF   L  I F F F +  LF    +L    +    L IF    C+  IL  ++D   LF
Sbjct:   176 CFLDFLVFILFIFVFCFCLLFYGFLYLLDLFAAILQLFIF----CNM-ILQLIMDFL-LF 229

Query:    20 IM 15
             ++
Sbjct:   230 LL 231


>gi|436923 (U01849) ORF1 [Trypanosoma brucei]
           Length = 146

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.0012, P = 0.0012
 Identities = 26/100 (26%), Positives = 54/100 (54%), Frame = -2

Query:   354 CSLFLSFIFI-IIYLFI*LFNPPPWYI-----FQITFFLFFINTINSHVF*FVYIIYMLQ 193
             C LFL F+ + + YLF   ++   +++     F + F+L+ +  +  + F + + ++   
Sbjct:    12 CFLFLLFVCVGMFYLFC--YSCLFFFVVLGCDFLLVFWLYSLFFLWRYNFVYFFFLFCFV 69

Query:   192 YFVGNNIF-LFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFL 70
             +FV   +F LF F ++  +C  +F  L F+  F+   FF+F+
Sbjct:    70 FFVLLFLFGLFGFFLYFLLCFVLFFDLFFMLFFVLGGFFVFV 111

 Score = 86 (30.3 bits), Expect = 0.0043, P = 0.0043
 Identities = 28/87 (32%), Positives = 40/87 (45%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             FV FFFL   + F+ LF F     G+F   L+F    +     +F L  +   F      
Sbjct:    59 FVYFFFLFCFVFFVLLFLF-----GLFGFFLYFLLCFVLFFDLFFMLFFVLGGF-----F 108

Query:   176 IYFFFFFLYSFLFVDIFFLSSFLSMSF 96
             ++ FFF L  FLFV +  L  +L + F
Sbjct:   109 VFVFFFCLCLFLFVVVVILLVWLLLLF 135

 Score = 86 (30.3 bits), Expect = 0.0043, P = 0.0043
 Identities = 32/104 (30%), Positives = 48/104 (46%), Frame = -3

Query:   359 IFVLFFFLSS--LLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFN-- 192
             +F+LF  +    L  + CLF F++L  G     +F+ +S   L    F       CF   
Sbjct:    14 LFLLFVCVGMFYLFCYSCLFFFVVL--GCDFLLVFWLYSLFFLWRYNFVYFFFLFCFVFF 71

Query:   191 ILLEIIYFFFFFLYSFL----FVDIFFLSSFLSMSFCLSIFSSSCC 66
             +LL +   F FFLY  L    F D+FF+  F+   F + +F    C
Sbjct:    72 VLLFLFGLFGFFLYFLLCFVLFFDLFFMLFFVLGGFFVFVFFFCLC 117

 Score = 80 (28.2 bits), Expect = 0.13, P = 0.12
 Identities = 27/88 (30%), Positives = 48/88 (54%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQIT-FFLFFINTINSHVF*FVYIIYMLQ-YFVGNNI 172
             F+ F F+  ++F  L      ++F +  FFL+F+         F  + ++L  +FV    
Sbjct:    59 FVYFFFLFCFVFFVLL-----FLFGLFGFFLYFLLCFVLFFDLFFMLFFVLGGFFVFVFF 113

Query:   171 F-LFLFLIFLSIC*HIFLVLLFVYVFLFIDF 82
             F L LFL  + +   ++L+LLFVY F+++ F
Sbjct:   114 FCLCLFLFVVVVILLVWLLLLFVYRFIYMRF 144

 Score = 79 (27.8 bits), Expect = 0.19, P = 0.17
 Identities = 28/94 (29%), Positives = 47/94 (50%), Frame = -1

Query:   346 FSFFHLYYHLFVYLAF*SSPLVYFPNNFFFVFHQYD*FPRILICLYYLYASIFCWK*YIS 167
             +S F L+ + FVY  F     V+F     F+F  +  F   L+C + L+  +F    ++ 
Sbjct:    49 YSLFFLWRYNFVYFFFLFC-FVFFV--LLFLFGLFGFFLYFLLC-FVLFFDLF----FML 100

Query:   166 FSFSYIPFYLLTYFSCPPFCLCLFVYRFFHLLVV 65
             F F    F++  +F    FCLCLF++    +L+V
Sbjct:   101 F-FVLGGFFVFVFF----FCLCLFLFVVVVILLV 129

 Score = 69 (24.3 bits), Expect = 6.3, P = 1.0
 Identities = 28/95 (29%), Positives = 49/95 (51%), Frame = -2

Query:   354 CSLFLSFIFI-IIYLFI*LFNPPPWYI-----FQITFFLFFINTINSHVF*FVYIIYMLQ 193
             C LFL F+ + + YLF   ++   +++     F + F+L+ +  +  + F + + ++   
Sbjct:    12 CFLFLLFVCVGMFYLFC--YSCLFFFVVLGCDFLLVFWLYSLFFLWRYNFVYFFFLFCFV 69

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFL 70
             +FV     LFLF +F       FL  L  +V LF D F  L
Sbjct:    70 FFV----LLFLFGLF-----GFFLYFLLCFV-LFFDLFFML 100


>pir||E22845 hypothetical protein 4 - Trypanosoma brucei mitochondrion (SGC6)
            Length = 445

  Minus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.0012, P = 0.0012
 Identities = 38/102 (37%), Positives = 61/102 (59%), Frame = -2

Query:   351 SLFLS----FIFIIIYLFI*L--FNPPPWYIFQITFFL---FFINTINSHVF*FVYIIYM 199
             SLFL     FIF+IIY FI L  +       F + + L   F+I  ++S++  F++I+  
Sbjct:     5 SLFLYIIHIFIFLIIYSFIILCDYTTLTLLSFDLLWLLINLFWITLLDSYIC-FIFILLF 63

Query:   198 LQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIII 46
             L  F    +F F FL F +    +F++++  Y+ +F+  FIF+   NHIII
Sbjct:    64 LFCFT---LF-FCFLSFDTR--FLFIIIIIQYIIIFL--FIFI---NHIII 103

 Score = 90 (31.7 bits), Expect = 0.0090, P = 0.0089
 Identities = 43/116 (37%), Positives = 60/116 (51%), Frame = -3

Query:   359 IFVLFF--FLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC---- 198
             IF  FF  FL SLL   CLF  +   P +F    FF    I++      LS L IC    
Sbjct:   329 IFFSFFNNFLISLL-LACLFLCIGAIPIVFG---FF----IKVFCLLLQLSYLCICIGFF 380

Query:   197 FNILLEIIYFFFF------FLYSFLFVDIFFLS-SFLSMSFCLSIFSSSCCSTTILSSLI 39
             F I L IIY F+F      F++S+ F+  + +  SF+++   L      C S  IL    
Sbjct:   381 FIIWLIIIYIFYFRLIVNIFIFSYQFLGFWVVKLSFINIKNLLFFI---CSSVYIL--FF 435

Query:    38 DVCGLFIMV 12
             D+  LF ++
Sbjct:   436 DIINLFDLI 444

 Score = 88 (31.0 bits), Expect = 0.015, P = 0.015
 Identities = 33/105 (31%), Positives = 53/105 (50%), Frame = -2

Query:   360 HICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINT---INSHVF*FVYIIYMLQY 190
             ++ + ++ F FI+I L I       +YI  I   LF   T   I  + F  V ++++L  
Sbjct:   211 YMLTFYILFCFILIILLISFIY---FYILFIKLLLFQSCTCVLIGLNSFAIVSLLFVLSV 267

Query:   189 FVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIII 46
                NN F FLFLIF+S   +IF + L  ++   I   + ++ Y   II
Sbjct:   268 ---NN-FCFLFLIFISTKNYIFYLYLNFHLIYSISLVLLIIIYYFFII 311

 Score = 87 (30.6 bits), Expect = 0.019, P = 0.019
 Identities = 43/116 (37%), Positives = 59/116 (50%), Frame = -3

Query:   359 IFVLFF--FLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC---- 198
             IF  FF  FL SLL   CLF  +   P +F    FF    I++      LS L IC    
Sbjct:   329 IFFSFFNNFLISLL-LACLFLCIGAIPIVFG---FF----IKVFCLLLQLSYLCICIGFF 380

Query:   197 FNILLEIIYFFFFFLYSFLFVDIF-FLSSFL-SMSFC--LSIFSSSCCSTTILSSLIDVC 30
             F I L IIY F+F L   +F+  + FL  ++  +SF    ++    C S  IL    D+ 
Sbjct:   381 FIIWLIIIYIFYFRLIVNIFIFSYQFLGFWVVKLSFINIKNLLFFICSSVYIL--FFDII 438

Query:    29 GLFIMV 12
              LF ++
Sbjct:   439 NLFDLI 444

 Score = 85 (29.9 bits), Expect = 0.093, P = 0.089
 Identities = 29/84 (34%), Positives = 44/84 (52%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             + +  F+++ L S+IC F F++L   +F   LFFCF S     T F   I+ I + I+  
Sbjct:    41 LLINLFWITLLDSYIC-FIFILL--FLFCFTLFFCFLSF---DTRFLFIIIIIQYIIIFL 94

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFL 108
              I+     + S LF +IF L  FL
Sbjct:    95 FIFINHIIIISILF-EIFSLLLFL 117

 Score = 84 (29.6 bits), Expect = 0.20, P = 0.18
 Identities = 32/114 (28%), Positives = 51/114 (44%), Frame = -3

Query:   338 LSSLLSFICLFSFLILPPGIFSK*LFFCFSSIR--LIPTYFNLSILSICFNILLEIIYFF 165
             L  L SF  +    +L    F   LF  F S +  +   Y N  ++     +LL IIY+F
Sbjct:   250 LIGLNSFAIVSLLFVLSVNNFCF-LFLIFISTKNYIFYLYLNFHLIYSISLVLLIIIYYF 308

Query:   164 FFF--LYSFLFVDIFFLSSFLSMSFCLSIFSSS--CCSTTILSSLIDVCGLFIMV 12
             F    ++ F + + +FL +F+  SF  +   S    C    + ++  V G FI V
Sbjct:   309 FIIYNIFDFKYNENYFLINFIFFSFFNNFLISLLLACLFLCIGAIPIVFGFFIKV 363

 Score = 83 (29.2 bits), Expect = 0.36, P = 0.30
 Identities = 33/97 (34%), Positives = 54/97 (55%), Frame = -2

Query:   348 LFLSFI-FIIIYLFI*LFNPPPWYIFQITFF----LFFINTINSHVF*FVYIIYMLQYFV 184
             L +SFI F I+++ + LF      +  +  F    L F+ ++N+  F F+++I++     
Sbjct:   226 LLISFIYFYILFIKLLLFQSCTCVLIGLNSFAIVSLLFVLSVNN--FCFLFLIFIS---T 280

Query:   183 GNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YN 58
              N IF +L+L F  I   I LVLL +  + FI + IF   YN
Sbjct:   281 KNYIF-YLYLNFHLIY-SISLVLLIIIYYFFIIYNIFDFKYN 320

 Score = 81 (28.5 bits), Expect = 0.84, P = 0.57
 Identities = 30/92 (32%), Positives = 53/92 (57%), Frame = -2

Query:   324 IIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFL--- 154
             I ++FI LF      +F  T F  F++  ++    F++II ++QY +   IFLF+F+   
Sbjct:    55 ICFIFILLF------LFCFTLFFCFLS-FDTR---FLFIIIIIQYII---IFLFIFINHI 101

Query:   153 IFLSIC*HIFLVLLFVYVFLF-IDFFIFLL*YNHII 49
             I +SI   IF +LLF+ +      + I +L Y +++
Sbjct:   102 IIISILFEIFSLLLFLLLMSSRFGYKILVLWYYYML 137

 Score = 81 (28.5 bits), Expect = 0.84, P = 0.57
 Identities = 29/101 (28%), Positives = 51/101 (50%), Frame = -2

Query:   348 LFLSFIFIIIY-LFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYI-IYMLQYFVGNN 175
             L + + F IIY +F   +N   +++    FF FF N + S +   +++ I  +    G  
Sbjct:   302 LIIIYYFFIIYNIFDFKYNEN-YFLINFIFFSFFNNFLISLLLACLFLCIGAIPIVFGFF 360

Query:   174 IFLFLFLI---FLSIC*HIFLV--LLFVYVFLF---IDFFIF 73
             I +F  L+   +L IC   F +  L+ +Y+F F   ++ FIF
Sbjct:   361 IKVFCLLLQLSYLCICIGFFFIIWLIIIYIFYFRLIVNIFIF 402


>gi|897642 (M14820) ORF2 bases 1807-2850; first start codon at 2032; putative
           [Trypanosoma brucei]
           Length = 272

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.0015, P = 0.0015
 Identities = 28/93 (30%), Positives = 45/93 (48%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQ-YFVGNNIF 169
             F SF+ I+  LF+ LF     + F  TF ++ I  I  +   ++Y+IY    Y +   I 
Sbjct:   140 FFSFVIILGLLFLLLFLVINLF-FGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAIL 198

Query:   168 LFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             +F   I+  +    F V +F+ +   I FF F L
Sbjct:   199 IFFKFIYFDV----FFVFVFILILFIISFFSFFL 228

 Score = 91 (32.0 bits), Expect = 0.0032, P = 0.0032
 Identities = 34/110 (30%), Positives = 53/110 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFS----SIRLIPTYFNLSILSI----CF 195
             +F F+    SF+ +   L L   +    LFF F+     I++I  Y+   +  I    C+
Sbjct:   133 IFNFIYGFFSFVIILGLLFLLLFLVIN-LFFGFTFLVYGIQIILLYYVYWLYMIYSRSCY 191

Query:   194 NILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCG 27
              IL+  I  FF F+Y     D+FF+  F+ + F +S FS        LS   D+ G
Sbjct:   192 -ILMPAILIFFKFIY----FDVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFG 242

 Score = 90 (31.7 bits), Expect = 0.0042, P = 0.0042
 Identities = 31/102 (30%), Positives = 52/102 (50%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINT---INSHVF*FVYIIYMLQYFVGNN 175
             ++ +I+I+ Y FI  F     + F I F +++I     I  H+F F +I +   Y    N
Sbjct:     7 YIYYIYIL-YNFICFF-----FAFGINFLIYYIEFFIFITFHIF-FDFISFS-NYIY--N 56

Query:   174 IFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITD 40
              F  L++  +  C ++F +  FV  FLF  F  F++    I+I D
Sbjct:    57 YFGILYMFNVMFCAYLFCLFYFVIYFLFC-FIFFVIRCLFIVIMD 100

 Score = 88 (31.0 bits), Expect = 0.0069, P = 0.0069
 Identities = 33/107 (30%), Positives = 52/107 (48%), Frame = -3

Query:   347 FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI----CFNILLE 180
             FF    +L  + L  FL++   +F    F  +  I++I  Y+   +  I    C+ IL+ 
Sbjct:   140 FFSFVIILGLLFLLLFLVI--NLFFGFTFLVYG-IQIILLYYVYWLYMIYSRSCY-ILMP 195

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCG 27
              I  FF F+Y   F D+FF+  F+ + F +S FS        LS   D+ G
Sbjct:   196 AILIFFKFIY---F-DVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFG 242

 Score = 86 (30.3 bits), Expect = 0.034, P = 0.034
 Identities = 26/93 (27%), Positives = 48/93 (51%), Frame = -2

Query:   348 LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIF 169
             L+ +FIF  IY F          I  + F L F+  IN   F F +++Y +Q  +   ++
Sbjct:   128 LYFNFIFNFIYGFFSFV-----IILGLLFLLLFL-VINLF-FGFTFLVYGIQIILLYYVY 180

Query:   168 LFLFLIFLSIC*HIFLVLLFVYVFLFID-FFIFL 70
              +L++I+   C  +   +L  + F++ D FF+F+
Sbjct:   181 -WLYMIYSRSCYILMPAILIFFKFIYFDVFFVFV 213

 Score = 86 (30.3 bits), Expect = 0.034, P = 0.034
 Identities = 37/113 (32%), Positives = 55/113 (48%), Frame = -2

Query:   354 CS-LFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFF-----INTINSHVF*FVYIIYMLQ 193
             C+ LF  F F+I +LF  +F         I  FLFF     ++ +   +    +I  +L 
Sbjct:    69 CAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLL 128

Query:   192 YFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFI---FLL*YNHIIITDRCMW 28
             YF  N IF F++  F  +   I L LLF+ +FL I+ F    FL+    II+     W
Sbjct:   129 YF--NFIFNFIYGFFSFV---IILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYW 181

 Score = 81 (28.5 bits), Expect = 0.36, P = 0.31
 Identities = 29/90 (32%), Positives = 46/90 (51%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIP-TYFN-LSILSICFNILL 183
             FV++F L   + F+    F+++   +F    F  F SI L    Y + +S+L + FN + 
Sbjct:    78 FVIYF-LFCFIFFVIRCLFIVIMDFLFFN--FDIFVSILLCDIVYLDFISLLLLYFNFIF 134

Query:   182 EIIYFFF--------FFLYSFLFVDIFFLSSFL 108
               IY FF         FL  FL +++FF  +FL
Sbjct:   135 NFIYGFFSFVIILGLLFLLLFLVINLFFGFTFL 167

 Score = 80 (28.2 bits), Expect = 0.52, P = 0.41
 Identities = 30/113 (26%), Positives = 55/113 (48%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSI-CFNILL 183
             +F  F FL   +  I L+    L   I+S+  +    +I +   +    +  +  F ++L
Sbjct:   160 LFFGFTFLVYGIQIILLYYVYWLYM-IYSRSCYILMPAILIFFKFIYFDVFFVFVFILIL 218

Query:   182 EIIYFFFFFLYSFLFVDIFF-----LSSFLSMSFCLSIFSSS-CCSTTILSSLI 39
              II FF FFL  FLF+ ++F     L ++  +S+ +  + ++  C T +LS  I
Sbjct:   219 FIISFFSFFLKDFLFLSLYFDIFGSLYNYDILSYSIFYYQNNQFCLTQLLSIYI 272

 Score = 78 (27.5 bits), Expect = 1.2, P = 0.70
 Identities = 36/118 (30%), Positives = 58/118 (49%), Frame = -1

Query:   361 SYLFSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFVFHQYD*FPRILIC-LYYL-YASIF 188
             +YLF   +F +Y+ LF ++ F    L  F     F+F  +D F  IL+C + YL + S+ 
Sbjct:    70 AYLFCLFYFVIYF-LFCFIFFVIRCL--FIVIMDFLFFNFDIFVSILLCDIVYLDFISLL 126

Query:   187 CWK*YISFSFSYI-PFYLLTYFSCPPFCLCLFVYRFFH---LLV----VVQPYYHH*SMY 32
                 Y +F F++I  F+         F L   V   F     LV    ++  YY +  +Y
Sbjct:   127 LL--YFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVY-WLY 183

Query:    31 VVYS 20
             ++YS
Sbjct:   184 MIYS 187

 Score = 74 (26.0 bits), Expect = 4.2, P = 0.99
 Identities = 27/101 (26%), Positives = 42/101 (41%), Frame = -3

Query:   356 FVLFFFLSSLLSFICL---FSFLILPPGIFSK*LFFCFSSIRLIPT--YFNLSILSICFN 192
             FV+   L  LL F+ +   F F  L  GI    L++ +    +     Y  +  + I F 
Sbjct:   143 FVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFK 202

Query:   191 ILLEIIYFFFFFLYSFLFVDIF--FLSSFLSMSFCLSIFSS 75
              +   ++F F F+     +  F  FL  FL +S    IF S
Sbjct:   203 FIYFDVFFVFVFILILFIISFFSFFLKDFLFLSLYFDIFGS 243

 Score = 73 (25.7 bits), Expect = 6.4, P = 1.0
 Identities = 32/104 (30%), Positives = 54/104 (51%), Frame = -2

Query:   360 HICSLFLSF------IFIIIYLFI*LFNPPPWYIFQITFF-LFFINTINSHVF*FVYIIY 202
             HI   F+SF       F I+Y+F  +F     Y+F + +F ++F+      V   ++I+ 
Sbjct:    42 HIFFDFISFSNYIYNYFGILYMFNVMFCA---YLFCLFYFVIYFLFCFIFFVIRCLFIVI 98

Query:   201 MLQYFVGNNIFLFLFLIFLSIC*HIFLVLL-FVYVFLFI-DFFIFLL 67
             M   F   +IF+ + L  +     I L+LL F ++F FI  FF F++
Sbjct:    99 MDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVI 145

 Score = 72 (25.3 bits), Expect = 8.2, P = 1.0
 Identities = 27/92 (29%), Positives = 47/92 (51%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIP-TYFN-LSILSICFNILL 183
             FV++F L   + F+    F+++   +F    F  F SI L    Y + +S+L + FN + 
Sbjct:    78 FVIYF-LFCFIFFVIRCLFIVIMDFLFFN--FDIFVSILLCDIVYLDFISLLLLYFNFIF 134

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIF 81
               IY FF F+   + + + FL  FL     +++F
Sbjct:   135 NFIYGFFSFV---IILGLLFLLLFL----VINLF 161

 Score = 72 (25.3 bits), Expect = 8.6, P = 1.0
 Identities = 21/87 (24%), Positives = 44/87 (50%), Frame = -2

Query:   282 YIFQITFFLFFINTINSHVF*FVYIIYMLQY-FVGNNIFLFLFLIFLSIC*HIFLVLLFV 106
             Y F   FF F IN +  ++  F++I + + + F+  + +++ +   L    ++F V+   
Sbjct:    15 YNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGIL----YMFNVMFCA 70

Query:   105 YVFLFIDFFIFLL*YNHIIITDRCMWSI 22
             Y+F    F I+ L +  I    RC++ +
Sbjct:    71 YLFCLFYFVIYFL-FCFIFFVIRCLFIV 97


>pir||S49427 hypothetical protein - Lactobacillus helveticus >gi|558226
            (X81979) pid:g558226 [Lactobacillus helveticus]
            Length = 152

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.0015, P = 0.0015
 Identities = 29/99 (29%), Positives = 58/99 (58%), Frame = +1

Query:    49 DNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKE-YKKKKKKYIISNKILKHIDNIDKLK 225
             D+ +VL+ EDE+  K+ + +KKE+   +S    E +KK+ +K     +I    + ID LK
Sbjct:    49 DSKIVLEIEDEQQKKRIEKNKKENNAGISVTVLEIFKKQLEKK--DQQIKDQAEIIDFLK 106

Query:   226 YVGIN-RIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKK 345
                +  R+D + K+  LE+    +++ ++++ + N+DE K+
Sbjct:   107 GEVLRARLDSQNKEKLLEDA-WKKVEAISEK-DLNRDEEKR 145


>sp|P24499|ATP6_TRYBB ATP SYNTHASE A CHAIN (PROTEIN 6)
            Length = 229

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.0023, P = 0.0023
 Identities = 35/104 (33%), Positives = 52/104 (50%), Frame = -3

Query:   350 LFFFLSSLLSFI--CLFSFL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L  F+  CLF  L  +   ++S  L++C + + L   +  + +L I F  L  
Sbjct:    41 LLFCLFDLYLFVGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFC 100

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSC-CSTTIL 51
              +  FF F   L    F+D+FF+  FL + F L  FS  C C +T L
Sbjct:   101 FLCDFFLFNNLLVGDSFMDVFFIR-FL-LCF-LECFSLLCRCLSTFL 144

 Score = 87 (30.6 bits), Expect = 0.0064, P = 0.0064
 Identities = 34/113 (30%), Positives = 51/113 (45%), Frame = -3

Query:   350 LFFFLSSLLSFI--CLFSFL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L  F+  CLF  L  +   ++S  L++C + + L   +  + +L I F  L  
Sbjct:    41 LLFCLFDLYLFVGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFC 100

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSCCST------TILSS 45
              +  FF F   L    F+D+FF+   L    C S+    C ST       +LSS
Sbjct:   101 FLCDFFLFNNLLVGDSFMDVFFIRFLLCFLECFSLLCR-CLSTFLRLFCNLLSS 153

 Score = 86 (30.3 bits), Expect = 0.017, P = 0.016
 Identities = 28/103 (27%), Positives = 49/103 (47%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFF---------CFSSI-RLIPTYFNL-- 216
             +++ F FL   L    LF+ L++        +FF         CFS + R + T+  L  
Sbjct:    91 LYIAFLFLFCFLCDFFLFNNLLVGDSFMD--VFFIRFLLCFLECFSLLCRCLSTFLRLFC 148

Query:   215 SILSICFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIF 81
             ++LS  F +L+   +F+F F++ F  V  +F+       FCL  +
Sbjct:   149 NLLSSHFLLLMFFDFFYFIFVFFFYGVFCYFILFIFVFCFCLLFY 193

 Score = 75 (26.4 bits), Expect = 2.5, P = 0.92
 Identities = 19/66 (28%), Positives = 36/66 (54%), Frame = -2

Query:   267 TFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFI 88
             TF   F N ++SH   F+ +++   +F     F+F+F  +   C   F++ +FV+ F  +
Sbjct:   142 TFLRLFCNLLSSH---FLLLMFF-DFFY----FIFVFFFYGVFC--YFILFIFVFCFCLL 191

Query:    87 DFFIFL 70
              F++FL
Sbjct:   192 -FYVFL 196

 Score = 75 (26.4 bits), Expect = 2.5, P = 0.92
 Identities = 22/70 (31%), Positives = 35/70 (50%), Frame = -2

Query:   267 TFFLFFINTINSHV-----F*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*--HIFLVLLF 109
             TF   F N ++SH      F F Y I++  +F G   +  LF+     C   ++FL LL 
Sbjct:   142 TFLRLFCNLLSSHFLLLMFFDFFYFIFVF-FFYGVFCYFILFIFVFCFCLLFYVFLYLLD 200

Query:   108 VYVFLFIDFFIF 73
             ++  + +  FIF
Sbjct:   201 LFAAI-LQLFIF 211


>gi|343544 (M33228) ATPase 6 [Trypanosoma brucei]
           Length = 231

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.0023, P = 0.0023
 Identities = 35/104 (33%), Positives = 52/104 (50%), Frame = -3

Query:   350 LFFFLSSLLSFI--CLFSFL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L  F+  CLF  L  +   ++S  L++C + + L   +  + +L I F  L  
Sbjct:    42 LLFCLFDLYLFVGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFC 101

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSC-CSTTIL 51
              +  FF F   L    F+D+FF+  FL + F L  FS  C C +T L
Sbjct:   102 FLCDFFLFNNLLVGDSFMDVFFIR-FL-LCF-LECFSLLCRCLSTFL 145

 Score = 87 (30.6 bits), Expect = 0.0065, P = 0.0065
 Identities = 34/113 (30%), Positives = 51/113 (45%), Frame = -3

Query:   350 LFFFLSSLLSFI--CLFSFL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L  F+  CLF  L  +   ++S  L++C + + L   +  + +L I F  L  
Sbjct:    42 LLFCLFDLYLFVGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFC 101

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSCCST------TILSS 45
              +  FF F   L    F+D+FF+   L    C S+    C ST       +LSS
Sbjct:   102 FLCDFFLFNNLLVGDSFMDVFFIRFLLCFLECFSLLCR-CLSTFLRLFCNLLSS 154

 Score = 83 (29.2 bits), Expect = 0.11, P = 0.10
 Identities = 27/104 (25%), Positives = 47/104 (45%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFF---------CFSSI-RLIPTYFNLSI 210
             +++ F FL   L    LF+ L++        +FF         CFS + R + T+  L  
Sbjct:    92 LYIAFLFLFCFLCDFFLFNNLLVGDSFMD--VFFIRFLLCFLECFSLLCRCLSTFLRLFC 149

Query:   209 LSICFNILLEIIYFFFFFLYSFLFVDIF---FLSSFLSMSFCLSIF 81
               +  + LL + + FF+F++ F F  +F   F+       FCL  +
Sbjct:   150 NLLSSHFLLLMFFDFFYFIFVFFFYGVFCYWFILFIFVFCFCLLFY 195

 Score = 78 (27.5 bits), Expect = 0.85, P = 0.57
 Identities = 31/114 (27%), Positives = 51/114 (44%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFC--FSSIRLIPTYFNLSILSICFNILL 183
             F+  FF+  LL F+  FS L      F +   FC   SS  L+  +F+       F    
Sbjct:   118 FMDVFFIRFLLCFLECFSLLCRCLSTFLR--LFCNLLSSHFLLLMFFDFFYFIFVFFFYG 175

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIM 15
                Y+F  F++ F F  +F++  +L   F   +     C+  IL  ++D   LF++
Sbjct:   176 VFCYWFILFIFVFCFCLLFYVFLYLLDLFAAILQLFIFCNM-ILQLIMDFL-LFLL 229

 Score = 77 (27.1 bits), Expect = 1.3, P = 0.71
 Identities = 19/66 (28%), Positives = 37/66 (56%), Frame = -2

Query:   267 TFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFI 88
             TF   F N ++SH   F+ +++   +F     F+F+F  +   C + F++ +FV+ F  +
Sbjct:   143 TFLRLFCNLLSSH---FLLLMFF-DFFY----FIFVFFFYGVFC-YWFILFIFVFCFCLL 193

Query:    87 DFFIFL 70
              F++FL
Sbjct:   194 -FYVFL 198

 Score = 74 (26.0 bits), Expect = 3.4, P = 0.97
 Identities = 28/105 (26%), Positives = 52/105 (49%), Frame = -2

Query:   345 FLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFL 166
             FL F    +YLF+ L       +F + +F+ F N  +      + + Y + Y    N++L
Sbjct:    41 FLLFCLFDLYLFVGLC------LFLLLWFMLF-NLYS------LILYYCITYL---NLYL 84

Query:   165 FLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITDRCM 31
                ++FL     +++  LF++ FL  DFF+F    N++++ D  M
Sbjct:    85 LFCIVFL-----LYIAFLFLFCFL-CDFFLF----NNLLVGDSFM 119

 Score = 72 (25.3 bits), Expect = 6.6, P = 1.0
 Identities = 22/64 (34%), Positives = 30/64 (46%), Frame = -1

Query:   259 FVFHQYD*F-PRILICLYYLYASIFCWK*YISFSFSYIPFYLLTYFSCPPFC-LCLFVYR 86
             F+F   D F  R+L+C+YY   S  C+  Y +       F L   F    F  LCLF+  
Sbjct:     2 FLFFFCDLFWLRLLLCMYYCVWSRLCFIVYFNCLMLIFDFLLFCLFDLYLFVGLCLFLLL 61

Query:    85 FFHL 74
             +F L
Sbjct:    62 WFML 65


>pir||A35349 H+-transporting ATP synthase (EC 3.6.1.34) protein 6 - Trypanosoma
            brucei mitochondrion (SGC6)
            Length = 214

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 31/102 (30%), Positives = 47/102 (46%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLIL---PPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L  F+ L  FL+L      ++S  L++C + + L   +  + +L I F  L  
Sbjct:    42 LLFCLFDLYLFVGLCVFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFC 101

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSCCST 60
              +  FF F   L    F+D+FF+   L    C S+    C ST
Sbjct:   102 FLCDFFLFNNLLVGDSFMDVFFIRPLLCFLECFSLLCR-CLST 143

 Score = 90 (31.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 36/114 (31%), Positives = 56/114 (49%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGI----FSK*LF-F--CFSSI-RLIPTYFNL--SI 210
             +++ F FL   L    LF+ L++        F + L  F  CFS + R + T+  L  ++
Sbjct:    92 LYIAFLFLFCFLCDFFLFNNLLVGDSFMDVFFIRPLLCFLECFSLLCRCLSTFLRLFCNL 151

Query:   209 LSICFNILL--EIIYFFF--FFLYSFLFVD--IFFLSSFLSMSFCLSIFSSSCC 66
             LS  F +L+  +  YF F  FFL+ FL +   I+F   FL +  C+ IF    C
Sbjct:   152 LSSHFLLLMFFDFFYFIFVFFFLWCFLLLIYFIYFCVLFLFIILCVFIFVGFIC 205

 Score = 89 (31.3 bits), Expect = 0.0033, P = 0.0033
 Identities = 29/97 (29%), Positives = 44/97 (45%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             F+  FF+  LL F+  FS L      F +   FC     L+ ++F   +L + F+    I
Sbjct:   118 FMDVFFIRPLLCFLECFSLLCRCLSTFLR--LFC----NLLSSHF---LLLMFFDFFYFI 168

Query:   176 IYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCC 66
               FFF + +  L   I+F   FL +  C+ IF    C
Sbjct:   169 FVFFFLWCFLLLIYFIYFCVLFLFIILCVFIFVGFIC 205

 Score = 88 (31.0 bits), Expect = 0.0043, P = 0.0043
 Identities = 31/104 (29%), Positives = 48/104 (46%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLIL---PPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L  F+ L  FL+L      ++S  L++C + + L   +  + +L I F  L  
Sbjct:    42 LLFCLFDLYLFVGLCVFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFC 101

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTIL 51
              +  FF F   L    F+D+FF+   L    C S+     C +T L
Sbjct:   102 FLCDFFLFNNLLVGDSFMDVFFIRPLLCFLECFSLLCR--CLSTFL 145

 Score = 85 (29.9 bits), Expect = 0.028, P = 0.027
 Identities = 34/113 (30%), Positives = 51/113 (45%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLIL---PPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLE 180
             L F L  L  F+ L  FL+L      ++S  L++C + + L   +  + +L I F  L  
Sbjct:    42 LLFCLFDLYLFVGLCVFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFC 101

Query:   179 IIYFFFFF---LYSFLFVDIFFLSSFLSMSFCLSIFSSSCCST------TILSS 45
              +  FF F   L    F+D+FF+   L    C S+    C ST       +LSS
Sbjct:   102 FLCDFFLFNNLLVGDSFMDVFFIRPLLCFLECFSLLCR-CLSTFLRLFCNLLSS 154

 Score = 78 (27.5 bits), Expect = 0.79, P = 0.54
 Identities = 22/74 (29%), Positives = 38/74 (51%), Frame = -2

Query:   267 TFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFL-IFLSIC*HIFLVLLFVYVFLF 91
             TF   F N ++SH    ++  +   YF    IF+F FL  FL +   I+  +LF+++ L 
Sbjct:   143 TFLRLFCNLLSSHFLLLMFFDFF--YF----IFVFFFLWCFLLLIYFIYFCVLFLFIILC 196

Query:    90 IDFFIFLL*YNHIII 46
             +  F+  +   HI +
Sbjct:   197 VFIFVGFI-CRHITV 210


>gnl|PID|d1000903 (D00570) open reading frame (196 AA) [Mus musculus]
            Length = 196

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.0027, P = 0.0027
 Identities = 39/105 (37%), Positives = 56/105 (53%), Frame = -3

Query:   338 LSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSI-LSICF-NILLEIIYFF 165
             +S  LS ICL S++ L   I+       + SI  +  Y +LSI LSI + +I L I    
Sbjct:     1 MSVCLS-ICL-SYVCLSISIYLSIYLSIYLSIYHMSVY-HLSIYLSIIYLSIYLSIYLSI 57

Query:   164 FFFLY-SFLFVDIFFLSSFLS---MSFCLSIFSSSCCSTTILSSLIDV 33
             +  +Y S L V +  LS +LS   MS CLSI+ S  C +  LS  + +
Sbjct:    58 YLSIYLSCLTVYLSCLSVYLSVYHMSVCLSIYLSYVCLSIYLSIYVSI 105

 Score = 87 (30.6 bits), Expect = 0.0045, P = 0.0045
 Identities = 24/92 (26%), Positives = 47/92 (51%), Frame = -3

Query:   344 FFLSSLLSFICLFSFLILPPGIFSK*LFFCFSS-IRLIPTYFNLSILSICFNILLEIIYF 168
             + LS  LS I L  +L +   I+      C +  +  +  Y ++  +S+C +I L  +  
Sbjct:    36 YHLSIYLSIIYLSIYLSIYLSIYLSIYLSCLTVYLSCLSVYLSVYHMSVCLSIYLSYVCL 95

Query:   167 FFFF-LYSFLFVDIFFLSSFLSMSFCLSIFSSS 72
               +  +Y  +++ I+ +S F  +S CLSI+ S+
Sbjct:    96 SIYLSIYVSIYLSIYHMSVF-HLSVCLSIYLST 127


>gnl|PID|d1000902 (D00570) open reading frame (251 AA) [Mus musculus]
            Length = 250

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.0027, P = 0.0027
 Identities = 39/114 (34%), Positives = 55/114 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFS-FL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             L  +LS  LS++CL S +L I    I+       + SI L      LSI+S+C +I L  
Sbjct:    70 LSIYLSIYLSYVCLSSIYLSIYHLSIYLSIYLSIYLSIYLSIMSDCLSIMSVCLSICLSY 129

Query:   176 ----IYFFFFFLYSFLFVDI-FFLSSFLSM----SFCLSIFSSSCCSTTILSSL 42
                 IY     L  +L + +  +LS +LS     S CLSI+ S   S   LSS+
Sbjct:   130 VCLSIYLSIICLSVYLSIYLCIYLSIYLSYVCLSSICLSIYLSIYLSYVCLSSI 183

 Score = 90 (31.7 bits), Expect = 0.0036, P = 0.0036
 Identities = 32/103 (31%), Positives = 55/103 (53%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFC-FSSIRLIPTYFNLSILSICFNILLEII 174
             L  +LS  LS++CL S  +    I+   ++   + SI L   Y  LSI+S C +I+   +
Sbjct:    70 LSIYLSIYLSYVCLSSIYL---SIYHLSIYLSIYLSIYL-SIY--LSIMSDCLSIMSVCL 123

Query:   173 YFFFFFLYSFLFVDIFFLSSFLSMSFC--LSIFSSSCCSTTILSSL 42
                  ++   +++ I  LS +LS+  C  LSI+ S  C ++I  S+
Sbjct:   124 SICLSYVCLSIYLSIICLSVYLSIYLCIYLSIYLSYVCLSSICLSI 169

 Score = 89 (31.3 bits), Expect = 0.0046, P = 0.0046
 Identities = 35/112 (31%), Positives = 57/112 (50%), Frame = -3

Query:   341 FLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIYFFF 162
             +LS  LS++CL  +L +     S    + + SI L   Y ++ +  +C + +   IY   
Sbjct:    41 YLSIYLSYVCLSIYLSII--CLS---VYIYLSIYL-SIYLSIYLSYVCLSSIYLSIYHLS 94

Query:   161 FFLYSFLFVDIFFLSSFLS-MSFCLSIFS---SSCCSTTILSSLIDVCGLFIMVKI 6
              +L  +L +   +LS +LS MS CLSI S   S C S   LS  + +  L + + I
Sbjct:    95 IYLSIYLSI---YLSIYLSIMSDCLSIMSVCLSICLSYVCLSIYLSIICLSVYLSI 147

 Score = 82 (28.9 bits), Expect = 0.19, P = 0.17
 Identities = 37/104 (35%), Positives = 55/104 (52%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICL--FSFLILPPGIF-SK*L-FFCFSSIRLIPTYFNLSI-LSICF 195
             I++ +  LS  LS ICL  + +L +   I+ S  L + C SSI L  + ++LSI LSI  
Sbjct:    44 IYLSYVCLSIYLSIICLSVYIYLSIYLSIYLSIYLSYVCLSSIYL--SIYHLSIYLSIYL 101

Query:   194 NILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILS 48
             +I L I         S + V +    S++    CLSI+ S  C +  LS
Sbjct:   102 SIYLSIYLSIMSDCLSIMSVCLSICLSYV----CLSIYLSIICLSVYLS 146

 Score = 81 (28.5 bits), Expect = 0.35, P = 0.30
 Identities = 36/115 (31%), Positives = 52/115 (45%), Frame = -1

Query:   361 SYLFSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFVFHQYD*FPRIL-ICLYY----LYA 197
             SY+   S +   YHL +YL+   S  +Y       +          L ICL Y    +Y 
Sbjct:    79 SYVCLSSIYLSIYHLSIYLSIYLS--IYLSIYLSIMSDCLSIMSVCLSICLSYVCLSIYL 136

Query:   196 SIFCWK*YISFSFSYIPFYLLTYFSCPPFCL---CLFVYRFFHL-LVVVQPYYHH*SMYV 29
             SI C   Y+S    Y+  YL  Y S    CL   CL +Y   +L  V +   Y   ++Y+
Sbjct:   137 SIICLSVYLSI---YLCIYLSIYLSY--VCLSSICLSIYLSIYLSYVCLSSIYLSYAVYI 191

Query:    28 VY 23
             +Y
Sbjct:   192 IY 193

 Score = 77 (27.1 bits), Expect = 1.3, P = 0.74
 Identities = 38/117 (32%), Positives = 55/117 (47%), Frame = -3

Query:   350 LFFFLSSLLSFICLFS-FL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             L  +LS  LS++CL S +L I    I+       + SI L      LSI+S+C +I L  
Sbjct:    70 LSIYLSIYLSYVCLSSIYLSIYHLSIYLSIYLSIYLSIYLSIMSDCLSIMSVCLSICLSY 129

Query:   176 ----IYFFFFFLYSFLFVDI-FFLSSFLSM----SFCLSIFSSS----CCSTTILSS 45
                 IY     L  +L + +  +LS +LS     S CLSI+ S      C ++I  S
Sbjct:   130 VCLSIYLSIICLSVYLSIYLCIYLSIYLSYVCLSSICLSIYLSIYLSYVCLSSIYLS 186

 Score = 72 (25.3 bits), Expect = 7.5, P = 1.0
 Identities = 25/118 (21%), Positives = 59/118 (50%), Frame = -2

Query:   360 HIC-SLFLSFIFIIIYLFI*LFNPP--PWYIFQITFFLFFINTINSHVF*FVYI-IYMLQ 193
             ++C S++LS I + +Y+++ ++       Y+  +     +++  +  ++  +Y+ IY+  
Sbjct:    48 YVCLSIYLSIICLSVYIYLSIYLSIYLSIYLSYVCLSSIYLSIYHLSIYLSIYLSIYLSI 107

Query:   192 YFVGNNIFLFLFLIFLSIC*-HIFLVLLFVYVFLFIDFFIFLL*YNHIIITDRCMWSI 22
             Y    +  L +  + LSIC  ++ L +    + L +   I+L  Y  I ++  C+ SI
Sbjct:   108 YLSIMSDCLSIMSVCLSICLSYVCLSIYLSIICLSVYLSIYLCIYLSIYLSYVCLSSI 165


>gi|294749 (L08174) NADH dehydrogenase subunit 3 [Romanomermis culicivorax]
           Length = 117

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.0031, P = 0.0031
 Identities = 30/100 (30%), Positives = 55/100 (55%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITF--FLFFINTINSHVF*F--VYIIYMLQY 190
             I  +F++ IF   Y F+   N   +++F+  F    ++ N I++H F    ++I + L+ 
Sbjct:    22 ILIMFMNLIFKEFY-FL---NKNQFFLFECGFESISWYFNNISNHFFKIGIIFITFDLE- 76

Query:   189 FVGNNIFLFLFLIFLSI-C*HIFLVLLFVYVFLFIDFFIFLL*YN 58
                  +  FLF IF  I    I+L+  F++  LF++FF+  L +N
Sbjct:    77 -----LMYFLFFIFNLINMKMIWLIFNFIFFTLFLEFFLNTLSWN 116


>gi|1216394 (U40265) ATPase subunit 6 [Trypanosoma cruzi]
            Length = 174

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.0032, P = 0.0032
 Identities = 36/104 (34%), Positives = 50/104 (48%), Frame = -3

Query:   350 LFFFLSSLLSFI--CLFSFL-ILPPGIFSK*LFFCFSSIRLIPTYFNLSIL-SICFNILL 183
             L F L  L  FI  CLF  L  +   ++S  L++C        TY NL +L  I F   +
Sbjct:    39 LLFCLFDLYLFIGLCLFLLLWFMLFNLYSLILYYCI-------TYLNLYLLFCIVFLYYM 91

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSF-----C-LSIFSSSC-CSTTIL 51
               ++ F F L  FLF ++    +F+ + F     C L  FS  C C  T L
Sbjct:    92 SFLFLFCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSLLCRCFATFL 142

 Score = 74 (26.0 bits), Expect = 1.8, P = 0.84
 Identities = 27/85 (31%), Positives = 43/85 (50%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFF---------CFSSI-RLIPTYFNL--S 213
             ++ F FL   L    LF+ L++        +FF         CFS + R   T+  L  +
Sbjct:    90 YMSFLFLFCFLLDFFLFNNLLVGDNFMD--VFFIRFLLCFLECFSLLCRCFATFLRLFCN 147

Query:   212 ILSICFNILL--EIIYFFFFFLYSFLF 138
             +LS  F +L+  + +YFF FFL+ F+F
Sbjct:   148 LLSSHFLLLMFFDFLYFFLFFLFFFVF 174

 Score = 74 (26.0 bits), Expect = 1.8, P = 0.84
 Identities = 28/86 (32%), Positives = 42/86 (48%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIY 171
             L++ + S L F+  F+ L+L   IF   LF  F     I     L +  + FN+   I+Y
Sbjct:    15 LYYCVWSRLCFVVYFNCLLL---IFDFLLFCLFDLYLFIGLCLFLLLWFMLFNLYSLILY 71

Query:   170 FFFFFLYSFLFVDIFFL--SSFLSMSFC 93
             +   +L  +L   I FL   SFL + FC
Sbjct:    72 YCITYLNLYLLFCIVFLYYMSFLFL-FC 98

 Score = 72 (25.3 bits), Expect = 3.8, P = 0.98
 Identities = 24/93 (25%), Positives = 46/93 (49%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             +L+L F  + +Y    LF     + F + FFLF    +  +     +I ++L +    ++
Sbjct:    78 NLYLLFCIVFLYYMSFLF----LFCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSL 133

Query:   171 FLFLFLIFLSI-C*----HIFLVLLFVYVFLFIDFFIF 73
                 F  FL + C     H  L++ F +++ F+ FF+F
Sbjct:   134 LCRCFATFLRLFCNLLSSHFLLLMFFDFLYFFL-FFLF 170

 Score = 70 (24.6 bits), Expect = 7.2, P = 1.0
 Identities = 26/95 (27%), Positives = 47/95 (49%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             +L+L F  + +Y    LF     + F + FFLF    +  +     +I ++L +    ++
Sbjct:    78 NLYLLFCIVFLYYMSFLF----LFCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSL 133

Query:   171 FLFLFLIFLSIC*HI----FLVLLFVYVFLFIDFFIFLL 67
                 F  FL +  ++    FL+L+F   F F+ FF+F L
Sbjct:   134 LCRCFATFLRLFCNLLSSHFLLLMF---FDFLYFFLFFL 169


>gi|2619013 (AF027868) sensor kinase [Bacillus subtilis]
            Length = 370

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.0033, P = 0.0032
 Identities = 27/102 (26%), Positives = 48/102 (47%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             I  + L+ +F  +Y F   F    W I+   F L  I+T +  +F ++Y  + + YF+GN
Sbjct:    40 IVGIILTLLFFSVYRFA--FVSKGWTIYLWGFLLIGISTASITLFSYIYFAFFIAYFIGN 97

Query:   177 -------NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
                    +I  ++ LI  ++  +  LVL   +    I F +  L
Sbjct:    98 IKERVPFHILYYVHLISAAVAANFSLVLKKEFFLTQIPFVVITL 141


>gi|1890784 (U88489) NADH dehydrogenase 1 [Flexamia areolata]
            Length = 310

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.0041, P = 0.0040
 Identities = 36/119 (30%), Positives = 54/119 (45%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLI-LPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             I + FF L    SFI  ++F   L   IFS  +FFC+ S  +  +  N +          
Sbjct:   149 ILLCFFLLVDSYSFISYYNFQFSLWLIIFSMPIFFCWLSCCMAES--NRTPFDFSEGES- 205

Query:   182 EIIYFFFFFL----YSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIM 15
             E++Y F        ++ LF+  +    F+SM  C+    S  CS      LI +C LFI 
Sbjct:   206 ELVYGFNVEYGGGGFALLFISEYSSIIFISMITCVIFLGSDLCSLGFYVKLILMCFLFIW 265

Query:    14 VK 9
             V+
Sbjct:   266 VR 267


>gnl|PID|e348257 (Z81048) C41G7.6 [Caenorhabditis elegans]
            Length = 223

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.0047, P = 0.0047
 Identities = 27/96 (28%), Positives = 51/96 (53%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++ DEK +++KD DKK++KK+      E K +KK     +K     D   + +     + 
Sbjct:    80 KEGDEKKEEKKDEDKKDEKKDEEKKDGEKKSEKKDEKKDDKKDDKKDGKKEDEKKDDEKK 139

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRT 354
             DE++K    E+   G  KK  K+ ++ KD++K+ ++
Sbjct:   140 DEEKKDDKKEDDKKGD-KKDEKKDDEKKDDKKEAKS 174

 Score = 74 (26.0 bits), Expect = 3.2, P = 0.96
 Identities = 14/33 (42%), Positives = 23/33 (69%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKK 168
             ++ +K D++KD +KK+DKK   +  K+ KK KK
Sbjct:   152 KKGDKKDEKKDDEKKDDKKEAKSKSKKSKKSKK 184

 Score = 72 (25.3 bits), Expect = 6.2, P = 1.0
 Identities = 27/95 (28%), Positives = 50/95 (52%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++ DEK +++KD DKK++KK+    +K+ +KK +K     K  K  D  D  K       
Sbjct:    80 KEGDEKKEEKKDEDKKDEKKD--EEKKDGEKKSEK-----KDEKKDDKKDDKK------- 125

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             D K++    ++      KK +K+ +D K ++K ++
Sbjct:   126 DGKKEDEKKDDEKKDEEKKDDKKEDDKKGDKKDEK 160

 Score = 71 (25.0 bits), Expect = 8.3, P = 1.0
 Identities = 15/34 (44%), Positives = 20/34 (58%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK 171
             ++DEK D +K  DKKE K     ++K  K KK K
Sbjct:   156 KKDEKKDDEKKDDKKEAKSKSKKSKKSKKSKKSK 189


>sp|P27571|XIST_MOUSE X INACTIVE SPECIFIC TRANSCRIPT PROTEIN >pir||S15433
            hypothetical protein - mouse >gi|1181245 (X59289) ORF [Mus
            musculus] >prf||1711440A xist gene [Mus musculus]
            Length = 298

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.0049, P = 0.0049
 Identities = 39/118 (33%), Positives = 56/118 (47%), Frame = -3

Query:   341 FLSSLLSFICLFSF-LILPPGIFSK*LFFC----FSSIRLIPTYFNLSILS--ICFNILL 183
             F   LLSF+CLF    +LP  +F   +  C    F S+ L+P +  LS L+  +CF I L
Sbjct:    86 FACLLLSFVCLFCLQCVLPIPMFLLHVLSCRALSFVSLSLVPVWSALSSLAMALCF-IYL 144

Query:   182 EIIYFFFFFLYSF---LFVDIFFLSSFLSMSFCLSIFSSSCCSTT-----ILSSLIDVC 30
               I   F F  +F   L+V      S   +   L + SSS C +      +L SL++ C
Sbjct:   145 VAISLSFSFTPAFRDSLWVTCCMHPSLFLVLTPLVLCSSSLCQSISVFFLLLLSLVNSC 203


>gi|1255425 (U53154) C33G8.2 gene product [Caenorhabditis elegans]
            Length = 390

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.0058, P = 0.0058
 Identities = 36/101 (35%), Positives = 51/101 (50%), Frame = +1

Query:    46 DDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLK 225
             DDN    ++E EK  K+KD  KK+D  +   N K+  KKKKK    +K     +N D  K
Sbjct:   188 DDND---EEEKEKDKKKKD-KKKDDDDDEDENDKKKDKKKKK---DDK--DDDENEDDKK 238

Query:   226 YVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
                  + D+K+K    E       KK +K+ ND+ +E KKK
Sbjct:   239 KDKKKKKDDKEKDDDDEEEKDK--KKKDKKKNDDDEEDKKK 277

 Score = 89 (31.3 bits), Expect = 0.0096, P = 0.0095
 Identities = 31/93 (33%), Positives = 49/93 (52%), Frame = +1

Query:    73 EDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDE 252
             EDE  DK+KD  KK+D K+   N  + KK KKK     K  K  D+ D+ +    ++  +
Sbjct:   212 EDEN-DKKKDKKKKKDDKDDDENEDDKKKDKKK----KKDDKEKDDDDEEEK---DKKKK 263

Query:   253 KQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
              +KK+  +     + KK  K  +D++DE  KK+
Sbjct:   264 DKKKNDDDEEDKKKDKKKKKDDDDDEDEDNKKK 296

 Score = 88 (31.0 bits), Expect = 0.012, P = 0.012
 Identities = 31/93 (33%), Positives = 48/93 (51%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E+++ DK+K   KK+D  +   N K+  KKKKK    +K     +N D  K     + D
Sbjct:   192 EEEKEKDKKKKDKKKDDDDDEDENDKKKDKKKKK---DDK--DDDENEDDKKKDKKKKKD 246

Query:   250 EKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             +K+K    E       KK +K+ ND+ +E KKK
Sbjct:   247 DKEKDDDDEEEKDK--KKKDKKKNDDDEEDKKK 277

 Score = 87 (30.6 bits), Expect = 0.031, P = 0.031
 Identities = 31/95 (32%), Positives = 49/95 (51%), Frame = +1

Query:    67 QQEDE-KIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINR 243
             + +DE + DK+KD  KK+D K    + +E K KKKK    +K     D  DK K      
Sbjct:   228 KDDDENEDDKKKDKKKKKDDKEKDDDDEEEKDKKKK----DKKKNDDDEEDKKK------ 277

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
              D+K+KK   ++      KK  K+  D+KD+  +++
Sbjct:   278 -DKKKKKDDDDDEDEDNKKKDKKKKKDDKDDEDEEK 312

 Score = 86 (30.3 bits), Expect = 0.060, P = 0.059
 Identities = 28/95 (29%), Positives = 49/95 (51%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNI-DKLKYVGINR 243
             ++ED+K ++++   KK+DKK    + +E +K KKK    N      D   DK K    N 
Sbjct:   132 EEEDKKKEEEEKDKKKKDKKKEEDDEEEEQKDKKKKDEKNDDDDEEDKKKDKKKKKDDN- 190

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
              DE++K+   +     +    ++  ND K ++KKK+
Sbjct:   191 -DEEEKEKDKKKKDKKKDDDDDEDENDKKKDKKKKK 225

 Score = 84 (29.6 bits), Expect = 0.20, P = 0.18
 Identities = 31/94 (32%), Positives = 47/94 (50%), Frame = +1

Query:    67 QQEDE-KIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINR 243
             + +DE + DK+KD  KK+D K    + +E K KKKK    +K     D  DK K     +
Sbjct:   228 KDDDENEDDKKKDKKKKKDDKEKDDDDEEEKDKKKK----DKKKNDDDEEDKKKDKKKKK 283

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
              D+  +    +N    + KK  K   D++DE K+K
Sbjct:   284 DDDDDEDE--DNKK--KDKKKKKDDKDDEDEEKEK 314

 Score = 84 (29.6 bits), Expect = 0.20, P = 0.18
 Identities = 30/95 (31%), Positives = 49/95 (51%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNI-DKLKYVGINR 243
             ++ED+K ++++   KK+DKK    + +E +K KKK    N      D   DK K    N 
Sbjct:   132 EEEDKKKEEEEKDKKKKDKKKEEDDEEEEQKDKKKKDEKNDDDDEEDKKKDKKKKKDDND 191

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
              +EK+K    ++      KK  K  +D++DE  KK+
Sbjct:   192 EEEKEKDKKKKD------KK--KDDDDDEDENDKKK 219

 Score = 83 (29.2 bits), Expect = 0.30, P = 0.26
 Identities = 34/102 (33%), Positives = 51/102 (50%), Frame = +1

Query:    46 DDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLK 225
             DDN    ++E EK  K+KD  KK+D  +   N K+  KKKKK    +K     +N D  K
Sbjct:   188 DDND---EEEKEKDKKKKD-KKKDDDDDEDENDKKKDKKKKK---DDK--DDDENEDDKK 238

Query:   226 YVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKD---ERKKKR 351
                  + D+K+K    E     + K   K  +D +D   ++KKK+
Sbjct:   239 KDKKKKKDDKEKDDDDEEEKDKKKKDKKKNDDDEEDKKKDKKKKK 283

 Score = 82 (28.9 bits), Expect = 0.44, P = 0.35
 Identities = 29/97 (29%), Positives = 48/97 (49%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMST-NRKEYKKKKKKYIISNKILKHI-DNIDKLKYVGIN 240
             +++DEK D   + DKK+DKK     N +E K+K KK     K      D  DK K     
Sbjct:   165 KKKDEKNDDDDEEDKKKDKKKKKDDNDEEEKEKDKKKKDKKKDDDDDEDENDKKKDKKKK 224

Query:   241 RIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             + D+   ++  +     + KK +K+ +D+ +E K K+
Sbjct:   225 KDDKDDDENEDDKKKDKKKKKDDKEKDDDDEEEKDKK 261

 Score = 80 (28.2 bits), Expect = 0.99, P = 0.63
 Identities = 29/96 (30%), Positives = 52/96 (54%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             ++DE  +K+KD  KK+ KK+   +  E +KK KK     K  K  D+ D+      ++ D
Sbjct:   305 KDDEDEEKEKDKKKKDKKKDDDDDDDEKEKKDKK----KKDDKD-DDEDE------DKDD 353

Query:   250 EKQKKSYLEN-IPGGRIKKLNKQINDNKDERKKKRTN 357
             +K+KK  +++ +   + KK +    D  D++K K+ N
Sbjct:   354 KKKKKDDVDDDMKKDKKKKEDDDKEDEDDKKKDKKKN 390

 Score = 77 (27.1 bits), Expect = 2.8, P = 0.94
 Identities = 27/95 (28%), Positives = 48/95 (50%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             +++D+  +++KD  KK+ KKN      + K KKKK    +   +  DN  K K     + 
Sbjct:   248 KEKDDDDEEEKDKKKKDKKKNDDDEEDKKKDKKKKKDDDDD--EDEDNKKKDKK---KKK 302

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             D+K  +   E     + KK  K+ +D+ D+ K+K+
Sbjct:   303 DDKDDED--EEKEKDKKKKDKKKDDDDDDDEKEKK 335

 Score = 77 (27.1 bits), Expect = 2.8, P = 0.94
 Identities = 32/97 (32%), Positives = 51/97 (52%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDK-LKYVGINRI 246
             +ED+K DK+K  D  +D+     N+K+ KKKKK         K  D   K  K    +  
Sbjct:   272 EEDKKKDKKKKKDDDDDEDE--DNKKKDKKKKKDDKDDEDEEKEKDKKKKDKKKDDDDDD 329

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDN--KDERKKKRTNM 360
             DEK+KK         + KK +K  +++  KD++KKK+ ++
Sbjct:   330 DEKEKKD--------KKKKDDKDDDEDEDKDDKKKKKDDV 361


>sp|P25805|CYSP_PLAFA THROPHOZOITE CYSTEINE PROTEINASE PRECURSOR (TCP)
            >pir||A45624 trophozoite cysteine proteinase - Plasmodium
            falciparum >gi|160248 (M81341) cysteine proteinase [Plasmodium
            falciparum]
            Length = 569

  Plus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.0059, P = 0.0059
 Identities = 25/117 (21%), Positives = 65/117 (55%), Frame = +1

Query:    10 FTIMNRPHTSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNK 189
             FT  +  H + ++ N   L++E+ ++ +   ++K + +K+   N    ++ ++KY ++++
Sbjct:    56 FTNKSSAHNNNNNKNEHSLKKEEIELLRVL-LEKYKKQKDGILNESSNEEDEEKYTLNSE 114

Query:   190 ILKHIDNIDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
                + +N+  +K   I    + +K+ Y+ N+    ++K  K IN+N +E +K+ +N+
Sbjct:   115 TYNNKNNVSNIKNDSI----KSKKEEYI-NLERILLEKYKKFINENNEENRKELSNI 166

 Score = 78 (27.5 bits), Expect = 3.4, P = 0.97
 Identities = 33/119 (27%), Positives = 59/119 (49%), Frame = +1

Query:    22 NRPHTSISDDNMVVLQQEDEKIDKQKD-----IDKKEDKKNMSTNRKEYKKKKKKYIISN 186
             N+   S+  + + +L+   EK  KQKD        +ED++  + N + Y  K     I N
Sbjct:    68 NKNEHSLKKEEIELLRVLLEKYKKQKDGILNESSNEEDEEKYTLNSETYNNKNNVSNIKN 127

Query:   187 KILK----HIDNIDKL---KYVG-INRIDEKQKKSYLENIPGGRIKKLNKQI-NDNKDER 339
               +K       N++++   KY   IN  +E+ +K  L NI   ++ ++NK I  + KD++
Sbjct:   128 DSIKSKKEEYINLERILLEKYKKFINENNEENRKE-LSNILH-KLLEINKLILREEKDDK 185

Query:   340 K 342
             K
Sbjct:   186 K 186


>gi|1519343 (U66363) Pdd1p [Tetrahymena thermophila] >gi|1519345 (U66364) Pdd1p
            [Tetrahymena thermophila]
            Length = 499

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.0064, P = 0.0064
 Identities = 27/96 (28%), Positives = 53/96 (55%), Frame = +1

Query:    73 EDEKIDKQKDIDKKEDKK-NMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             E+E+ D Q +++K  D + N  T +KEY  K + + I +   +  +++  +K + +   +
Sbjct:    42 EEEEED-QYEVEKILDSRFNPKTKQKEYLVKWENWPIEDSTWEPYEHLSNVKEI-VQAFE 99

Query:   250 EKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
             +KQK + +   P G I ++N Q    KD +KK R ++
Sbjct:   100 KKQKANVMPQ-PTGPITRVNAQ----KDPQKKNRLSL 131


>sp|P36043|YKU1_YEAST 64.6 KD PROTEIN IN TOR2-PAS1 INTERGENIC REGION
            >pir||S38038 hypothetical protein YKL201c - yeast (Saccharomyces
            cerevisiae) >gi|486359 (Z28201) ORF YKL201c [Saccharomyces
            cerevisiae]
            Length = 539

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.0071, P = 0.0070
 Identities = 26/94 (27%), Positives = 51/94 (54%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++E+EK  K+++  KK++++      +E KKKK++     K  K  +   K +     + 
Sbjct:   406 KEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEE---EEKKKKEEEEKKKQEEEEKKKK 462

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             +E++KK   E   G ++K  +++   N+DE KKK
Sbjct:   463 EEEEKKKQEE---GEKMKNEDEENKKNEDEEKKK 493

 Score = 84 (29.6 bits), Expect = 0.31, P = 0.26
 Identities = 23/96 (23%), Positives = 53/96 (55%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK-YIISNKILKHIDNIDKLKYVGINR 243
             ++E+EK  K+++  KK++++      +E KKK+++   + N+  ++  N D+ K      
Sbjct:   438 KEEEEKKKKEEEEKKKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEEKKKNEEE 497

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
               +KQ++   +N    + K+  ++   N++E KKK+
Sbjct:   498 EKKKQEEKNKKNEDEEKKKQEEEEKKKNEEEEKKKQ 533

 Score = 81 (28.5 bits), Expect = 1.1, P = 0.66
 Identities = 30/95 (31%), Positives = 51/95 (53%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++E+EK  K+++  KK++++      +E KKKK++     K  K  +  +K+K    N  
Sbjct:   430 KEEEEKKKKEEEEKKKKEEEEKKKQEEEEKKKKEE---EEK--KKQEEGEKMK----NE- 479

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNK---DERKKKR 351
             DE+ KK+  E       ++  KQ   NK   DE KKK+
Sbjct:   480 DEENKKNEDEEKKKNEEEEKKKQEEKNKKNEDEEKKKQ 517

 Score = 81 (28.5 bits), Expect = 1.1, P = 0.66
 Identities = 25/100 (25%), Positives = 51/100 (51%), Frame = +1

Query:    61 VLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGIN 240
             +L++   +  K+K+ ++K+ K+     +KE ++KKKK     K  +  +   K +     
Sbjct:   394 LLEERKRREKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKK 453

Query:   241 RIDEKQKKSYLENIP----GGRIKKLNKQINDNKDERKKK 348
             + +E++KK   E       G ++K  +++   N+DE KKK
Sbjct:   454 QEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEEKKK 493


>pir||A54503 51k merozoite surface antigen - Plasmodium falciparum (strain
            FCQ-27/PNG) (fragment) >gi|160090 (M18825) antigen QF122
            [Plasmodium falciparum]
            Length = 149

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.0071, P = 0.0071
 Identities = 31/91 (34%), Positives = 43/91 (47%), Frame = +1

Query:    73 EDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDE 252
             E+  + K KD+ K  D+KN    +K+    KKK     K  K  D +DK+   G N  D+
Sbjct:    42 EENCVIKSKDVVKGGDQKNEGQAKKKNNNNKKK-----KGTKEND-MDKINQSG-NTNDD 94

Query:   253 KQKKSYLENIPGGRIKK--LNKQINDNKDERKK 345
             K+K +      G    K   NK+   NKDE  K
Sbjct:    95 KKKANKNNTTEGNEKNKGSNNKKYVGNKDENMK 127


>pir||S51911 cryptogene protein G5(ND3) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 89

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.0083, P = 0.0083
 Identities = 20/58 (34%), Positives = 35/58 (60%), Frame = -2

Query:   261 FLFFINTINSHVF*FVYIIYML--QYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFI 88
             F+ F + I   +F  V ++Y +   +FV    F F+FL+F SI  +I+  +LFV++F  +
Sbjct:    20 FVMFYSIIGLILFLIVVVLYFMCKLFFVW---FCFVFLLFWSIVFNIWFCVLFVFIFFLL 76

 Score = 64 (22.5 bits), Expect = 1.0, P = 0.64
 Identities = 17/59 (28%), Positives = 34/59 (57%), Frame = -3

Query:   257 CFSSIRLIPTYFNLSILSICFNILLEIIYFF--FFFLYSFLFVDIFFLSSFLSMSFC-LS 87
             CF+ +     ++  SI+ +   +++ ++YF    FF++ F FV + F S   ++ FC L 
Sbjct:    13 CFAVLLCFVMFY--SIIGLILFLIVVVLYFMCKLFFVW-FCFVFLLFWSIVFNIWFCVLF 69

Query:    86 IF 81
             +F
Sbjct:    70 VF 71

 Score = 62 (21.8 bits), Expect = 3.6, P = 0.97
 Identities = 17/61 (27%), Positives = 33/61 (54%), Frame = -1

Query:   226 ILICLYYLYASIFCWK*YISFSFSYIPFYLLTYFSCPPFCLCLFVYRFFHLLVVVQPYYH 47
             I++ LY++    F W     F F ++ F+ + +     FC+ LFV+ FF LL+++   + 
Sbjct:    34 IVVVLYFMCKLFFVW-----FCFVFLLFWSIVFNIW--FCV-LFVFIFF-LLILINSVFS 84

Query:    46 H 44
             +
Sbjct:    85 Y 85


>sp|Q37355|COX3_TRYBO CYTOCHROME C OXIDASE POLYPEPTIDE III >gi|576731 (U14181)
            cytochrome c oxidase subunit III [Trypanoplasma borreli]
            Length = 286

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.0097, P = 0.0097
 Identities = 26/102 (25%), Positives = 49/102 (48%), Frame = -3

Query:   314 CLFSFLILPPGIFSK*LFFCFSSIRLIPTYF-NLS--ILSICFNILLEIIYFFFFFLYSF 144
             C   F+     +F    +  +S   LI   F N+   + +   NI+L++ Y F++FL+ F
Sbjct:    89 CFLWFVFSEFMLFVVFFYTLYSECLLINVEFTNIGCPVTTKYSNIILDLGYIFYWFLFDF 148

Query:   143 LFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFI 18
               + +  +  F+S   C ++ SS  C   +LS +I    +F+
Sbjct:   149 FNIILNTVYLFISGLCCNNVLSSILCREYLLSKIILGSSIFL 190


>pir||S72692 probable membrane protein Q0320 - yeast (Saccharomyces cerevisiae)
            mitochondrion (SGC2)
            Length = 103

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.011, P = 0.011
 Identities = 23/76 (30%), Positives = 40/76 (52%), Frame = -1

Query:   352 FSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFVFHQYD*FPRILICLYYLYASIFCWK*Y 173
             F    F++ + LF++L F S+ + +F NNF F+        R+L+ +  L  S+F     
Sbjct:    28 FMLLLFNITFMLFIFLLFMSNNM-FFNNNFLFINESN----RLLMMMLLLLLSLFIIDKI 82

Query:   172 ISFSFSYIPFYLLTYF 125
             +  +F++I FY   YF
Sbjct:    83 MFNNFNFIIFYF--YF 96


>gnl|PID|e321505 (Y10687) purine NTPase [Sulfolobus acidocaldarius]
            Length = 886

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.017, P = 0.016
 Identities = 22/95 (23%), Positives = 58/95 (61%), Frame = +1

Query:    64 LQQEDEKIDKQKDIDKKEDK-KNMSTNRKEYKKKKKKYIISNKILKHI-DNIDKLK--YV 231
             L+++ EK+ ++K++++KE + + +   +KE ++K+K+Y    K L ++  NI++ K    
Sbjct:   318 LKRKKEKLKRKKELEEKEKQYEEIEKRKKELEEKEKQYEEIEKRLTYVLKNIERQKNEIE 377

Query:   232 GINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDER 339
              +N +D +  ++ ++++   RI +++ ++    D R
Sbjct:   378 KLNYVDTQDLENKIKDV-SDRINQIDNELKGLLDRR 412

 Score = 86 (30.3 bits), Expect = 0.17, P = 0.16
 Identities = 28/112 (25%), Positives = 61/112 (54%), Frame = +1

Query:    64 LQQEDEKIDKQKDIDKKEDK-KNMSTNRKEYKKKKKKYIISNK----ILKHIDN----ID 216
             L+++ EK+ ++K++++KE + + +   +KE ++K+K+Y    K    +LK+I+     I+
Sbjct:   318 LKRKKEKLKRKKELEEKEKQYEEIEKRKKELEEKEKQYEEIEKRLTYVLKNIERQKNEIE 377

Query:   217 KLKYVGINRIDEKQKK-----SYLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
             KL YV    ++ K K      + ++N   G + +    +N  K++  K   N+
Sbjct:   378 KLNYVDTQDLENKIKDVSDRINQIDNELKGLLDRRG-DLNGRKEQTLKIYNNL 429


>pir||A45612 ATPase 6 - Sauroleishmania tarentolae >gi|340586 (M33229) ATPase 6
            [Leishmania tarentolae] >gi|340615 (L07543) MURF4 [Leishmania
            tarentolae]
            Length = 232

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.017, P = 0.017
 Identities = 31/100 (31%), Positives = 50/100 (50%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRL-----IPTYFNLSILSICF 195
             IF ++ F+  L  FICL+  L    G+    +++C + + +     I   + ++ L  CF
Sbjct:    45 IFDVYLFVG-LCMFICLWFVLFNFYGLI---VYYCITYLNVYILFCIVFMYYMAFL-FCF 99

Query:   194 NILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCST 60
               LL+ I  F   L    F+D+FFL   L +  C S+    C ST
Sbjct:   100 CFLLDFI-LFGSLLVGDAFMDVFFLRYLLCVLECFSLLCR-CIST 142

 Score = 78 (27.5 bits), Expect = 0.85, P = 0.57
 Identities = 26/93 (27%), Positives = 43/93 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             F+  FFL  LL  +  FS L      F +   FC     L+ ++F +  L  C  +   I
Sbjct:   117 FMDVFFLRYLLCVLECFSLLCRCISTFLR--MFC----NLLSSHFLM--LMFCDFVYFFI 168

Query:   176 IYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFS 78
             I+F FF +  F++  IF  +    + F L +++
Sbjct:   169 IFFLFFIMCDFIYFIIFTFAMLFCIIFYLFLYA 201

 Score = 77 (27.1 bits), Expect = 1.3, P = 0.72
 Identities = 21/66 (31%), Positives = 35/66 (53%), Frame = -2

Query:   267 TFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLF- 91
             TF   F N ++SH     +++ M   FV    F  +F +F  +C  I+ ++ F +  LF 
Sbjct:   142 TFLRMFCNLLSSH-----FLMLMFCDFV---YFFIIFFLFFIMCDFIYFII-FTFAMLFC 192

Query:    90 IDFFIFL 70
             I F++FL
Sbjct:   193 IIFYLFL 199

 Score = 74 (26.0 bits), Expect = 3.3, P = 0.96
 Identities = 32/96 (33%), Positives = 45/96 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFC--FSSIRLIPTYFNLS---ILSICFN 192
             F+  FFL  LL  +  FS L      F +   FC   SS  L+  + +     I+   F 
Sbjct:   117 FMDVFFLRYLLCVLECFSLLCRCISTFLR--MFCNLLSSHFLMLMFCDFVYFFIIFFLFF 174

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFC--LSIF 81
             I+ + IYF  F  ++ LF  IF+L  +    FC  L IF
Sbjct:   175 IMCDFIYFIIF-TFAMLFCIIFYLFLYALDMFCALLQIF 212


>gi|457146 (L27838) rhoptry protein [Plasmodium yoelii]
           Length = 2269

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.018, P = 0.017
 Identities = 32/107 (29%), Positives = 57/107 (53%), Frame = +1

Query:    40 ISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKH--IDNI 213
             I+DD M V QQ D+ I+   DI KK +   +S  +++  K +K   +SN  + +  ++ I
Sbjct:   625 INDDIMAVSQQIDQHINGLDDIQKKSESY-VSEMKEQINKLEK---VSNTEISNDNVEGI 680

Query:   214 DKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
              K + + + +ID+K  K+  E I    + +++K   DN    K K  N+
Sbjct:   681 KKKQQIIVTKIDKK--KNIYEEI-NKLLSEISKIEKDNTSLEKVKDINL 726


>gnl|PID|d1012343 (D83006) gene required for phosphoylation of
            oligosaccharides/ has high homology with YJR061w [Saccharomyces
            cerevisiae]
            Length = 1178

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.018, P = 0.018
 Identities = 26/94 (27%), Positives = 51/94 (54%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++E+EK  K+++  KK++++      +E KKKK++     K  K  +   K +     + 
Sbjct:  1045 KEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEE---EEKKKKEEEEKKKQEEEEKKKK 1101

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             +E++KK   E   G ++K  +++   N+DE KKK
Sbjct:  1102 EEEEKKKQEE---GEKMKNEDEENKKNEDEEKKK 1132

 Score = 90 (31.7 bits), Expect = 0.029, P = 0.029
 Identities = 26/94 (27%), Positives = 52/94 (55%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++++E+  K+K+ ++K+ K+     +KE ++KKKK     K  K  +   K +     + 
Sbjct:  1043 KKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKK-KKEEEEKKKQEEEEKKKK 1101

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             +E++KK   E   G ++K  +++   N+DE KKK
Sbjct:  1102 EEEEKKKQEE---GEKMKNEDEENKKNEDEEKKK 1132

 Score = 84 (29.6 bits), Expect = 0.77, P = 0.54
 Identities = 23/96 (23%), Positives = 53/96 (55%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK-YIISNKILKHIDNIDKLKYVGINR 243
             ++E+EK  K+++  KK++++      +E KKK+++   + N+  ++  N D+ K      
Sbjct:  1077 KEEEEKKKKEEEEKKKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEEKKKNEEE 1136

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
               +KQ++   +N    + K+  ++   N++E KKK+
Sbjct:  1137 EKKKQEEKNKKNEDEEKKKQEEEEKKKNEEEEKKKQ 1172

 Score = 81 (28.5 bits), Expect = 2.7, P = 0.93
 Identities = 30/95 (31%), Positives = 51/95 (53%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++E+EK  K+++  KK++++      +E KKKK++     K  K  +  +K+K    N  
Sbjct:  1069 KEEEEKKKKEEEEKKKKEEEEKKKQEEEEKKKKEE---EEK--KKQEEGEKMK----NE- 1118

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNK---DERKKKR 351
             DE+ KK+  E       ++  KQ   NK   DE KKK+
Sbjct:  1119 DEENKKNEDEEKKKNEEEEKKKQEEKNKKNEDEEKKKQ 1156

 Score = 81 (28.5 bits), Expect = 2.7, P = 0.93
 Identities = 25/100 (25%), Positives = 51/100 (51%), Frame = +1

Query:    61 VLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGIN 240
             +L++   +  K+K+ ++K+ K+     +KE ++KKKK     K  +  +   K +     
Sbjct:  1033 LLEERKRREKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKK 1092

Query:   241 RIDEKQKKSYLENIP----GGRIKKLNKQINDNKDERKKK 348
             + +E++KK   E       G ++K  +++   N+DE KKK
Sbjct:  1093 QEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEEKKK 1132


>gi|501027 (U01849) ORF2 [Trypanosoma brucei]
           Length = 141

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.019, P = 0.019
 Identities = 23/80 (28%), Positives = 41/80 (51%), Frame = -2

Query:   354 CSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNN 175
             C + + FIF   + F+  F    +Y+  + FF  F   +        ++IY L  F+   
Sbjct:    68 CDVIILFIFF--FYFVLCFLYCCFYLVCLVFFCIFCCVL------CYFLIYFLCCFLFWV 119

Query:   174 IFLFLFLIFLSIC*HIFLVL 115
             +FLFLF  F+ +C +++L+L
Sbjct:   120 VFLFLFFFFVYVCFYLWLLL 139

 Score = 82 (28.9 bits), Expect = 0.040, P = 0.039
 Identities = 36/118 (30%), Positives = 51/118 (43%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIY 171
             +FFF      FI     L    GIF     FCF  +  +   F   ++ +CF +L  ++ 
Sbjct:     3 IFFF------FIWCVCVLCTVYGIFYCCFVFCFCCL-FVWVCFICFVIVVCFFLLFWVVI 55

Query:   170 FFFFF---LYSF-----LFVDIF-FLSSFLSMSF---CLSIFSSSCCSTTILSSLIDVCG 27
             F++ F   +Y F     LF+  F F+  FL   F   CL  F   CC           C 
Sbjct:    56 FYWCFDCIVYFFCDVIILFIFFFYFVLCFLYCCFYLVCLVFFCIFCCVLCYFLIYFLCCF 115

Query:    26 LFIMV 12
             LF +V
Sbjct:   116 LFWVV 120

 Score = 81 (28.5 bits), Expect = 0.078, P = 0.075
 Identities = 33/109 (30%), Positives = 54/109 (49%), Frame = -2

Query:   354 CSLFL--SFI-FIIIYLFI*LFNPPPWY-IFQITFFLFFINTINSHVF*FVYII---YML 196
             C LF+   FI F+I+  F  LF    +Y  F    + FF + I   +F F +++   Y  
Sbjct:    30 CCLFVWVCFICFVIVVCFFLLFWVVIFYWCFDCIVY-FFCDVIILFIFFFYFVLCFLYCC 88

Query:   195 QYFVGNNIF------LFLFLIFLSIC*HIFLVLLFVYVF-LFIDFFIFLL 67
              Y V    F      L  FLI+   C   ++V LF++ F +++ F+++LL
Sbjct:    89 FYLVCLVFFCIFCCVLCYFLIYFLCCFLFWVVFLFLFFFFVYVCFYLWLL 138

 Score = 79 (27.8 bits), Expect = 0.15, P = 0.14
 Identities = 31/103 (30%), Positives = 41/103 (39%), Frame = -3

Query:   320 FICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIYFFFFFLYSFL 141
             F C F F      +F    F CF  +      F + I   CF+    I+YFF   +  F+
Sbjct:    21 FYCCFVFCFCC--LFVWVCFICFVIVVCFFLLFWVVIFYWCFDC---IVYFFCDVIILFI 75

Query:   140 FVDIFFLSSFLSMSF---CLSIFSSSCCSTTILSSLIDVCGLFIMV 12
             F   +F+  FL   F   CL  F   CC           C LF +V
Sbjct:    76 FF-FYFVLCFLYCCFYLVCLVFFCIFCCVLCYFLIYFLCCFLFWVV 120

 Score = 69 (24.3 bits), Expect = 5.5, P = 1.0
 Identities = 22/68 (32%), Positives = 35/68 (51%), Frame = -3

Query:   353 VLFFFLSSLLSFICLFSFLI--LPPGIFSK*L-FFCFSSIRLIPTYFNLSILSICFNILL 183
             +++FF   ++ FI  F F++  L    +   L FFC     L   YF +  L  CF   +
Sbjct:    63 IVYFFCDVIILFIFFFYFVLCFLYCCFYLVCLVFFCIFCCVLC--YFLIYFLC-CFLFWV 119

Query:   182 EIIYFFFFFLY 150
               ++ FFFF+Y
Sbjct:   120 VFLFLFFFFVY 130

 Score = 69 (24.3 bits), Expect = 5.7, P = 1.0
 Identities = 25/95 (26%), Positives = 41/95 (43%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C+++  F    ++ F  LF    W  F I F +     +   V  F +    + YF  +
Sbjct:    14 LCTVYGIFYCCFVFCFCCLF---VWVCF-ICFVIVVCFFLLFWVVIFYWCFDCIVYFFCD 69

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIF 73
              I LF+F  +  +C   FL   F Y+   + F IF
Sbjct:    70 VIILFIFFFYFVLC---FLYCCF-YLVCLVFFCIF 100


>gi|1439631 (U64598) coded for by C. elegans cDNA yk88a8.5; coded for by C.
            elegans cDNA yk112b11.5; coded for by C. elegans cDNA yk11a10.5;
            coded for by C. elegans cDNA yk11a10.3; coded for by C. elegans
            cDNA yk112b11.3; coded for by C. elegans cDNA yk...
            Length = 1257

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.025, P = 0.024
 Identities = 32/110 (29%), Positives = 54/110 (49%), Frame = +1

Query:    22 NRPHTSISDDNMVVLQQEDEKID--KQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKIL 195
             NR  +  SDDN +  +++  K D  K+K+ +KK++K+   +   E   K+K      KI 
Sbjct:   958 NRSESD-SDDNSLKKEKKHRKEDHPKEKEKEKKKEKEQEKSTDSEKDLKRKIEAPIEKIR 1016

Query:   196 KHIDNIDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
                      KY  IN  +E  KK + +   G + +K +K  +D+ D   KK+
Sbjct:  1017 IKFSGEPSEKYRKIN--EEPPKKEHRDK--GRKEEKSHKHRSDDDDSSPKKK 1064


>gi|160409 (M69183) mature-parasite-infected erythrocyte surface antigen
           [Plasmodium falciparum]
           Length = 1510

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.039, P = 0.038
 Identities = 26/88 (29%), Positives = 49/88 (55%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E E++ +++++ +KE+ K   T  K+ + +++K     K +K  D  +K K +G   I 
Sbjct:   924 KEKEEVKEKEEVKEKEEVKEKDTESKDKEIEQEKEKEEVKEVKEKDTENKDKVIGQEIII 983

Query:   250 EKQKKSYLENIPGGRIKKLNKQINDNKD 333
             E+ KK   +     R+KK N + N+NKD
Sbjct:   984 EEIKKEVKK-----RVKKRNNK-NENKD 1005

 Score = 85 (29.9 bits), Expect = 0.53, P = 0.41
 Identities = 27/122 (22%), Positives = 63/122 (51%), Frame = +1

Query:    19 MNRPHTSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILK 198
             +N   T+ + D ++  ++E E++ +++++ +KE+ K      KE ++ K+K  +  K  +
Sbjct:  1017 VNEKDTA-NKDKVIEQEKEKEEVKEKEEVKEKEEVKEKE-EVKEKEEVKEKEEVKEKDTE 1074

Query:   199 HIDNI--DKLKYVGINRIDEKQKKSYL------ENIPGGRIKKLNKQIND--NKDERKKK 348
               DN+   ++    +N  D + K   +      E +     K++NK++N   N+  RK +
Sbjct:  1075 SRDNVIVQEIMNEDVNEKDTESKDKMIGKEVIIEEVKEEVKKRVNKEVNKRVNRRNRKNE 1134

Query:   349 RTNM 360
             R ++
Sbjct:  1135 RKDV 1138

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.63
 Identities = 31/111 (27%), Positives = 62/111 (55%), Frame = +1

Query:    43 SDDNMVVLQQED----EKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKY--IISNKIL--K 198
             S+D   + +QE+    E  ++ KD DK E+ +  + N+K+ KKKKK +  ++    L  K
Sbjct:   389 SEDPKKLTEQEENGTKESSEETKD-DKPEENEKKADNKKKSKKKKKSFFQMLGCNFLCNK 447

Query:   199 HIDNIDKLKYVGINRIDEKQKKSYLE--NIPGGRIKKLNKQIND-NKDERKKK 348
             +I+  D+ + + + + D K+K  +L   N      +K +K + + +K++ K+K
Sbjct:   448 NIETDDEEETLVV-KDDAKKKHKFLREANTEKNDNEKKDKLLGEGDKEDVKEK 499


>pir||A45605 mature-parasite-infected erythrocyte surface antigen MESA -
            Plasmodium falciparum
            Length = 1526

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.039, P = 0.038
 Identities = 26/88 (29%), Positives = 49/88 (55%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E E++ +++++ +KE+ K   T  K+ + +++K     K +K  D  +K K +G   I 
Sbjct:   940 KEKEEVKEKEEVKEKEEVKEKDTESKDKEIEQEKEKEEVKEVKEKDTENKDKVIGQEIII 999

Query:   250 EKQKKSYLENIPGGRIKKLNKQINDNKD 333
             E+ KK   +     R+KK N + N+NKD
Sbjct:  1000 EEIKKEVKK-----RVKKRNNK-NENKD 1021

 Score = 85 (29.9 bits), Expect = 0.53, P = 0.41
 Identities = 27/122 (22%), Positives = 63/122 (51%), Frame = +1

Query:    19 MNRPHTSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILK 198
             +N   T+ + D ++  ++E E++ +++++ +KE+ K      KE ++ K+K  +  K  +
Sbjct:  1033 VNEKDTA-NKDKVIEQEKEKEEVKEKEEVKEKEEVKEKE-EVKEKEEVKEKEEVKEKDTE 1090

Query:   199 HIDNI--DKLKYVGINRIDEKQKKSYL------ENIPGGRIKKLNKQIND--NKDERKKK 348
               DN+   ++    +N  D + K   +      E +     K++NK++N   N+  RK +
Sbjct:  1091 SRDNVIVQEIMNEDVNEKDTESKDKMIGKEVIIEEVKEEVKKRVNKEVNKRVNRRNRKNE 1150

Query:   349 RTNM 360
             R ++
Sbjct:  1151 RKDV 1154

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 31/111 (27%), Positives = 62/111 (55%), Frame = +1

Query:    43 SDDNMVVLQQED----EKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKY--IISNKIL--K 198
             S+D   + +QE+    E  ++ KD DK E+ +  + N+K+ KKKKK +  ++    L  K
Sbjct:   405 SEDPKKLTEQEENGTKESSEETKD-DKPEENEKKADNKKKSKKKKKSFFQMLGCNFLCNK 463

Query:   199 HIDNIDKLKYVGINRIDEKQKKSYLE--NIPGGRIKKLNKQIND-NKDERKKK 348
             +I+  D+ + + + + D K+K  +L   N      +K +K + + +K++ K+K
Sbjct:   464 NIETDDEEETLVV-KDDAKKKHKFLREANTEKNDNEKKDKLLGEGDKEDVKEK 515


>gi|1209842 (U45423) minus strand repeat motif-containing gene [Borrelia
            burgdorferi]
            Length = 150

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.052, P = 0.051
 Identities = 29/96 (30%), Positives = 44/96 (45%), Frame = -3

Query:   326 LSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIYFFFFFLYS 147
             + F    S LI  P IF +  FF   SI ++ +   +SIL+  F     I+       + 
Sbjct:    30 IKFFSTLSILIFKPSIF-RFKFFSTLSILVLSSLLTVSILTCKFFSTASILMSKLDISFC 88

Query:   146 FLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLI 39
               F  +   +S L +SFC   FS+   S  +LSSL+
Sbjct:    89 KFFSTVSIFASKLDISFC-KFFST--LSILVLSSLL 121


>pir||B30010 hypothetical ORF-5 protein - Sauroleishmania tarentolae
            mitochondrion (SGC6)
            Length = 105

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.058, P = 0.057
 Identities = 24/78 (30%), Positives = 46/78 (58%), Frame = -2

Query:   285 WYIFQITFFLF-FI-NTINSHVF*FVYII-YMLQYFVGNNIFLFLFLIFLSIC*HIFLVL 115
             W+ F + F L+ F+ + +    F FV+++ + L+ F  + +F+ LF++F  +       L
Sbjct:    22 WW-FDLDFILYDFVFDFVVCITFIFVFVLGFFLRIFF-SFVFVLLFIVFFGL-----FSL 74

Query:   114 LFVYVFLFIDFFIFLL*YNHI 52
              F+Y   FI ++I++L YN I
Sbjct:    75 SFLYTGYFI-YYIYIL-YNFI 93

 Score = 70 (24.6 bits), Expect = 0.88, P = 0.58
 Identities = 20/73 (27%), Positives = 35/73 (47%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFN-ILLE 180
             F+L+ F+   +  +C+    +   G F + +FF F  + L   +F L  LS  +    + 
Sbjct:    28 FILYDFVFDFV--VCITFIFVFVLGFFLR-IFFSFVFVLLFIVFFGLFSLSFLYTGYFIY 84

Query:   179 IIYFFFFFL-YSFLF 138
              IY  + F+ Y F F
Sbjct:    85 YIYILYNFICYFFCF 99

 Score = 67 (23.6 bits), Expect = 3.0, P = 0.95
 Identities = 23/62 (37%), Positives = 33/62 (53%), Frame = -3

Query:   257 CFSSIRLIPTYFNLSIL-SICFNILLEIIYFFFF---FLYSFLFVD-IFFLSSFLSMSFC 93
             C + I +    F L I  S  F +LL I++F  F   FLY+  F+  I+ L +F+   FC
Sbjct:    40 CITFIFVFVLGFFLRIFFSFVF-VLLFIVFFGLFSLSFLYTGYFIYYIYILYNFICYFFC 98

Query:    92 LSI 84
              SI
Sbjct:    99 FSI 101

 Score = 65 (22.9 bits), Expect = 6.0, P = 1.0
 Identities = 18/57 (31%), Positives = 27/57 (47%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNI 189
             +FVL FFL    SF+ +  F++   G+FS    +    I  I   +N      CF+I
Sbjct:    46 VFVLGFFLRIFFSFVFVLLFIVFF-GLFSLSFLYTGYFIYYIYILYNFICYFFCFSI 101


>gi|527431 (Z35663) T04A8.13 [Caenorhabditis elegans]
           Length = 762

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.075, P = 0.072
 Identities = 31/94 (32%), Positives = 48/94 (51%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             + E EK +K+K   K+E+KK     +KE KK+ KK    N   K     DK +    ++ 
Sbjct:    70 EAEKEKNEKEK---KEEEKKEDGHEKKEDKKEDKKEN-ENDEKKEKSKDDKKEE---SKE 122

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             D+K+K    +N      KK  K+  + KDE++KK
Sbjct:   123 DKKEKTKTEDNEGKNEEKKKEKK-EEKKDEKEKK 155

 Score = 83 (29.2 bits), Expect = 0.70, P = 0.50
 Identities = 32/95 (33%), Positives = 49/95 (51%), Frame = +1

Query:    64 LQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINR 243
             LQ E  ++ K ++ DK+E +K    N KE K+++KK     K  K     DK +    N 
Sbjct:    53 LQDEFAELKKDEEKDKEEAEKEK--NEKEKKEEEKKEDGHEK--KEDKKEDKKE----NE 104

Query:   244 IDEKQKKSY---LENIPGGRIKKLNKQINDNKDERKKK 348
              DEK++KS     E     + +K   + N+ K+E KKK
Sbjct:   105 NDEKKEKSKDDKKEESKEDKKEKTKTEDNEGKNEEKKK 142


>gi|496191 (L19858) NADH dehydrogenase [Planicephalus flavicosta]
           Length = 46

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.075, P = 0.072
 Identities = 14/28 (50%), Positives = 20/28 (71%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  ICF ILL+++ F+ FFL S+
Sbjct:    19 YLPLSLNYICFFILLKLVCFYHFFLXSY 46


>pir||S51908 cryptogene protein G1(ND9) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 196

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.076, P = 0.074
 Identities = 31/95 (32%), Positives = 43/95 (45%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFC-FSSIRLIPTYFNLSILSICFNILL 183
             +FV FF    +  F  L+ FL+    +F   + FC F  +R I  Y  L  L +CF +  
Sbjct:    45 LFVCFFLFFVMFLFFNLWFFLLYCLDLFC--IDFCGFCFVRFILIYV-LFCLLLCFRVSF 101

Query:   182 EIIYFFFFF--LYSFLFVD----IFFLSSF--LSMSFC 93
              +I FF FF  ++S  F      IF    F      FC
Sbjct:   102 VLICFFLFFGLVFSLFFCSYALCIFEREVFDLFGFVFC 139

 Score = 81 (28.5 bits), Expect = 0.19, P = 0.18
 Identities = 30/90 (33%), Positives = 44/90 (48%), Frame = -3

Query:   359 IFVLFFFLSSL-LSF--ICLFSFLILPPGIFSK*LFFCFSSIRLIPT-YFNLSILSICFN 192
             I+VLF  L    +SF  IC F F  L   +FS  LFFC  ++ +     F+L     C N
Sbjct:    87 IYVLFCLLLCFRVSFVLICFFLFFGL---VFS--LFFCSYALCIFEREVFDLFGFVFCGN 141

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCL 90
               L   Y  +FF+  F    ++ L     ++FC+
Sbjct:   142 DCLHRFYVDWFFV-GFFLCKVYPLFGLFMLNFCM 174

 Score = 73 (25.7 bits), Expect = 3.4, P = 0.97
 Identities = 22/82 (26%), Positives = 37/82 (45%), Frame = -3

Query:   311 LFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIYFFFFFLYSFLFVD 132
             +F FLI+   +F   LFFC    R +   F      +CF +    ++F+ F  +   FV 
Sbjct:     7 MFLFLIMFRCVFVLLLFFCLCC-RWV---F------LCF-VDCSFVFFYLFVCFFLFFVM 55

Query:   131 IFFLSSFLSMSFCLSIFSSSCC 66
               F + +  + +CL +F    C
Sbjct:    56 FLFFNLWFFLLYCLDLFCIDFC 77


>gi|495719 (L19837) NADH dehydrogenase [Amblysellus grex] >gi|495767 (L19843)
           NADH dehydrogenase [Deltazotus obesus] >gi|495837 (L19850) NADH
           dehydrogenase [Graminella nigrifrons] >gi|496185 (L19859) NADH
           dehydrogenase [Polyamia neoyavapai]
           Length = 46

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.096, P = 0.091
 Identities = 14/28 (50%), Positives = 20/28 (71%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  ICF ILL+++ F+ FFL S+
Sbjct:    19 YLPLSLNYICFFILLKLLCFYHFFLXSY 46


>gi|456389 (U05816) 3'-end [Crithidia fasciculata]
           Length = 95

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.12, P = 0.11
 Identities = 25/84 (29%), Positives = 42/84 (50%), Frame = -3

Query:   245 IRLIPTYFNLSILSIC---FNIL-LEIIYFFFF------FLYSFLFVDIFFLSSFLSMSF 96
             I++     +LS L +C   F+++ L IIY F+F      F++S+ F+  + +   +   F
Sbjct:    11 IKVFCLLLHLSYLGVCVVFFSVIWLVIIYIFYFRLIINVFIFSYQFIGFWVVRLHIIGLF 70

Query:    95 CLSIFSSSCCSTTILSSLIDVCGLFIMV 12
              L  F S C    I     D+  LF +V
Sbjct:    71 NLLFFLSWC----IFILFFDIINLFDLV 94


>gi|495764 (L19838) NADH dehydrogenase [Deltocephalus fuscinervosus] >gi|496285
           (L19864) NADH dehydrogenase [Unoka sp.]
           Length = 46

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.12, P = 0.11
 Identities = 14/28 (50%), Positives = 20/28 (71%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  ICF ILL+++ F+ FFL S+
Sbjct:    19 YLPLSLNYICFFILLKLMCFYHFFLXSY 46


>pir||A25877 cytochrome-c oxidase (EC 1.9.3.1) chain III - Crithidia
            fasciculata mitochondrion (SGC6) (fragment)
            Length = 287

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.12, P = 0.12
 Identities = 27/97 (27%), Positives = 50/97 (51%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C  F +F+F+I  +F  L      Y F   F+ +FI+  N  +    +++++   FV  
Sbjct:   114 VCVEF-AFVFVIPVMFCCLICD---YGF--VFYWYFIDVFNLLIN--TFLLFVSGLFVNF 165

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
              +FLF F  FL +   ++  +LF ++FL+   + F L
Sbjct:   166 VLFLFWFRFFLCVLFVLWSAILFGFLFLWNQVWEFAL 202

 Score = 77 (27.1 bits), Expect = 1.8, P = 0.84
 Identities = 26/104 (25%), Positives = 51/104 (49%), Frame = -2

Query:   348 LFLSFIFIIIYL-------FI*LFNPPPWYI-----FQITFFLFFINTINSHVF*FVYII 205
             LF+SF +++  L       F  +F  P  +      +   F+ +FI+  N  +    +++
Sbjct:    99 LFISFFYVVFSLVLFVCVEFAFVFVIPVMFCCLICDYGFVFYWYFIDVFNLLIN--TFLL 156

Query:   204 YMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             ++   FV   +FLF F  FL +   ++  +LF ++FL+   + F L
Sbjct:   157 FVSGLFVNFVLFLFWFRFFLCVLFVLWSAILFGFLFLWNQVWEFAL 202


>gi|2622329 (AE000889) unknown [Methanobacterium thermoautotrophicum]
            Length = 232

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.13, P = 0.12
 Identities = 30/102 (29%), Positives = 60/102 (58%), Frame = +1

Query:    55 MVVLQQEDEKIDKQ-KDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYV 231
             MV++ Q+ + + +Q K ++++ ++ N+S   KEY+  +++Y    + L+ ++NI +L+  
Sbjct:    27 MVMISQDKKMLLRQLKKLEREREEGNIS--EKEYRSLREQYTRELETLEAVENIRRLQ-- 82

Query:   232 GINRIDEKQKKSYLENIPGGRIKKLNKQIND------NKDE-RKKKRTNM 360
             G     EK    ++E     RIKK  K+  +        DE R++KR N+
Sbjct:    83 G-QETPEKPLDHWVEE---SRIKKDRKEKEELIEKYVRTDETRRRKRPNL 128


>gi|495761 (L19842) NADH dehydrogenase [Daltonia sp.]
           Length = 46

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 0.16, P = 0.14
 Identities = 13/28 (46%), Positives = 20/28 (71%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  +S+  ICF ILL+++ F+ FFL S+
Sbjct:    19 YLPMSLNYICFFILLKVMCFYHFFLXSY 46


>gi|2072771 (U47023) unknown [Methanococcus maripaludis]
            Length = 83

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 0.16, P = 0.14
 Identities = 29/66 (43%), Positives = 37/66 (56%), Frame = -3

Query:   341 FLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPT---YFNL-SILSICFNILLEII 174
             F ++  SF C  SF IL   I S  LF   SS  L P+   +F+  S+ SI F ILL I+
Sbjct:    17 FPNNSKSFKC--SFTIL--SILSSLLFILVSSAVLSPSIIVFFSFPSLFSIVFLILLNIL 72

Query:   173 YF-FFFFLYS 147
                F F L+S
Sbjct:    73 PTPFLFLLFS 82


>gi|1255424 (U53154) C33G8.3 gene product [Caenorhabditis elegans]
            Length = 142

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.17, P = 0.15
 Identities = 16/35 (45%), Positives = 23/35 (65%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK 171
             + EDE+ ++ KD  KK+ KKN  +  +E KKK KK
Sbjct:    86 KDEDEEEEEDKDKKKKDKKKNKDSEEEEDKKKDKK 120

 Score = 74 (26.0 bits), Expect = 1.1, P = 0.66
 Identities = 19/88 (21%), Positives = 48/88 (54%), Frame = +1

Query:    94 QKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQKKSYL 273
             + ++D + D   M     +  K+   + +  K+ + ++ ++K+K    ++I+E ++K   
Sbjct:    22 EDNVDLESDVAEMEGAELDRVKRASDHKLEKKLDEIMEKVEKIK----DKIEENKEKREK 77

Query:   274 ENIPGGRIKKLNKQINDNKDERKK-KRTN 357
             +N   G  K  +++  ++KD++KK K+ N
Sbjct:    78 KNKKKGNKKDEDEEEEEDKDKKKKDKKKN 106


>pir||S49423 hypothetical protein - Lactobacillus helveticus >gi|558228
            (X81980) pid:g558228 [Lactobacillus helveticus]
            Length = 142

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.17, P = 0.15
 Identities = 26/77 (33%), Positives = 45/77 (58%), Frame = +1

Query:    49 DNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKE-YKKKKKKYIISNKILKHIDNIDKLK 225
             D+ VVL+ E+++  K+ + +KKED   +ST   E +KK+ +K     +I      ID LK
Sbjct:    49 DSKVVLEIENKQQKKRIENNKKEDDAGISTTVLEIFKKQLEKK--DQQIKDQAKTIDFLK 106

Query:   226 YVGIN-RIDEKQKKSYLEN 279
                +  R+D ++K+  LE+
Sbjct:   107 GEILRARLDNQKKEKLLED 125


>gi|1825637 (U88172) ZK354.7 gene product [Caenorhabditis elegans]
            Length = 224

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.18, P = 0.16
 Identities = 29/96 (30%), Positives = 48/96 (50%), Frame = +1

Query:    58 VVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGI 237
             +  ++ DEK D++KD  K+E K+     +KE KK  KK   + K  K  +  ++ K    
Sbjct:   129 ISFKKGDEKGDEKKDEKKEEKKEEKKEEKKEDKKDDKKE--AKKEEKKEEKKEEKKEE-- 184

Query:   238 NRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKK 345
              + ++K++K   +N      KK  K+  D K E KK
Sbjct:   185 KKEEKKEEKKEEKNDENKEEKKEEKK--DEKKEEKK 218

 Score = 82 (28.9 bits), Expect = 0.18, P = 0.16
 Identities = 26/97 (26%), Positives = 48/97 (49%), Frame = +1

Query:    58 VVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGI 237
             +  ++ DEK D++KD +KKE+KK      K+  KK  K     +  K     +K +    
Sbjct:   129 ISFKKGDEKGDEKKD-EKKEEKKEEKKEEKKEDKKDDKKEAKKEEKKEEKKEEKKEEKKE 187

Query:   238 NRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
              + +EK+++   EN    + +K +++  + K E  KK
Sbjct:   188 EKKEEKKEEKNDENKEEKKEEKKDEKKEEKKVEEAKK 224

 Score = 76 (26.8 bits), Expect = 1.6, P = 0.80
 Identities = 23/70 (32%), Positives = 41/70 (58%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++ED+K DK K+  K+E K+     +KE KK++KK     K  K+ +N ++ K     + 
Sbjct:   157 KKEDKKDDK-KEAKKEEKKEEKKEEKKEEKKEEKKE--EKKEEKNDENKEEKKE---EKK 210

Query:   247 DEKQKKSYLE 276
             DEK+++  +E
Sbjct:   211 DEKKEEKKVE 220


>pir||S34960 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Crithidia
            oncopelti mitochondrion (SGC6) >gi|12882 (X56015) NADH
            dehydrogenase subunit 5 [Crithidia oncopelti]
            Length = 590

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.18, P = 0.16
 Identities = 28/99 (28%), Positives = 48/99 (48%), Frame = -2

Query:   360 HICSLFLSFIFIIIYLFI*LFNPPPW--YIFQITFFLFFINTINSHV-F*FVYIIYMLQY 190
             ++C + + F+   +Y+F+       W  Y++   FF     T+   +   F+Y   +L Y
Sbjct:   464 YMCFILIFFVIDFLYIFVFSSYCMFWSFYLYYFNFFDIASFTVFVMISLAFIYYGCVLFY 523

Query:   189 FVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             F   +  +  + IFL IC   F+  LF   + F  FFI+LL
Sbjct:   524 FFNVDCIMLFWRIFLIIC-VTFMFGLFS-CWYFACFFIYLL 562

 Score = 81 (28.5 bits), Expect = 1.2, P = 0.70
 Identities = 26/112 (23%), Positives = 48/112 (42%), Frame = -2

Query:   360 HICSLFLSFIFIIIYLFI*LFNPPPW--YIFQITFFLFFINTINSHV-F*FVYIIYMLQY 190
             ++C + + F+   +Y+F+       W  Y++   FF     T+   +   F+Y   +L Y
Sbjct:   464 YMCFILIFFVIDFLYIFVFSSYCMFWSFYLYYFNFFDIASFTVFVMISLAFIYYGCVLFY 523

Query:   189 FVGNNIFLFLFLIFLSIC*HI--------FLVLLFVYVFLFIDFFIFLL*YN 58
             F   +  +  + IFL IC           +    F+Y+ LF+  F+    YN
Sbjct:   524 FFNVDCIMLFWRIFLIICVTFMFGLFSCWYFACFFIYLLLFVWNFVIYFRYN 575

 Score = 80 (28.2 bits), Expect = 1.7, P = 0.82
 Identities = 29/98 (29%), Positives = 50/98 (51%), Frame = -1

Query:   358 YLFSFSFFHLY-YHLFVYLAF*SSPLVYFPNNFFFVFHQ--YD*FPRI--LICLYYLYAS 194
             YL+ F+FF +  + +FV +   S   +Y+    F+ F+      F RI  +IC+ +++  
Sbjct:   492 YLYYFNFFDIASFTVFVMI---SLAFIYYGCVLFYFFNVDCIMLFWRIFLIICVTFMFGL 548

Query:   193 IFCWK*YISFSFSYIPFYL---LTYFS-----CPPFCLCLFVY 89
               CW  Y +  F Y+  ++   + YF      C  FCL L +Y
Sbjct:   549 FSCW--YFACFFIYLLLFVWNFVIYFRYNLKYCLFFCLLLILY 589

 Score = 76 (26.8 bits), Expect = 6.6, P = 1.0
 Identities = 26/88 (29%), Positives = 47/88 (53%), Frame = -2

Query:   282 YIFQITFFLFFINTINSHVF*FVYIIYMLQYF-VGNNIFL-FLFLIFLSIC*HIFLVLLF 109
             ++F   FF+FF  T+  + F   ++ ++ + F + + +FL F F   L  C  + L + F
Sbjct:   411 FLFVCIFFIFF--TVIYNYFLLFFLCFVFKCFCLADCLFLLFDFECCLIYC-FLGLYMCF 467

Query:   108 VYVFLFIDF-FIFLL*YNHIIITDRCM-WSIH 19
             + +F  IDF +IF       + +  CM WS +
Sbjct:   468 ILIFFVIDFLYIF-------VFSSYCMFWSFY 492

 Score = 75 (26.4 bits), Expect = 9.0, P = 1.0
 Identities = 27/86 (31%), Positives = 40/86 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRL--IPTYFNLSILSICFNILL 183
             + L FFL  +    CL   L L    F   L +CF  + +  I  +F +  L I F +  
Sbjct:   427 YFLLFFLCFVFKCFCLADCLFLLFD-FECCLIYCFLGLYMCFILIFFVIDFLYI-F-VFS 483

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMS 99
                 F+ F+LY F F DI   + F+ +S
Sbjct:   484 SYCMFWSFYLYYFNFFDIASFTVFVMIS 511


>pir||S43597 coiled-coil protein homolog R07E5.6 - Caenorhabditis elegans
            >gi|474808 (Z32683) R07E5.6 [Caenorhabditis elegans]
            Length = 592

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.18, P = 0.16
 Identities = 29/100 (29%), Positives = 52/100 (52%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             + EDEK  K+K+   KE+K        E KKK++K     ++ K+ +    +    ++R 
Sbjct:   219 KDEDEKAKKEKERIDKEEKIKKEVEEAEKKKKEEKEKRRKEVKKNREEQLSIN-PEMSRN 277

Query:   247 DEK---QKKSYLENIPGGRIKKLNKQ--INDNKDERKKKRT 354
             D+K   ++KS L+       KK  +Q  ++  K++RK K+T
Sbjct:   278 DKKDVVEEKSCLDKGAKDAQKKKKQQDVVDKKKEKRKLKKT 318


>gi|1890780 (U88487) NADH dehydrogenase 1 [Flexamia albida]
            Length = 310

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.18, P = 0.17
 Identities = 35/119 (29%), Positives = 53/119 (44%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIF-SK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SF+  ++F +    IF S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFMSYYNFQLSLWLIFVSLPLFFCWLSCSMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS     S++ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLFFYISMVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890842 (U88518) NADH dehydrogenase 1 [Flexamia surcula]
            Length = 310

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.18, P = 0.17
 Identities = 37/119 (31%), Positives = 54/119 (45%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSI----LS 204
             I + FF L    SFI  ++F   L   + S  LFFC+ S  +     T F+ S     L 
Sbjct:   149 ILLCFFLLLDSYSFISYYNFNFSLWLILISLPLFFCWLSCSMAESNRTPFDFSEGESELV 208

Query:   203 ICFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGL 24
               FN+    + F      + LF+  +    F+SM  C+    S  CS      L+ +C L
Sbjct:   209 SGFNVEYGGVGF------ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYIKLVLMCFL 262

Query:    23 FIMVK 9
             FI V+
Sbjct:   263 FIWVR 267


>pir||S60846 M protein precursor - Streptococcus pyogenes (serotype PT4245)
            (fragment) >gi|1235824 (U11966) emml gene product [Streptococcus
            pyogenes]
            Length = 97

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.18, P = 0.17
 Identities = 21/83 (25%), Positives = 43/83 (51%), Frame = +1

Query:    94 QKDIDKKEDKKNMSTNRKEYKKKKKKYI--ISNKILKHIDNIDKLKYVGINRIDEKQKKS 267
             Q  +    D  N S + K+ +K+    I  +  +  +H+D ID+LK      +  K+K S
Sbjct:    19 QTTVKADSDNINRSVSVKDNEKELHNKIADLEEERGEHLDKIDELK----EELKAKEKSS 74

Query:   268 YLENIPGGRIKKLNKQINDNKDERK 342
               EN+    ++KL+++  + ++ +K
Sbjct:    75 --ENVERHYLRKLDQEYKEQQERQK 97


>sp|P14546|COX3_LEITA CYTOCHROME C OXIDASE POLYPEPTIDE III >pir||G22848
            cytochrome-c oxidase (EC 1.9.3.1) chain III - Sauroleishmania
            tarentolae mitochondrion (SGC6)
            Length = 284

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.18, P = 0.17
 Identities = 25/95 (26%), Positives = 49/95 (51%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             S+  +F+F+I  +F  L        F   F+ +FI+  N  +    +++++   FV   +
Sbjct:   112 SVEFAFVFVIPVMFSCLICD-----FGFVFYWYFIDIFNLLIN--TFLLFVSGLFVNFVL 164

Query:   171 FLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             FLF F  FL +   +++ +LF ++FL+   + F L
Sbjct:   165 FLFWFRFFLCVLFMLWVGILFGFLFLWNQVWEFAL 199

 Score = 75 (26.4 bits), Expect = 3.5, P = 0.97
 Identities = 35/110 (31%), Positives = 61/110 (55%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C LF+ ++ I+ + F+ L+N   W      F L F+ T +  VF  +  +  L +F  +
Sbjct:   173 LCVLFMLWVGIL-FGFLFLWNQV-W-----EFALLFV-TCSCGVFGSILFLIDLLHF--S 222

Query:   177 NIFLFLFLIFL--SIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITDRCMW 28
             ++FL +FL+FL  S C + FL +   +VFL++   + L  Y H +  D C+W
Sbjct:   223 HVFLGIFLLFLCFSRCFN-FLCMDTRFVFLYV---VCL--YWHFV--D-CVW 265

 Score = 73 (25.7 bits), Expect = 6.8, P = 1.0
 Identities = 29/97 (29%), Positives = 49/97 (50%), Frame = -2

Query:   354 CSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFL--FFINTINS--HVF*FVYII-YMLQY 190
             C +F SFIFI  Y FI  F      +F +   L   F++++     V  F+  I Y   +
Sbjct:    33 CIMFGSFIFID-YCFICFF---ACLLFCLVCLLCDLFVDSLRGLFDVCCFIRCIQYCFVW 88

Query:   189 FVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             F+ + + LFL L ++     +F+ + F +VF+    F  L+
Sbjct:    89 FIISELLLFLSLFYVVFSLVLFVSVEFAFVFVIPVMFSCLI 129


>gi|340588 (L07539) cytochrome oxidase [Leishmania tarentolae]
           Length = 287

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.19, P = 0.17
 Identities = 25/95 (26%), Positives = 49/95 (51%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             S+  +F+F+I  +F  L        F   F+ +FI+  N  +    +++++   FV   +
Sbjct:   115 SVEFAFVFVIPVMFSCLICD-----FGFVFYWYFIDIFNLLIN--TFLLFVSGLFVNFVL 167

Query:   171 FLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             FLF F  FL +   +++ +LF ++FL+   + F L
Sbjct:   168 FLFWFRFFLCVLFMLWVGILFGFLFLWNQVWEFAL 202

 Score = 75 (26.4 bits), Expect = 3.6, P = 0.97
 Identities = 35/110 (31%), Positives = 61/110 (55%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C LF+ ++ I+ + F+ L+N   W      F L F+ T +  VF  +  +  L +F  +
Sbjct:   176 LCVLFMLWVGIL-FGFLFLWNQV-W-----EFALLFV-TCSCGVFGSILFLIDLLHF--S 225

Query:   177 NIFLFLFLIFL--SIC*HIFLVLLFVYVFLFIDFFIFLL*YNHIIITDRCMW 28
             ++FL +FL+FL  S C + FL +   +VFL++   + L  Y H +  D C+W
Sbjct:   226 HVFLGIFLLFLCFSRCFN-FLCMDTRFVFLYV---VCL--YWHFV--D-CVW 268

 Score = 73 (25.7 bits), Expect = 7.0, P = 1.0
 Identities = 29/97 (29%), Positives = 49/97 (50%), Frame = -2

Query:   354 CSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFL--FFINTINS--HVF*FVYII-YMLQY 190
             C +F SFIFI  Y FI  F      +F +   L   F++++     V  F+  I Y   +
Sbjct:    36 CIMFGSFIFID-YCFICFF---ACLLFCLVCLLCDLFVDSLRGLFDVCCFIRCIQYCFVW 91

Query:   189 FVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
             F+ + + LFL L ++     +F+ + F +VF+    F  L+
Sbjct:    92 FIISELLLFLSLFYVVFSLVLFVSVEFAFVFVIPVMFSCLI 132

 Score = 72 (25.3 bits), Expect = 8.9, P = 1.0
 Identities = 21/63 (33%), Positives = 31/63 (49%), Frame = -3

Query:   218 LSILSICFNILLEIIYFFFFFLY-SFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTI--LS 48
             LS+ +IC   L   +   F  ++ SF+F+D  F+  F  + FCL       C   +  L 
Sbjct:    17 LSLPAICIVYLTFCLCGLFCIMFGSFIFIDYCFICFFACLLFCLVCL---LCDLFVDSLR 73

Query:    47 SLIDVC 30
              L DVC
Sbjct:    74 GLFDVC 79


>sp|Q58507|YB07_METJA HYPOTHETICAL PROTEIN MJ1107 >pir||B64438 hypothetical
            protein MJ1107 - Methanococcus jannaschii >gi|1499957 (U67553) M.
            jannaschii predicted coding region MJ1107 [Methanococcus
            jannaschii]
            Length = 149

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.20, P = 0.18
 Identities = 22/66 (33%), Positives = 40/66 (60%), Frame = +1

Query:    79 EKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYV--GINRIDE 252
             +K ++QK + K E K+ +   RKE   K+   +I  KIL+++DN  K+  V   IN++D+
Sbjct:    50 KKFEEQKPVLKLELKEEL---RKELTTKEDLELIGEKILRYVDN--KINQVIEKINQLDK 104

Query:   253 KQKKSYLE 276
             K  + + +
Sbjct:   105 KIDEGFYQ 112


>sp|P53911|YNN6_YEAST HYPOTHETICAL 49.4 KD PROTEIN IN NAM9-FPR1 INTERGENIC
            REGION >pir||S55147 hypothetical protein YNL136w - yeast
            (Saccharomyces cerevisiae) >gi|854501 (Z46843) orf12 [Saccharomyces
            cerevisiae] >gnl|PID|e239807 (Z71412) ORF YNL136w [Saccharomyces
            cerevisiae]
            Length = 425

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.22, P = 0.20
 Identities = 19/87 (21%), Positives = 48/87 (55%), Frame = +1

Query:    70 QEDEKIDKQKDID-KKEDKKNMST-NRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINR 243
             ++ +++ + K++  + E+K+ +   N K+ ++K+KK  I    + H + +DK K      
Sbjct:   242 RKSQRLKRSKEVKFEDEEKEEIEEDNTKDEEQKEKKEEIQEPKITHNEEVDKEKNENEEG 301

Query:   244 IDEKQKKSYLENIPGGRIKKLNKQIND 324
              DE++K +  EN  G   + +++ +++
Sbjct:   302 DDEREKSTSYENTNGSESEGVDEGVDE 328


>gi|2621149 (AE000801) unknown [Methanobacterium thermoautotrophicum]
            Length = 82

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.25, P = 0.22
 Identities = 13/21 (61%), Positives = 17/21 (80%), Frame = -2

Query:   198 LQYFVGNNIFLFLFLIFLSIC 136
             L++FV    F+F+FLIFLSIC
Sbjct:    50 LRHFVSFTEFVFIFLIFLSIC 70


>sp|Q03525|YM8H_YEAST HYPOTHETICAL 16.2 KD PROTEIN IN PRP24-RRN9 INTERGENIC
            REGION >pir||S54481 hypothetical protein YMR269w - yeast
            (Saccharomyces cerevisiae) >gi|809092 (Z49260) unknown
            [Saccharomyces cerevisiae]
            Length = 142

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.26, P = 0.23
 Identities = 26/78 (33%), Positives = 39/78 (50%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHI-DNIDKLKYVGINRI 246
             ++D K+ K+K + K +   N S ++K+ KKK KK     K  KH  D  DK K+    + 
Sbjct:    66 EDDNKV-KRKKLKKDKKTSNDSESKKKKKKKSKKESKKGKKSKHSSDEGDKSKH----KK 120

Query:   247 DEKQKKSYLENIPGGRIKK 303
              +K KK   E     R +K
Sbjct:   121 SKKSKKHKKEESSARRDRK 139


>pir||F30010 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 443

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.30, P = 0.26
 Identities = 37/110 (33%), Positives = 56/110 (50%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSIL--SICFNIL 186
             +F L F LS  L     + F IL   IF   +FF  + I LI  +    IL  S+ F I 
Sbjct:    63 VFFLIFLLSRKLVSYSKY-FYILLSYIF---IFFDVTLIILIDDFMCFMILFESLFFPIC 118

Query:   185 LEIIYFFFF--FLYSFLFVDIFF-LSSFLSMSFCLSI-FSSSCCSTTILSSLIDVC 30
                ++F F   F+++  ++ IF  LSS + +  C+ I F  +  +   L S ID+C
Sbjct:   119 FVSLFFNFNNRFIFAIFYLVIFSSLSSIMCIIICIIIIFHFNILN---LQSFIDIC 171

 Score = 77 (27.1 bits), Expect = 3.1, P = 0.96
 Identities = 23/78 (29%), Positives = 37/78 (47%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFS--SIRLIPTYF--NLSILSICFN 192
             IF+L+  +S    +IC F  ++L   + S  ++ C S  S   +  Y   +L+I  I   
Sbjct:   366 IFLLYGLISLSFIYICCFYIIVLAVFLSSIYMYMCLSFYSFIWLDKYLRLDLTINDIYLY 425

Query:   191 ILLEIIYFFFFFLYSFLF 138
              +  II   FF+L   LF
Sbjct:   426 FITSIIVILFFYLIYLLF 443

 Score = 76 (26.8 bits), Expect = 4.6, P = 0.99
 Identities = 28/102 (27%), Positives = 51/102 (50%), Frame = -2

Query:   348 LFLSFIFIIIYLFI*LFNPPPWYIF---QITFFLFFI---NTINSHVF*FVYIIYMLQYF 187
             L L F +I I +++   N   W+I+    I FFL F+     ++   + ++ + Y+  +F
Sbjct:    35 LALQFNYIYINIYLNYINL--WFIYFMGLIVFFLIFLLSRKLVSYSKYFYILLSYIFIFF 92

Query:   186 VGNNIFLFL-FLIFLSIC*HIFLVLLFVYVFL-FIDFFIFLL*Y 61
                 I L   F+ F+ +   +F  + FV +F  F + FIF + Y
Sbjct:    93 DVTLIILIDDFMCFMILFESLFFPICFVSLFFNFNNRFIFAIFY 136

 Score = 74 (26.0 bits), Expect = 8.5, P = 1.0
 Identities = 29/92 (31%), Positives = 43/92 (46%), Frame = -3

Query:   350 LFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIY 171
             L   +   + F+ LF  L  P    S  LFF F++ R I   F L I S   +I+  II 
Sbjct:    96 LIILIDDFMCFMILFESLFFPICFVS--LFFNFNN-RFIFAIFYLVIFSSLSSIMCIIIC 152

Query:   170 FFFFFLYSFL----FVDI-FFLSSFLSMSFCLSIF 81
                 F ++ L    F+DI  F S +L +   + +F
Sbjct:   153 IIIIFHFNILNLQSFIDICIFDSLYLGLYVWILLF 187


>gi|1825636 (U88172) ZK354.3 gene product [Caenorhabditis elegans]
            Length = 312

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.31, P = 0.27
 Identities = 31/95 (32%), Positives = 54/95 (56%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++EDEK+D +K  +K+E K+     +KE KK++KK     +  K+    D  K  G  + 
Sbjct:   155 KKEDEKMDDKKPGEKEEKKEEF---KKEMKKEEKKEEKKEEPKKN----DAPKKEGETK- 206

Query:   247 DEKQKKSYLENIP-----GGRIKKLNKQINDNKDERKKKR 351
              E +K + +EN P       R +K  ++ +D KDE+K ++
Sbjct:   207 GEVKKDALVEN-PIVTEMSDRDEKKEEKKDDKKDEKKDEK 245

 Score = 80 (28.2 bits), Expect = 0.71, P = 0.51
 Identities = 33/103 (32%), Positives = 54/103 (52%), Frame = +1

Query:    34 TSISDDNMVVLQQEDEKIDKQKDIDKKEDKKN-MSTNRKEYKKKKKKYIISNKILKHIDN 210
             T +SD +    +++D+K D++KD +KKE KK      +KE KK++KK     K  K  D 
Sbjct:   221 TEMSDRDEKKEEKKDDKKDEKKD-EKKEAKKEEKKEEKKEEKKEEKKE--EKKDDKKED- 276

Query:   211 IDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERK 342
              DK K    +  D+K  +   E       KK +++ N+  +E+K
Sbjct:   277 -DKEKSATKSE-DKKSDEKKTEE------KKSDEKKNEKSEEKK 312

 Score = 76 (26.8 bits), Expect = 2.8, P = 0.94
 Identities = 26/92 (28%), Positives = 49/92 (53%), Frame = +1

Query:    73 EDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDE 252
             E++K +++K+ +KKE++K     +K+ ++K  K    +K  +  D +  +K     + + 
Sbjct:    67 EEKKEEEKKEEEKKEEEKKADDEKKKTEEKDDK---KSKKTEEKDKLS-VKKTQETKSER 122

Query:   253 KQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             K KK   E     + K+ NK+   +KDE KKK
Sbjct:   123 KDKKD--ERKEDDK-KEENKE--KSKDEEKKK 149

 Score = 75 (26.4 bits), Expect = 4.1, P = 0.98
 Identities = 23/94 (24%), Positives = 53/94 (56%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKK---KKKYIISNKILKHIDNIDKLKYVGIN 240
             +++ K +++K+  K+E KKN    +KE + K   KK  ++ N I+  + + D+ K     
Sbjct:   177 KKEMKKEEKKEEKKEEPKKN-DAPKKEGETKGEVKKDALVENPIVTEMSDRDEKKE---E 232

Query:   241 RIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             + D+K+ +   E     + +K  ++  + K+E+K+++
Sbjct:   233 KKDDKKDEKKDEKKEAKKEEKKEEKKEEKKEEKKEEK 269

 Score = 75 (26.4 bits), Expect = 4.1, P = 0.98
 Identities = 25/95 (26%), Positives = 48/95 (50%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++E++K +++K+ +KK D +   T  K+ KK KK     +K+     ++ K +     R 
Sbjct:    70 KEEEKKEEEKKEEEKKADDEKKKTEEKDDKKSKKTEE-KDKL-----SVKKTQETKSERK 123

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             D+K ++   E+      K+ +K     KDE K K+
Sbjct:   124 DKKDERK--EDDKKEENKEKSKDEEKKKDEVKDKK 156

 Score = 74 (26.0 bits), Expect = 5.5, P = 1.0
 Identities = 14/34 (41%), Positives = 24/34 (70%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK 171
             ++DEK D++K+  K+E K+     +KE KK++KK
Sbjct:   237 KKDEKKDEKKEAKKEEKKEEKKEEKKEEKKEEKK 270


>gi|2196513 (U77778) putative membrane protein [Staphylococcus epidermidis]
            Length = 330

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.34, P = 0.29
 Identities = 28/100 (28%), Positives = 52/100 (52%), Frame = -2

Query:   357 ICSLFLSF-IFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVG 181
             I ++F+   + I+I+L   +FN       + +    F++   S +  ++ +   L +F+ 
Sbjct:    56 ILTMFIILSLSILIFLTFLIFNSKKLLEKEGSKLSNFLSFGLSLLLLWIIVTSPLSFFIN 115

Query:   180 NNIFLFLFLIFLSIC*HIFLVLLFVYVF-LFIDFFIFLL*YN 58
              ++  ++F+I      HIF+V LF Y F LFI  FI  L Y+
Sbjct:   116 KSLAAYIFVI------HIFIVSLFTYFFSLFISCFILSLFYS 151


>gi|1209830 (U45421) minus strand repeat motif-containing gene [Borrelia
            burgdorferi]
            Length = 143

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.35, P = 0.30
 Identities = 29/87 (33%), Positives = 43/87 (49%), Frame = -3

Query:   263 FFCFSSIRLIPTYFNLSILSICFNILLEIIYFFFFFLYSFLF--VDIFFLSSFLSMSFCL 90
             FF   SI     +  LSIL++   + L I+ F FF   S L   +DI F   F ++S   
Sbjct:    32 FFSTLSILAFKFFSTLSILALSSLLTLSILAFKFFSTVSILASKLDISFCKFFSTLSILA 91

Query:    89 SIFSSSCCSTTILSSLIDV--CGLFIMVKI 6
               F S+    +IL+S +D+  C  F  + I
Sbjct:    92 FKFFST---VSILTSKLDISFCKFFSTLSI 118

 Score = 72 (25.3 bits), Expect = 2.1, P = 0.88
 Identities = 33/97 (34%), Positives = 48/97 (49%), Frame = -3

Query:   353 VLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEII 174
             +L F   S LS + L S L L   I +   F  FS++ ++ +  ++S     F   L I+
Sbjct:    38 ILAFKFFSTLSILALSSLLTL--SILA---FKFFSTVSILASKLDISFCK--FFSTLSIL 90

Query:   173 YFFFFFLYSFLF--VDIFFLSSFLSMSFC---LSIFSSSCCS 63
              F FF   S L   +DI F   F ++S     LS F S+C S
Sbjct:    91 AFKFFSTVSILTSKLDISFCKFFSTLSILKIRLSNFISNCFS 132


>sp|Q09863|YAFA_SCHPO HYPOTHETICAL 122.9 KD PROTEIN C29E6.10C IN CHROMOSOME I
            >gi|1044936 (Z66525) unknown [Schizosaccharomyces pombe]
            Length = 1085

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.37, P = 0.31
 Identities = 23/94 (24%), Positives = 52/94 (55%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             Q+E  K  +++ + ++++KK     R++ ++K+K+     K+ K     D+ K     R+
Sbjct:   634 QEEARKKREEQRLKREQEKKQQELERQKREEKQKQKEREKKLKKQQQEADREKMAREQRL 693

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
              E+++K  LE     R +KL+K+    ++ER+++
Sbjct:   694 REEEEKRILEERK--RREKLDKE----EEERRRR 721

 Score = 78 (27.5 bits), Expect = 7.1, P = 1.0
 Identities = 24/101 (23%), Positives = 53/101 (52%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             Q+E  K  +++ + ++++KK     R++ ++K+K+     K+ K     D+ K     R+
Sbjct:   634 QEEARKKREEQRLKREQEKKQQELERQKREEKQKQKEREKKLKKQQQEADREKMAREQRL 693

Query:   247 DEKQKKSYLENIPGGRIKKLNKQ--------INDNKDERKKKR 351
              E+++K  LE     R +KL+K+        + + + E K++R
Sbjct:   694 REEEEKRILEERK--RREKLDKEEEERRRRELLEKESEEKERR 734


>pir||S61462 p83/p100 protein - Lyme disease spirochete (strain PBi) >gi|928987
            (X75213) p100 protein [Borrelia burgdorferi]
            Length = 672

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.40, P = 0.33
 Identities = 24/105 (22%), Positives = 56/105 (53%), Frame = +1

Query:    49 DNMVVLQQEDEKIDKQKD---IDKKEDKKNMSTNRKEYKKKKKKYIIS-NKI-LKHIDNI 213
             +  + +++ DE++ K KD   +D   D  + ++++++ K K+K+ +   +K+ L  +DN 
Sbjct:   360 EKQIEIKKSDEELLKSKDPKALDLNRDLNSKASSKEKIKGKEKEIVKEKSKVSLGDLDND 419

Query:   214 DKLKYVGINRIDEKQKKSYLENI-PGGRIKKLNKQINDNKDERKK 345
             + L      ++ E +K    +N+ P   I+++N+    N +E  K
Sbjct:   420 ETLMTPEDQKLSEDKKLDSKKNLKPVSEIERVNEISKSNNNEVSK 464


>gi|495843 (L19849) NADH dehydrogenase [Graminella mohri]
           Length = 46

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.41, P = 0.34
 Identities = 13/28 (46%), Positives = 19/28 (67%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  ICF I L+++ F+ FFL S+
Sbjct:    19 YLPLSLNYICFFIWLKLLCFYHFFLXSY 46


>gi|495846 (L19852) NADH dehydrogenase [Haldorus furcatus]
           Length = 46

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.41, P = 0.34
 Identities = 13/28 (46%), Positives = 19/28 (67%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  ICF ILL+++  + FFL S+
Sbjct:    19 YLPLSLNYICFFILLKLVCVYHFFLXSY 46


>gi|496166 (L19856) NADH dehydrogenase [Mendozellus isis]
           Length = 46

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.41, P = 0.34
 Identities = 13/27 (48%), Positives = 19/27 (70%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYS 147
             Y  LS+  ICF IL++++ F+ FFL S
Sbjct:    19 YLPLSLNYICFFILVKLLCFYHFFLXS 45


>gi|496288 (L19863) NADH dehydrogenase [Unerus colonus]
           Length = 46

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.41, P = 0.34
 Identities = 12/28 (42%), Positives = 19/28 (67%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  +S+  ICF I L+++ F+ FFL S+
Sbjct:    19 YLPMSLNYICFFIFLKLLCFYHFFLXSY 46


>pir||I40141 p93 protein - Lyme disease spirochete (fragment) >gi|436326
            (X69604) p93 [Borrelia burgdorferi]
            Length = 693

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.42, P = 0.34
 Identities = 24/105 (22%), Positives = 56/105 (53%), Frame = +1

Query:    49 DNMVVLQQEDEKIDKQKD---IDKKEDKKNMSTNRKEYKKKKKKYIIS-NKI-LKHIDNI 213
             +  + +++ DE++ K KD   +D   D  + ++++++ K K+K+ +   +K+ L  +DN 
Sbjct:   381 EKQIEIKKSDEELLKSKDPKALDLNRDLNSKASSKEKIKGKEKEIVKEKSKVSLGDLDND 440

Query:   214 DKLKYVGINRIDEKQKKSYLENI-PGGRIKKLNKQINDNKDERKK 345
             + L      ++ E +K    +N+ P   I+++N+    N +E  K
Sbjct:   441 ETLMTPEDQKLSEDKKLDSKKNLKPVSEIERVNEISKSNNNEVSK 485


>gi|1707051 (U80447) strong similarity to protein-tyrosine phosphatases
            [Caenorhabditis elegans]
            Length = 518

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.44, P = 0.35
 Identities = 18/60 (30%), Positives = 36/60 (60%), Frame = +1

Query:    43 SDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNR-KEYKKKKKKYIISNKILKHIDNIDK 219
             S+D+++ +++   K D +K +DKK+  K +S  + KE KK+K K +   K +   ++ D+
Sbjct:    93 SEDDLLDVKKTVSKEDDKKKVDKKDGSKKLSKKKLKEEKKEKSKKVNKEKKISKTESDDE 152


>sp|P50532|XCPC_XENLA CHROMOSOME ASSEMBLY PROTEIN XCAP-C >pir||A55094
            chromosomal protein XCAP-C - African clawed frog >gi|563812
            (U13673) XCAP-C [Xenopus laevis]
            Length = 1290

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.44, P = 0.36
 Identities = 26/90 (28%), Positives = 50/90 (55%), Frame = +1

Query:    67 QQEDEKIDKQ-KDIDKKEDK--KNMSTNRKEYKKKKKKYIISNKILKHID-NIDKLKYVG 234
             + + EKI +  KDI +K +   + M    K  K  +K+    NKI K I+ N +K   + 
Sbjct:   332 EAQKEKIQEDTKDISEKSNTLLETMKEKNKALKDVEKQL---NKITKFIEENREKFTQLD 388

Query:   235 INRIDEKQKKSYLENIPGGRIKKLNKQINDNKDE 336
             +  +D ++K  + ++    ++KKL KQ+  +K++
Sbjct:   389 LQDVDTREKLKHSKS----KVKKLQKQLQKDKEK 418

 Score = 85 (29.9 bits), Expect = 0.44, P = 0.36
 Identities = 28/105 (26%), Positives = 59/105 (56%), Frame = +1

Query:    40 ISDDNMVVLQQEDEKIDKQKDIDKKEDK--KNMSTNRKEYKKKKKKYIISNKILKHIDNI 213
             IS+ +  +L+   EK    KD++K+ +K  K +  NR+++ +   + + + + LKH  + 
Sbjct:   345 ISEKSNTLLETMKEKNKALKDVEKQLNKITKFIEENREKFTQLDLQDVDTREKLKHSKS- 403

Query:   214 DKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKD--ERKKKR 351
              K+K +      +K+K   L+N+P    K + ++ N  KD  E++K++
Sbjct:   404 -KVKKLQKQLQKDKEKVDELKNVPANSQKIIAEETN-KKDLLEKQKEK 449


>gi|1890800 (U88497) NADH dehydrogenase 1 [Flexamia dakota]
            Length = 310

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.45, P = 0.36
 Identities = 35/119 (29%), Positives = 52/119 (43%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLI-LPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F   L   I S  +FFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLVDSYSFISYYNFQFSLWLIILSLPIFFCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S+ CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSNLCSLLFYMKLVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890810 (U88502) NADH dehydrogenase 1 [Flexamia gila]
            Length = 310

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.45, P = 0.36
 Identities = 37/119 (31%), Positives = 52/119 (43%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF---LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSIC 198
             I + FF L    SFI  ++F   L L P   S  LFFC+ S  +     T F+ S     
Sbjct:   149 ILLCFFLLLDSYSFISYYNFHFSLWLIP--ISLPLFFCWLSCSMAESNRTPFDFSEGESE 206

Query:   197 FNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFI 18
                   + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI
Sbjct:   207 LVSGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYIKLVLMCFLFI 264

Query:    17 MVK 9
              V+
Sbjct:   265 WVR 267


>gnl|PID|e349281 (Z99280) Y57G11B.1 [Caenorhabditis elegans]
            Length = 300

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.48, P = 0.38
 Identities = 19/74 (25%), Positives = 41/74 (55%), Frame = +1

Query:    55 MVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKY--IISNKILKHIDNIDKLKY 228
             + +++ E +KI +++  +  E  KNM T  KEY +K+++   +I NK L  + +  + + 
Sbjct:   147 IALVEMEKQKIVRERADEMNEHHKNMETMTKEYHQKREEIHEVIKNKKLDILKDKREHQR 206

Query:   229 VGINRIDEKQKKSY 270
             +   +I E  K ++
Sbjct:   207 IEHEKISENMKNAF 220


>sp|P15911|VFP3_FOWPV PROTEIN FP3 >pir||WMVZP3 F3 protein - fowlpox virus
            (strain HP444) >gnl|PID|d1000674 (D00320) FP3 [Fowlpox virus]
            Length = 96

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.48, P = 0.38
 Identities = 21/62 (33%), Positives = 30/62 (48%), Frame = -2

Query:   285 WYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFV 106
             W I  +   L F + I S V     IIY L  FV  N  + LFL+ +S     F+V+  +
Sbjct:    35 WIILDLVLNLIFDSLITSFV-----IIYSLYSFVARNNKVLLFLL-MSYAIFRFIVMYLL 88

Query:   105 YV 100
             Y+
Sbjct:    89 YI 90


>gnl|PID|d1021580 (AB001684) ORF54d [Chlorella vulgaris]
            Length = 54

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 0.53, P = 0.41
 Identities = 13/32 (40%), Positives = 21/32 (65%), Frame = -3

Query:   227 YFNLSILSICFNILLE--IIYFFFFFLYSFLF 138
             +F L  L + F+++    +I+FFFFFL+ F F
Sbjct:     5 HFVLKPLKLLFSLMFFFFLIFFFFFFLFVFFF 36

 Score = 57 (20.1 bits), Expect = 3.6, P = 0.97
 Identities = 8/25 (32%), Positives = 16/25 (64%), Frame = -3

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLS 117
             +L  +++FFF   + F F+ +FF +
Sbjct:    13 LLFSLMFFFFLIFFFFFFLFVFFFT 37


>gi|2447150 (U42580) a580R [Paramecium bursaria Chlorella virus 1]
            Length = 73

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 0.53, P = 0.41
 Identities = 23/60 (38%), Positives = 33/60 (55%), Frame = -3

Query:   227 YFN-LSILSICFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTIL 51
             +F+ L++LS  F ILL I++  F  L+S  F  I  L  F   +F + IF    C  TI+
Sbjct:     2 FFSILTLLSEFFIILLCILFILFSMLFSITFPSIGNLVCF---AFSV-IFEMLYCIYTIM 57

Query:    50 S 48
             S
Sbjct:    58 S 58


>pir||A28782 cytochrome-c oxidase (EC 1.9.3.1) chain III - Trypanosoma brucei
            mitochondrion (SGC6) (fragment)
            Length = 181

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.55, P = 0.42
 Identities = 28/97 (28%), Positives = 48/97 (49%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C  F +F+F + Y+F  L      Y F   F+ +F++  N  +  F Y+ ++   FV  
Sbjct:     8 LCCEF-AFVFCLPYMFCCLLCD---YGF--VFYWYFLDLFNLLINTF-YL-FVSGLFVNF 59

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
              +  F F  F   C  ++L LLF ++FL+   + F L
Sbjct:    60 FVLCFWFRFFCCCCFVLWLSLLFGFLFLWNQLWEFAL 96


>gi|343596 (M20379) cytochrome c oxidase III [Trypanosoma brucei]
           >prf||1913438A cytochrome c oxidase [Trypanosoma brucei]
           Length = 288

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.57, P = 0.44
 Identities = 31/93 (33%), Positives = 45/93 (48%), Frame = -3

Query:   353 VLFFFLSSLLSFICLF--SFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC-FNILL 183
             V+ ++L  LL FICL   SFL +  G     + FC   + L+   F   +  +  F +LL
Sbjct:    24 VIVYWLFCLLGFICLLFGSFLFVDCGFIFFFVGFCICLLLLLLDLFCDFLRGLFDFCVLL 83

Query:   182 EII-YFFFFFLYS-FLFVDIFFLSSF-LSMSFC 93
               I Y F +FL S F+    FF+  F L +  C
Sbjct:    84 RCIQYCFLWFLCSEFVLFMAFFVVLFGLCLFLC 116

 Score = 78 (27.5 bits), Expect = 1.3, P = 0.73
 Identities = 28/97 (28%), Positives = 48/97 (49%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             +C  F +F+F + Y+F  L      Y F   F+ +F++  N  +  F Y+ ++   FV  
Sbjct:   115 LCCEF-AFVFCLPYMFCCLLCD---YGF--VFYWYFLDLFNLLINTF-YL-FVSGLFVNF 166

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL 67
              +  F F  F   C  ++L LLF ++FL+   + F L
Sbjct:   167 FVLCFWFRFFCCCCFVLWLSLLFGFLFLWNQLWEFAL 203


>sp|P52531|VU79_HSV7J PROTEIN U79 >gi|1139680 (U43400) similar to U79 of HHV6,
            GenBank Accession Number X83413 at the N-terminus [Human
            herpesvirus 7]
            Length = 233

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.61, P = 0.46
 Identities = 25/90 (27%), Positives = 48/90 (53%), Frame = +1

Query:    73 EDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDE 252
             +D+K++K  + +  E KK     +K+  K+K K     KIL+  D  D+ K     R+D+
Sbjct:   137 KDQKLEKLFEKEHAERKKQDDDYKKKALKQKDKRRSEQKILEDCDKKDEKK-----RMDD 191

Query:   253 KQKKSYLENIPGGRIKKLNKQINDNKDERK 342
              +K+   E+    + + L K+++D  ++RK
Sbjct:   192 TEKRKLQEDRRNEK-QDLKKRVDDT-EKRK 219

 Score = 77 (27.1 bits), Expect = 1.3, P = 0.72
 Identities = 22/66 (33%), Positives = 38/66 (57%), Frame = +1

Query:    64 LQQEDEKIDKQK---DIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVG 234
             L+Q+D++  +QK   D DKK++KK M    K  K ++ +      + K +D+ +K K   
Sbjct:   164 LKQKDKRRSEQKILEDCDKKDEKKRMDDTEKR-KLQEDRRNEKQDLKKRVDDTEKRKLED 222

Query:   235 INRIDEKQ 258
              +R +EKQ
Sbjct:   223 -DRRNEKQ 229


>gi|1890778 (U88486) NADH dehydrogenase 1 [Flexamia abbreviata]
            Length = 310

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.64, P = 0.47
 Identities = 35/119 (29%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F   L   + S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFISYYNFHFSLWLILVSLPLFFCWLSCSMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYMKLVLMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890790 (U88492) NADH dehydrogenase 1 [Flexamia bandarita]
            Length = 310

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.64, P = 0.47
 Identities = 35/119 (29%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F   L   + S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFISYYNFHFSLWLILISLPLFFCWLSCSMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYVKLVLMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890798 (U88496) NADH dehydrogenase 1 [Flexamia curvata]
            Length = 310

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.64, P = 0.47
 Identities = 35/119 (29%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F   L   + S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFISYYNFNFSLWLILISLPLFFCWLSCSMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYIKLVLMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890818 (U88506) NADH dehydrogenase 1 [Flexamia mescalero] >gi|1890824
            (U88509) NADH dehydrogenase 1 [Flexamia pectinata]
            Length = 310

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.64, P = 0.47
 Identities = 35/119 (29%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F   L   + S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFISYYNFHFSLWLILISLPLFFCWLSCSMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYIKLVLMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|563136 (U11682) unassigned reading frame [Trypanoplasma borelli]
           Length = 68

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 0.69, P = 0.50
 Identities = 20/68 (29%), Positives = 36/68 (52%), Frame = -2

Query:   279 IFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYV 100
             IF + F+ +F  TI   +F   +I  +  YF+  NIF+++ L  +++   +F    F+  
Sbjct:    12 IFNLYFYFYF--TI---IF---FIFCLNSYFLMCNIFIYIILNTIALLTKVFT---FINY 60

Query:    99 FLFIDFFI 76
              LFI + I
Sbjct:    61 ILFITYII 68

 Score = 57 (20.1 bits), Expect = 3.7, P = 0.97
 Identities = 15/54 (27%), Positives = 30/54 (55%), Frame = -2

Query:   303 LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFL-FLIFLS 142
             +FN   ++ F I FF+F +N+       F+YII      +   +F F+ +++F++
Sbjct:    12 IFNLYFYFYFTIIFFIFCLNSYFLMCNIFIYIILNTIALL-TKVFTFINYILFIT 65


>gi|780433 (U18466) pC84L [African swine fever virus] >prf||2113434BP C84L gene
           [African swine fever virus]
           Length = 84

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 0.69, P = 0.50
 Identities = 14/43 (32%), Positives = 25/43 (58%), Frame = +1

Query:   142 RKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQKKSY 270
             +K  KKK+ ++ I +   K I  I  + ++ +  I++KQKK Y
Sbjct:    24 QKTTKKKENRFFIRSG--KKIQRIQMMMFITVYDINQKQKKRY 64


>pir||S54621 probable membrane protein YOR015w - yeast (Saccharomyces
            cerevisiae) >gi|829125 (X87331) ORF OR26.05 [Saccharomyces
            cerevisiae] >gnl|PID|e252321 (Z74923) ORF YOR015w [Saccharomyces
            cerevisiae]
            Length = 119

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.70, P = 0.51
 Identities = 20/52 (38%), Positives = 31/52 (59%), Frame = -3

Query:   221 NLSIL-SICFNILLEIIY--FFFFFLYSFLFVD---IFFLSSFLSMSFCLSI 84
             +LSIL S+C + ++ I++  + F FL++FL      +F L S L    CLSI
Sbjct:    60 HLSILQSMCLHFIISILFSKYIFVFLFAFLLPSAFPLFILHSTLFRKPCLSI 111


>pir||C26696 hypothetical protein (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 211

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.71, P = 0.51
 Identities = 26/93 (27%), Positives = 43/93 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             F+  FFL  LL  +  FS L      F +   FC     L+ ++F +  L  C  +   I
Sbjct:    96 FMDVFFLRYLLCVLECFSLLCRCISTFLR--MFC----NLLSSHFLM--LMFCDFVYFFI 147

Query:   176 IYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFS 78
             I+F FF +  F++  IF  +    + F L +++
Sbjct:   148 IFFLFFIMCDFIYFIIFTFAMLFCIIFYLFLYA 180

 Score = 77 (27.1 bits), Expect = 1.1, P = 0.65
 Identities = 21/66 (31%), Positives = 35/66 (53%), Frame = -2

Query:   267 TFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLF- 91
             TF   F N ++SH     +++ M   FV    F  +F +F  +C  I+ ++ F +  LF 
Sbjct:   121 TFLRMFCNLLSSH-----FLMLMFCDFV---YFFIIFFLFFIMCDFIYFII-FTFAMLFC 171

Query:    90 IDFFIFL 70
             I F++FL
Sbjct:   172 IIFYLFL 178

 Score = 74 (26.0 bits), Expect = 2.7, P = 0.93
 Identities = 32/96 (33%), Positives = 45/96 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFC--FSSIRLIPTYFNLS---ILSICFN 192
             F+  FFL  LL  +  FS L      F +   FC   SS  L+  + +     I+   F 
Sbjct:    96 FMDVFFLRYLLCVLECFSLLCRCISTFLR--MFCNLLSSHFLMLMFCDFVYFFIIFFLFF 153

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFC--LSIF 81
             I+ + IYF  F  ++ LF  IF+L  +    FC  L IF
Sbjct:   154 IMCDFIYFIIF-TFAMLFCIIFYLFLYALDMFCALLQIF 191


>gi|1209856 (U45425) minus strand repeat motif-containing gene [Borrelia
            burgdorferi]
            Length = 168

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.81, P = 0.56
 Identities = 32/89 (35%), Positives = 42/89 (47%), Frame = -3

Query:   248 SIRLIPTYFNLSILSICFNILLEIIYFFFFFLYSFLF--VDIFFLSSFLSMSFCLSIFSS 75
             S R I  +  LSIL   F   + I+ F FF   S L   +DI F   F ++S  +S    
Sbjct:    26 SERDIKFFSTLSILVFKFFSTVSILAFKFFSTLSILVSKLDISFCKFFSTLSILMSKLDI 85

Query:    74 SCC---ST-TILSSLIDV--CGLFIMVKI 6
             S C   ST +IL S +D+  C  F  V I
Sbjct:    86 SFCKFFSTASILMSKLDISFCKFFSTVSI 114


>gi|2444428 (AF020657) ErpX protein [Borrelia burgdorferi]
            Length = 345

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.83, P = 0.56
 Identities = 23/89 (25%), Positives = 48/89 (53%), Frame = +1

Query:    46 DDNMVVLQQEDEKIDK-QKDIDKKEDKKNMSTNRKEYKKKK-----KKYIISNKILKHID 207
             D++   ++++ ++++K Q+   ++E+KK     ++E KK+K     K+    NKI K  D
Sbjct:   150 DEDKEEIEKQKQEVEKAQERKQRQEEKKRKKQEQQEEKKRKRQEQRKERRAKNKIKKLAD 209

Query:   208 NIDKLKYV--GINRIDEKQKKSYLENIPG 288
              ID++ +   GI      + K+ ++ I G
Sbjct:   210 KIDEISWNIDGIESQTSVKPKAVIDKITG 238


>gi|1294785 (L76262) ND3 gene product [Meloidogyne hapla]
            Length = 101

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 0.85, P = 0.57
 Identities = 24/97 (24%), Positives = 52/97 (53%), Frame = -2

Query:   336 FIFIIIYLFI*-LFNPPPWYIFQITFFLFFINT-------INSHVF*FV--YIIYMLQYF 187
             F+ I+I+ F+  +F    +   + +FF    N+       IN H F  V  ++++ L+ F
Sbjct:     2 FLLIMIFFFLTFMFTKKKYKKMKNSFFESGFNSLGKNMFSINMHFFCLVMIFVLFDLELF 61

Query:   186 VGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDF-FIFLL 67
                  FLF+F  +  +   + +++ F+ + LF+++ +I L+
Sbjct:    62 ----FFLFVFFNYYLVYWMVMMIIFFIIMTLFLEWKYIKLI 98


>sp|P25808|SPB4_YEAST ATP-DEPENDENT RRNA HELICASE SPB4 >pir||S14942 RNA
            helicase SPB4 - yeast (Saccharomyces cerevisiae) >gi|4522 (X16147)
            spb4 protein product (AA 1-606) [Saccharomyces cerevisiae]
            >gnl|PID|d1009879 (D50617) Putative rRNA helicase [Saccharomyces
            cerevisiae] >gnl|PID|d1008624 (D44600) PUTATIVE RRNA HELICASE SPB4
            [Saccharomyces cerevisiae]
            Length = 606

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.85, Sum P(2) = 0.57
 Identities = 29/92 (31%), Positives = 53/92 (57%), Frame = +1

Query:    88 DKQKDIDKKEDKKNMS--TNRKEYKK--KKKKYIISNKILKHIDNIDKLKYVGINR--ID 249
             DK+++ +++E  KN+S   ++K+ K   KKK    S+K L     +++ + + + R  I+
Sbjct:   502 DKKREKERQETLKNISLINDKKKLKSELKKKNLAWSDKTLTKERKLERKEKMSLKRKAIE 561

Query:   250 EKQKKSYL-ENIPGGRIKKLNKQINDNKDERKK 345
             E+ K   L EN    RIK+  K+I   +++RKK
Sbjct:   562 EELKAEELDENAEEERIKEDWKEIV-LQNKRKK 593

 Score = 40 (14.1 bits), Expect = 0.85, Sum P(2) = 0.57
 Identities = 10/37 (27%), Positives = 17/37 (45%), Frame = +1

Query:     7 IFTIMNRPHTSISDDNMVVLQQEDEKIDKQ--KDIDK 111
             +   +  P    S  +MVV+ + D  +D    KD +K
Sbjct:   152 VLDFLQMPAVKTSACSMVVMDEADRLLDMSFIKDTEK 188


>sp|P13816|GARP_PLAFF GLUTAMIC ACID-RICH PROTEIN PRECURSOR >pir||A54514
            glutamic acid-rich protein precursor - Plasmodium falciparum
            >gi|160299 (J03998) glutamic acid-rich protein [Plasmodium
            falciparum]
            Length = 678

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.89, P = 0.59
 Identities = 21/65 (32%), Positives = 38/65 (58%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E EKI+K+K   ++++KK     RK+ +KK++K     K +K    I+K +     + +
Sbjct:   273 KEQEKIEKKKKKQEEKEKKKQEKERKKQEKKERKQ--KEKEMKKQKKIEKER----KKKE 326

Query:   250 EKQKK 264
             EK+KK
Sbjct:   327 EKEKK 331

 Score = 82 (28.9 bits), Expect = 0.89, P = 0.59
 Identities = 22/70 (31%), Positives = 40/70 (57%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E EKI+K+K   ++++KK     RK+ +KK++K     K +K    I+K +     + +
Sbjct:   273 KEQEKIEKKKKKQEEKEKKKQEKERKKQEKKERKQ--KEKEMKKQKKIEKERKKKEEK-E 329

Query:   250 EKQKKSYLEN 279
             +K+KK   EN
Sbjct:   330 KKKKKHDKEN 339

 Score = 79 (27.8 bits), Expect = 2.8, P = 0.94
 Identities = 25/96 (26%), Positives = 48/96 (50%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E EKI+K+K   ++++KK     RK+ +KK++K     K +K    I+K +     + +
Sbjct:   273 KEQEKIEKKKKKQEEKEKKKQEKERKKQEKKERKQ--KEKEMKKQKKIEKER----KKKE 326

Query:   250 EKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTN 357
             EK+KK    +       K N++     D+  ++  N
Sbjct:   327 EKEKKKKKHD-------KENEETMQQPDQTSEETNN 355


>pir||E64456 hypothetical protein MJ1254 - Methanococcus jannaschii >gi|1591888
            (U67566) M. jannaschii predicted coding region MJ1254
            [Methanococcus jannaschii]
            Length = 469

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.90, P = 0.59
 Identities = 29/86 (33%), Positives = 43/86 (50%), Frame = +1

Query:    79 EKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQ 258
             EKI K+K I++ ++ KN  T+ K  K K+K+  I N  +K  D  DKL     N +++ +
Sbjct:   271 EKISKRKIIERTKNIKNELTSLKN-KLKEKEEEIKNLAIKIKDLEDKLSKANKNLLNKDE 329

Query:   259 KKSYLENIPGGRIKKLNKQINDNKDE 336
               S L      RI +   QI    DE
Sbjct:   330 IISVLNE----RISEYESQIQKLLDE 351


>gi|1142588 (U05313) CR3 [Trypanosoma brucei]
            Length = 70

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 0.90, P = 0.59
 Identities = 17/32 (53%), Positives = 23/32 (71%), Frame = -2

Query:   168 LFL-FLIFLSIC*HIFLVLLFVYVFLFIDF-FIF 73
             LF+ F  FL +C  +FL LLF + FL +DF F+F
Sbjct:    13 LFVHFFCFLFVC-DLFLCLLFSFCFL-LDFCFLF 44

 Score = 56 (19.7 bits), Expect = 4.8, P = 0.99
 Identities = 22/70 (31%), Positives = 34/70 (48%), Frame = -3

Query:   329 LLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIYFFFFFLY 150
             LL F CLF         F   LF C   + L+ ++  L      FN+ L ++  FFFF+ 
Sbjct:     7 LLFFYCLFVHFFC----F---LFVCDLFLCLLFSFCFLLDFCFLFNMGL-LLCLFFFFIL 58

Query:   149 SF-LFVDIFFL 120
             SF + + + F+
Sbjct:    59 SFDMCIKLLFI 69


>pir||S60823 M protein precursor - Streptococcus pyogenes (serotype M66)
            (fragment) >gi|1235843 (U11999) emml gene product [Streptococcus
            pyogenes]
            Length = 78

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 0.90, P = 0.59
 Identities = 16/48 (33%), Positives = 27/48 (56%), Frame = +1

Query:    31 HTSISDDNMVVLQQEDEKIDKQKD---IDKKEDKKNMSTNRKEYKKKKK 168
             +  +SDD+  +LQ   E+I  + +    + +E+KKN+    KE KK  K
Sbjct:    31 YQKLSDDH-TLLQDAIEEISSENEKLKSENEENKKNLEKLSKEIKKSSK 78


>gi|1890796 (U88495) NADH dehydrogenase 1 [Flexamia clayi]
            Length = 310

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.91, P = 0.60
 Identities = 33/119 (27%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF------LILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC 198
             I + FF L    SFI  ++F      ++L   IF   L  C +     P  F+     + 
Sbjct:   149 ILLCFFLLVDSYSFISYYNFQFSLWLIMLSLPIFFCWLSCCMAESNRTPFDFSEGESELV 208

Query:   197 FNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFI 18
                ++E  Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI
Sbjct:   209 SGFMVE--YGGGGF--ALLFISEYSSIIFISMITCVIFLGSDFCSLIFYIKLVFMCFLFI 264

Query:    17 MVK 9
              V+
Sbjct:   265 WVR 267


>gi|1890848 (U88521) NADH dehydrogenase 1 [Flexarida chaotica]
            Length = 310

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.91, P = 0.60
 Identities = 35/119 (29%), Positives = 52/119 (43%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F L L   + S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLVDSYSFISYYNFNLSLWFVVISLPLFFCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C +FI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVIFLGSDLCSFFFYIKLVFMCLMFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|454844 (M74170) ORF 3 [Schistosoma mansoni]
           Length = 393

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 1.0, P = 0.63
 Identities = 22/71 (30%), Positives = 34/71 (47%), Frame = -2

Query:   279 IFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLF----LIFLSIC*HIFLVLL 112
             +F IT F F   TI   V   + I+ +L  F G  IFL +F    L+   +   +F V +
Sbjct:    34 VFTITVF-FISTTIIVFVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVLVVSVFFVTI 92

Query:   111 FVYVFLFIDFFI 76
             F+   L +  F+
Sbjct:    93 FIIAILLVTIFV 104

 Score = 75 (26.4 bits), Expect = 5.3, P = 1.0
 Identities = 33/114 (28%), Positives = 58/114 (50%), Frame = -3

Query:   353 VLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEII 174
             +  FF+S+ +    +F  +IL   I +  +FF  +   +I   F++++L I   +L+  +
Sbjct:    37 ITVFFISTTIIVFVIFLIVILI--ILA--IFFGVTIFLII---FSMTMLVI--PVLVVSV 87

Query:   173 YFFFFFLYSFLFVDIFFLSSFLSMSFCLS-----IFSSSCCSTTILSSLIDVCGLFIMV 12
             +F   F+ + L V IF +S F+   F ++     IF  S    TI    I V  LFI +
Sbjct:    88 FFVTIFIIAILLVTIFVVSVFVVTIFIIAVLLVTIFVISILLVTIFVVSILVVTLFITI 146

 Score = 75 (26.4 bits), Expect = 5.3, P = 1.0
 Identities = 31/115 (26%), Positives = 55/115 (47%), Frame = -3

Query:   359 IFVLFFFLSSLLS--FICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNIL 186
             +FV  F  + L+   F+ +F   IL   +F   +F    +I +I  +  + I+SI    L
Sbjct:   189 LFVAIFVRTILVITLFVTIFVRTILVITLFVA-IFV--RTILVITLFVTIFIISI----L 241

Query:   185 LEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIM 15
             L  I     F+ + L + IF +S  +   F +S+F  +    TI +  + V  +FI+
Sbjct:   242 LVTILVISVFIIAILTISIFVISILIITIFVISVFVITIFVVTIFAITVLVISIFIV 298

 Score = 75 (26.4 bits), Expect = 5.3, P = 1.0
 Identities = 33/117 (28%), Positives = 60/117 (51%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFS-SIRLIP---TYFNLSILSICF- 195
             IFV+  F+ ++   + +F+  +L   IF    F  F+ SI L+P   T F ++IL I   
Sbjct:   270 IFVISVFVITIF-VVTIFAITVLVISIFIVAFFIVFAVSILLVPLLMTIFIIAILVITIF 328

Query:   194 ------NILLEIIYFFFFFLYSFLFVDIFFLSSF-LSMSFCLSIFSSSCCSTTILSSLI 39
                   ++L  II   F  +  FL + IF ++ + + M+F  S  ++  C+ +I  S++
Sbjct:   329 VIVFTVSVLAGIIACVFSTITIFLTIVIFIINIYRIFMTFT-STRTTGNCTNSISISIV 386


>sp|P04540|NU5M_TRYBB NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >pir||QQUTC5 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Trypanosoma
            brucei mitochondrion (SGC6) >gi|343540 (M14820) NADH dehydrogenase
            subunit 5 [Trypanosoma brucei]
            Length = 590

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 1.1, P = 0.66
 Identities = 29/116 (25%), Positives = 54/116 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             +   +F   +L+ + L   ++    I+    F+C     L+     LS  +I   + + I
Sbjct:   359 YFFMYFCGCVLARLLLIFAILNSCSIWFLCGFYCKDM--LLALLMLLSFYNIIEFLFISI 416

Query:   176 IYFFFFFLYSFLFVDIFFLSSFLSMSFCLS-----IFSSSCCSTTILSSL-IDVCGLFIM 15
             I+ FF  +Y++    +FFL  F+   FCL      +F   CC    L SL + +  +F +
Sbjct:   417 IFIFFTMIYNYFL--LFFLM-FVFKCFCLVDCLFLLFDYECCLVYCLISLYMCILSIFFI 473

Query:    14 V 12
             +
Sbjct:   474 I 474

 Score = 79 (27.8 bits), Expect = 2.2, P = 0.88
 Identities = 26/97 (26%), Positives = 46/97 (47%), Frame = -3

Query:   347 FFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEIIYF 168
             F+    LL+ + L SF  +   +F   +F  F+ I      F L  +  CF  L++ ++ 
Sbjct:   390 FYCKDMLLALLMLLSFYNIIEFLFISIIFIFFTMIYNYFLLFFLMFVFKCF-CLVDCLFL 448

Query:   167 FFFF----LYSFLFVDIFFLSSFLSMSF-CLSIFSSSC 69
              F +    +Y  + + +  LS F  + F C+ +FSS C
Sbjct:   449 LFDYECCLVYCLISLYMCILSIFFIIDFVCIFVFSSYC 486

 Score = 78 (27.5 bits), Expect = 3.5, P = 0.97
 Identities = 29/99 (29%), Positives = 54/99 (54%), Frame = -2

Query:   360 HICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVG 181
             ++C   LS  FII ++ I +F+   + +F  +FFL F N  +  +F  V++I  + +   
Sbjct:   464 YMC--ILSIFFIIDFVCIFVFSS--YCVFW-SFFLNFYNFFDIAIF-VVFLILSVGFLYY 517

Query:   180 NNIFLFLFLI-FLSIC*HIFLVLLFVYVFL------FIDFFIFLL 67
               +F + F I  + +   IF V++ + VF+      F+   IF+L
Sbjct:   518 GCLFFYFFNIDCIMLFWRIFFVIIILVVFMIFCCWYFVCMIIFML 562


>gnl|PID|e214803 (Z68300) T22B3.3 [Caenorhabditis elegans]
            Length = 185

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 1.1, P = 0.67
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +1

Query:    61 VLQQEDEKIDKQKDIDKKEDKKNMSTNR-KEYKKKKKK 171
             VL+ EDE  DK+K  ++KE+KK    N  KE KK+ KK
Sbjct:   136 VLENEDE--DKEKKEEEKEEKKEEKKNEEKEEKKEDKK 171

 Score = 73 (25.7 bits), Expect = 3.2, P = 0.96
 Identities = 18/40 (45%), Positives = 28/40 (70%), Frame = +1

Query:    61 VLQQEDEKIDKQKDI--DKKEDKKNMSTN-RKEYKKKKKK 171
             VL+ EDE  +K+++   +KKE+KKN     +KE KK++KK
Sbjct:   136 VLENEDEDKEKKEEEKEEKKEEKKNEEKEEKKEDKKEEKK 175


>gi|495722 (L19839) NADH dehydrogenase [Amplicephalus marginellus]
           Length = 46

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.2, P = 0.69
 Identities = 12/28 (42%), Positives = 19/28 (67%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  +S+   CF ILL+++ F+ FFL S+
Sbjct:    19 YLPMSLNYNCFFILLKLMCFYHFFLXSY 46


>gnl|PID|d1021467 (AB001684) ORF49b [Chlorella vulgaris]
            Length = 49

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.2, P = 0.70
 Identities = 15/24 (62%), Positives = 16/24 (66%), Frame = +1

Query:    94 QKDIDKKEDKKNMSTNRKEYKKKK 165
             QK I KK  KK   TN+KE KKKK
Sbjct:    28 QKQIKKKRRKKK--TNKKEEKKKK 49


>gi|1890846 (U88520) NADH dehydrogenase 1 [Flexamia zacate]
            Length = 310

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 1.3, Sum P(2) = 0.72
 Identities = 15/48 (31%), Positives = 24/48 (50%), Frame = -3

Query:   152 YSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMVK 9
             ++ LF+  +    F+SM  C+    S  CS      L+ +C LFI V+
Sbjct:   220 FALLFISEYSSIIFISMITCVVFLGSHLCSLLFYIKLVLMCFLFIWVR 267

 Score = 42 (14.8 bits), Expect = 1.3, Sum P(2) = 0.72
 Identities = 9/22 (40%), Positives = 15/22 (68%), Frame = -2

Query:   213 YIIYMLQYFVGNNIFLFLFLIF 148
             Y+IYM+  F+     LF+++IF
Sbjct:    68 YMIYMVCPFISMIQSLFIWVIF 89


>gi|1199810 (X95665) cDNA6 gene product [Brugia pahangi]
            Length = 175

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.3, P = 0.74
 Identities = 19/59 (32%), Positives = 28/59 (47%), Frame = -3

Query:   254 FSSIRLIPTYFNLSILSICFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFS 78
             FS + +I  Y    I S  F +L+  ++FF  FL+ F F    F S F  + +   I S
Sbjct:    97 FSCLFIIDDYSRTCIKSSAF-LLVSSLFFFLLFLHIFFFFFSLFFSEFTFIDYSAIILS 154


>sp|P06719|KNOB_PLAFN KNOB-ASSOCIATED HISTIDINE-RICH PROTEIN PRECURSOR (KAHRP)
            >pir||A29454 knob-associated histidine-rich protein precursor -
            Plasmodium falciparum (strain NF7/Ghana) >gi|9909 (Y00060) KAHRP
            [Plasmodium falciparum]
            Length = 657

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 1.4, P = 0.75
 Identities = 32/95 (33%), Positives = 45/95 (47%), Frame = +1

Query:    70 QEDEKIDKQKDID--KKEDKKNMSTNRKE-YKKKKKKY--IISNKILKHIDNIDKLKYVG 234
             ++ +K  K KD D  KK+ KK+      E  K KK K       K  KH DN D  + V 
Sbjct:   377 EKKKKSKKHKDHDGEKKKSKKHKDNEDAESVKSKKHKSHDCEKKKSKKHKDNEDA-ESVK 435

Query:   235 INRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
               ++ +K++KS +E       KKL K+I   K     K
Sbjct:   436 SKKVLKKREKSIMEK--NHAAKKLTKKIKIKKKTNNSK 471


>gi|1890782 (U88488) NADH dehydrogenase 1 [Flexamia arenicola]
            Length = 310

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 1.4, P = 0.75
 Identities = 35/119 (29%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIF-SK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SF+  +SF      IF S  LF C+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFMSYYSFHFSVWLIFISMPLFLCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S+ CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSNLCSLLFYMKLVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890804 (U88499) NADH dehydrogenase 1 [Flexamia delongi]
            Length = 310

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 1.4, P = 0.75
 Identities = 33/119 (27%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF------LILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC 198
             I + FF L    SFI  ++F      ++L   IF + L  C +     P  F+     + 
Sbjct:   149 ILLCFFLLVDSYSFISYYNFQFSLWLIMLSLPIFFRWLSCCMAESNRTPFDFSEGESELV 208

Query:   197 FNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFI 18
                 +E  Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI
Sbjct:   209 SGFNVE--YGGGGF--ALLFISEYSSIIFISMITCVIFLGSDFCSLIFYIKLVLMCFLFI 264

Query:    17 MVK 9
              V+
Sbjct:   265 WVR 267


>pir||S72690 probable membrane protein Q0270 - yeast (Saccharomyces cerevisiae)
            mitochondrion (SGC2)
            Length = 118

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 1.4, P = 0.75
 Identities = 14/64 (21%), Positives = 37/64 (57%), Frame = -2

Query:   216 VYIIYMLQYFV----------GNNIFLFLFLIFL-SIC*HIFLVLLFVYVFLFIDFFIFL 70
             + I+YML  F+          G    +++F+I++  +  +++ + +F+Y++L++  +++L
Sbjct:    49 IMIMYMLLIFIYTPSGFGSPPGRGTIIYMFIIYIYMLYLYLYYIYMFMYLYLYLYLYLYL 108

Query:    69 L*YN 58
               YN
Sbjct:   109 YLYN 112


>sp|P23271|OLF8_RAT OLFACTORY RECEPTOR-LIKE PROTEIN I8 >pir||G23701 olfactory
            receptor I8 - rat >gi|205836 (M64387) olfactory protein [Rattus
            norvegicus]
            Length = 312

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 1.4, P = 0.75
 Identities = 35/114 (30%), Positives = 55/114 (48%), Frame = -3

Query:   359 IFVLFFFLSSLLSFIC--LFSFLILPPGIFSK*LFF---CFSSIRLIPTYFNLS--ILSI 201
             I  L  FL +LL  +   L S L  P  +F   L F   CFSS+ ++    N+   + SI
Sbjct:    31 IMYLTTFLGNLLIVVLVQLDSHLHTPMYLFLSNLSFSDLCFSSVTMLKLLQNIQSQVPSI 90

Query:   200 CFNILLEIIYFFFFFLY--SFLFVDIFFLSSFLSMSFCL---SIFSSSCCSTTIL 51
              +   L  I+FF  F Y  +FL V + +   ++++ F L   +I S   C+  +L
Sbjct:    91 SYAGCLTQIFFFLLFGYLGNFLLVAMAY-DRYVAICFPLHYTNIMSHKLCTCLLL 144


>pir||A64465 hypothetical protein MJ1322 - Methanococcus jannaschii >gi|1591962
            (U67572) M. jannaschii predicted coding region MJ1322
            [Methanococcus jannaschii]
            Length = 1005

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 1.4, P = 0.75
 Identities = 29/102 (28%), Positives = 56/102 (54%), Frame = +1

Query:    64 LQQEDEKIDKQKD----IDKKEDKKNMSTNRKEYK-KKKKKYI-ISNKI--LKHI-DNID 216
             L++++ +I++ KD    +  KE +     NR+  K  K K+Y+ ++ K+  LK+I D ++
Sbjct:   666 LREDEREINRLKDKLNELKNKEKELIEIENRRSLKFDKYKEYLGLTEKLEELKNIKDGLE 725

Query:   217 KL------KYVGINRIDEKQKKSYLENIPGGRIKKLNKQIND 324
             ++      K + I+ I  K  K  +E     +I ++NK+IND
Sbjct:   726 EIYNICNSKILAIDNIKRKYNKEDIEIYLNNKILEVNKEIND 767


>gi|677198 (L03188) putative [Saccharomyces cerevisiae]
           Length = 1015

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 1.4, P = 0.76
 Identities = 26/107 (24%), Positives = 54/107 (50%), Frame = +1

Query:    37 SISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRK-EYKKKKKKYIISNKILKHID-N 210
             SI  + + + + +DE   K+K++ + EDK   S ++  +Y + +K+   S KI + +D  
Sbjct:   471 SIESETVKIKELQDECNFKEKEVSELEDKLKASEDKNSKYLELQKE---SEKIKEELDAK 527

Query:   211 IDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTN 357
               +LK + + ++    K          R+KK + +   N +E+ +K  N
Sbjct:   528 TTELK-IQLEKVTNLSKAKEKSESELSRLKKTSSEERKNAEEQLEKLKN 575


>gi|1209848 (U45424) minus strand repeat motif-containing gene [Borrelia
            burgdorferi]
            Length = 161

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 1.5, P = 0.77
 Identities = 31/89 (34%), Positives = 43/89 (48%), Frame = -3

Query:   248 SIRLIPTYFNLSILSICFNILLEIIYFFFFFLYSFLF--VDIFFLSSFLSMSFCLSIFSS 75
             S R I  +  LSIL+  F   + I+ F FF   S L   +DI F   F ++S  +S    
Sbjct:    26 SERDIKFFSTLSILAFKFFSTVSILAFKFFSTLSILVSKLDISFCKFFSTLSILVSKLDI 85

Query:    74 SCC---ST-TILSSLIDV--CGLFIMVKI 6
             S C   ST +IL S +D+  C  F  + I
Sbjct:    86 SFCKFFSTLSILVSKLDISFCKFFSTLSI 114


>sp|P34849|NU2M_APIME NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 2 >gi|829004
            (L06178) NADH dehydrogenase subunit 2 [Apis mellifera ligustica]
            Length = 333

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 1.5, Sum P(2) = 0.78
 Identities = 26/82 (31%), Positives = 42/82 (51%), Frame = -2

Query:   279 IFQITFFLFFINTINSHVF*FVYIIYMLQYFVG----N--NIFLFLFLIFLSIC*HIFLV 118
             IF  +F+  FI  +N ++F  + I+Y   YF+     N  NI  F F+ +     + FL 
Sbjct:   177 IFN-SFYFIFILELNKNMFIAMIILYSFNYFLLISFLNKFNIQNFNFMFYNKYQMYTFLT 235

Query:   117 LLFVYVFLFIDFFIFLL*YNHIII 46
             L+F Y    I F  F++ +N I +
Sbjct:   236 LMFNYSMYPI-FLSFVIKWNLIFM 258

 Score = 41 (14.4 bits), Expect = 1.5, Sum P(2) = 0.78
 Identities = 9/27 (33%), Positives = 12/27 (44%), Frame = -1

Query:   340 FFHLYYHLFVYLAF*SSPLVYFPNNFF 260
             F +  YH F+Y       L+   NN F
Sbjct:     3 FMNFKYHWFIYFLITIFVLMMNSNNIF 29


>pir||S52960 NADH dehydrogenase chain 2 - honeybee mitochondrion (SGC4)
            Length = 333

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 1.5, Sum P(2) = 0.78
 Identities = 26/82 (31%), Positives = 42/82 (51%), Frame = -2

Query:   279 IFQITFFLFFINTINSHVF*FVYIIYMLQYFVG----N--NIFLFLFLIFLSIC*HIFLV 118
             IF  +F+  FI  +N ++F  + I+Y   YF+     N  NI  F F+ +     + FL 
Sbjct:   177 IFN-SFYFIFILELNKNMFIAMIILYSFNYFLLISFLNKFNIQNFNFMFYNKYQMYTFLT 235

Query:   117 LLFVYVFLFIDFFIFLL*YNHIII 46
             L+F Y    I F  F++ +N I +
Sbjct:   236 LMFNYSMYPI-FLSFVIKWNLIFM 258

 Score = 41 (14.4 bits), Expect = 1.5, Sum P(2) = 0.78
 Identities = 9/27 (33%), Positives = 12/27 (44%), Frame = -1

Query:   340 FFHLYYHLFVYLAF*SSPLVYFPNNFF 260
             F +  YH F+Y       L+   NN F
Sbjct:     3 FMNFKYHWFIYFLITIFVLMMNSNNIF 29


>gi|496096 (L19853) NADH dehydrogenase [Kansendria kansiesis]
           Length = 46

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.6, P = 0.79
 Identities = 13/28 (46%), Positives = 19/28 (67%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  I F ILL+++ F+ FFL S+
Sbjct:    19 YLLLSLNYISFFILLKLLCFYHFFLXSY 46


>gi|496251 (L19862) NADH dehydrogenase [Sanctanus balli]
           Length = 46

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.6, P = 0.79
 Identities = 12/28 (42%), Positives = 19/28 (67%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  + F ILL+++ F+ FFL S+
Sbjct:    19 YLPLSLNYVSFFILLKLLCFYHFFLXSY 46


>sp|Q36426|NU2M_LOCMI NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 2 >gi|1182024
            (X80245) ND2 gene product [Locusta migratoria]
            Length = 342

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 1.6, P = 0.80
 Identities = 26/82 (31%), Positives = 44/82 (53%), Frame = -3

Query:   251 SSIRLIPTYFNLSILS--ICFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFS 78
             +S+R I  Y ++S L   I    + E  + F+F +YS L V I F+   +++ F   I+S
Sbjct:   169 TSLRQILAYSSISHLGWMISSMTISENTWEFYFLIYSTLNVIIIFMFKTMNLFFLNQIYS 228

Query:    77 SSCCSTTI----LSSLIDVCGL 24
             +S   T I    ++SL+ + GL
Sbjct:   229 ASYFKTEIKFMMMTSLLSLGGL 250


>gi|829333 (X15081) ctyochrome c oxidase subunit I (2034 is 3rd base in codon)
           [Crithidia fasciculata]
           Length = 49

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.6, P = 0.80
 Identities = 10/29 (34%), Positives = 20/29 (68%), Frame = -2

Query:   171 FLFLFLIFLSIC*HIFLVLLFVYVFLFID 85
             +L +F + L +C   F + +FV++FL+I+
Sbjct:    20 WLLIFDLMLLLCFFYFFLTIFVFIFLYIN 48

 Score = 54 (19.0 bits), Expect = 8.2, P = 1.0
 Identities = 9/26 (34%), Positives = 20/26 (76%), Frame = -3

Query:   203 ICFNILLEIIYFFFFFLYSFLFVDIF 126
             + F+++L ++ FF+FFL  F+F+ ++
Sbjct:    22 LIFDLML-LLCFFYFFLTIFVFIFLY 46


>gi|2621454 (AE000824) unknown [Methanobacterium thermoautotrophicum]
            Length = 74

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.6, P = 0.80
 Identities = 14/29 (48%), Positives = 18/29 (62%), Frame = -2

Query:   324 IIYLFI*LFNPPPWYIFQITFFLF--FINTI 238
             IIY  I  FNPP W ++ +  FL   FI +I
Sbjct:    22 IIYALI--FNPPSWVVYGVAIFLIPVFILSI 50


>gi|1294789 (L76261) ND3 gene product [Meloidogyne javanica]
            Length = 103

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.6, P = 0.80
 Identities = 24/96 (25%), Positives = 53/96 (55%), Frame = -2

Query:   333 IFIIIYLFI*LF-NPPPWYIFQITFFLFFINTINSHVF*F-VYIIYMLQYFV--GNNIFL 166
             IF +++ F+  F N     + + ++F    N +   +F + ++   ++  F+     +FL
Sbjct:     5 IFSLVFFFVTFFFNKKKNKLMKNSYFESGFNYLGKLLFSYSIHFFMIILIFILFDLELFL 64

Query:   165 FLFLIF-LS-IC*HIFLVLLFVYVFLFIDF-FIFLL 67
             FLF+ F L+ I   IFL+++F+ + L +++ +I L+
Sbjct:    65 FLFIYFNLNLIYWMIFLLIIFIMMTLVLEWKYIKLI 100


>gnl|PID|e327003 (Z97341) membrane protein homolog [Arabidopsis thaliana]
            Length = 587

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 1.7, P = 0.81
 Identities = 26/102 (25%), Positives = 50/102 (49%), Frame = +1

Query:    46 DDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLK 225
             +DN    ++EDE+ D+++   + +DKK   T++K    K   Y+ +  +      ID  K
Sbjct:    23 EDNEGEEEEEDEEGDEKRGRSRGKDKKKQETDKKGLTLKDLGYMRAKAVKAKQRAIDSGK 82

Query:   226 YVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
              +   + D+KQ +S   N P G  +++      +  E+K+ R
Sbjct:    83 -MERPKPDKKQSRSKPRNQPRG--EEMKDLFKSDMGEKKQGR 121


>gi|2258370 (AF007261) haem lyase [Reclinomonas americana]
            Length = 637

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 1.7, P = 0.81
 Identities = 28/91 (30%), Positives = 42/91 (46%), Frame = -3

Query:   338 LSSLLSFICLFSFLILPPGIFSK*L--FFCFSSIRLIPTYFNLSILSICFNILLEIIYFF 165
             L SL  F  +  ++I+  G F   +  FF   SI + P+++N  I+ I     + +I   
Sbjct:   350 LISLNQFFFISFYIIILIGTFYPTIHYFFFKQSITIGPSFYNQMIIPILVPFFIFMISSL 409

Query:   164 FFFLYSFLFVDIFFLSSFLSMSFCLS--IFS 78
             +F   S     IFF +  L   FC S  IFS
Sbjct:   410 YFHWESIKIKKIFFSTKELLFIFCFSTAIFS 440


>sp|P14873|MAPB_MOUSE MICROTUBULE-ASSOCIATED PROTEIN 1B (MAP1.2) (MAP1(X))
            >pir||QRMSP1 microtubule-associated protein MAP1B - mouse >gi|53000
            (X51396) MAPB1 protein (AA 1-2464) [Mus musculus] >prf||1604367A
            microtubule assocd protein MAP1B [Mus musculus]
            Length = 2464

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.7, P = 0.82
 Identities = 25/83 (30%), Positives = 44/83 (53%), Frame = +1

Query:    64 LQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGIN- 240
             +++E    D +K++ KKE+KK +    KE KK+ KK  IS  I K     D  K   +  
Sbjct:   698 VKKETPLKDAKKEV-KKEEKKEVKKEEKEPKKEIKK--ISKDIKKSTPQSDTKKPSALKP 754

Query:   241 RIDEKQKKSYLENIPGGRIKKLNK 312
             ++ +K++ +  E +  G++K   K
Sbjct:   755 KVAKKEESTKKEPLAAGKLKDKGK 778


>gnl|PID|e309969 (Z93389) T13F3.e [Caenorhabditis elegans]
            Length = 166

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 1.7, P = 0.82
 Identities = 21/73 (28%), Positives = 38/73 (52%), Frame = +1

Query:    49 DNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKK-KKYIISNKILKHIDNIDKLK 225
             +  V  + E+ K  ++KD  KKE++K     +KE KK++ KK  +  +  K     D+ K
Sbjct:    25 EEKVEKKPEENKEAEKKDEPKKEEEKKEEEKKKEEKKEEEKKEEVKEEEKKDDSKRDEKK 84

Query:   226 YVGINRIDEKQKK 264
               G  + D++ K+
Sbjct:    85 KDGEKKEDDENKE 97

 Score = 72 (25.3 bits), Expect = 3.4, P = 0.97
 Identities = 15/35 (42%), Positives = 25/35 (71%), Frame = +1

Query:    67 QQEDEKID-KQKDIDKKEDKKNMSTNRKEYKKKKK 168
             +++D K D K+KD +KKED +N   N K+ ++KK+
Sbjct:    74 KKDDSKRDEKKKDGEKKEDDENKEDNEKKKEEKKE 108

 Score = 72 (25.3 bits), Expect = 3.4, P = 0.97
 Identities = 22/94 (23%), Positives = 51/94 (54%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++++EK++K+ + +K+ +KK+    ++E KK+++K     K  +  + + + +    ++ 
Sbjct:    22 KKKEEKVEKKPEENKEAEKKD-EPKKEEEKKEEEKKKEEKKEEEKKEEVKEEEKKDDSKR 80

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             DEK+K    +          NK+ N+ K E KK+
Sbjct:    81 DEKKKDGEKKE------DDENKEDNEKKKEEKKE 108


>sp|P34859|NULM_APIME NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 4L >pir||S52969 NADH
            dehydrogenase chain 4L - honeybee mitochondrion (SGC4) >gi|829008
            (L06178) NADH dehydrogenase subunit 4L [Apis mellifera ligustica]
            Length = 87

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 1.8, P = 0.84
 Identities = 22/69 (31%), Positives = 38/69 (55%), Frame = -2

Query:   342 LSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLF 163
             +  +F+++ LF  +F    WY + + F  F I      +  F+ +I +L + +G  I  +
Sbjct:     1 MKLLFVMMLLFF-MFL---WY-YNVNFLSFLI------LMEFL-VITVLFFIIGYEINSW 48

Query:   162 LFLIFL--SIC 136
             LFLIFL  S+C
Sbjct:    49 LFLIFLVFSVC 59


>gnl|PID|e308403 (Z74105) ORF YDL058w [Saccharomyces cerevisiae]
            Length = 1268

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 1.8, P = 0.84
 Identities = 26/107 (24%), Positives = 54/107 (50%), Frame = +1

Query:    37 SISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRK-EYKKKKKKYIISNKILKHID-N 210
             S+  + + + + +DE   K+K++ + EDK   S ++  +Y + +K+   S KI + +D  
Sbjct:   730 SVESETVKIKELQDECNFKEKEVSELEDKLKASEDKNSKYLELQKE---SEKIKEELDAK 786

Query:   211 IDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTN 357
               +LK + + +I    K          R+KK + +   N +E+ +K  N
Sbjct:   787 TTELK-IQLEKITNLSKAKEKSESELSRLKKTSSEERKNAEEQLEKLKN 834


>pir||S49604 hypothetical protein 126 - euglenid (Astasia longa)
            >gnl|PID|e156256 (X82630) ata start [Astasia longa]
            Length = 125

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 1.8, P = 0.84
 Identities = 24/71 (33%), Positives = 39/71 (54%), Frame = -2

Query:   285 WYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFV 106
             W  F I F + F+  I  ++F F++ I  L Y     I+ F+F IFLS+   IF +  F+
Sbjct:    66 WTRFGIRFGIRFLIFILKYIFYFIFDI--LCY-----IYWFIFSIFLSL---IFNI--FI 113

Query:   105 YVFLFIDFFIF 73
             YV + + + +F
Sbjct:   114 YVKIILLYIVF 124


>gi|1890788 (U88491) NADH dehydrogenase 1 [Flexamia atlantica]
            Length = 310

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 1.9, P = 0.85
 Identities = 34/119 (28%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLI-LPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F   L   + S  +FFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLVDSYSFISYYNFHFPLWLIVLSLPIFFCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVIFLGSDLCSLVFYIKLVLMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890802 (U88498) NADH dehydrogenase 1 [Flexamia decora]
            Length = 310

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 1.9, P = 0.85
 Identities = 35/119 (29%), Positives = 50/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIF-SK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SF+  F+F      IF S  LF C+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFMSYFNFHFSVWLIFISMPLFLCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYMKLVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890820 (U88507) NADH dehydrogenase 1 [Flexamia minima]
            Length = 310

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 1.9, P = 0.85
 Identities = 34/119 (28%), Positives = 50/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  + F   L   + S  +FFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFISYYDFNFSLWLILISLPIFFCWLSCSMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLLFYIKLVLMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890840 (U88517) NADH dehydrogenase 1 [Flexamia stylata]
            Length = 310

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 1.9, P = 0.85
 Identities = 35/119 (29%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIF-SK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SF+  +SF      IF S   FFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFMSYYSFHFSVWLIFISMPHFFCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S+ CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSNLCSLLFYMKLVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>pir||B21124 Bkm-like sex-determining region hypothetical protein CS314 - fruit
            fly (Drosophila melanogaster) (fragment)
            Length = 105

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.9, P = 0.86
 Identities = 22/84 (26%), Positives = 51/84 (60%), Frame = -2

Query:   282 YIFQITFFLFFINTINSHVF*FVYI-IYMLQYF-VGNNIFLFLFL-IFLSIC*HIFLVLL 112
             Y+  I ++L +++   S +F  +Y+ IY+  Y  +  +I+L + L I+LS    I+ + L
Sbjct:    23 YLTSI-YWLIYLSIFIS-IFISIYLSIYLSIYLSIYLSIYLSIHLSIYLSTYQSIY-IYL 79

Query:   111 FVYVFLFIDFFIFLL*YNHIIITDRCM 31
             ++Y+ ++I  ++ +  Y +I ++  C+
Sbjct:    80 YIYISIYISTYLSIYIYLYIYLSS-CL 105

 Score = 65 (22.9 bits), Expect = 6.2, P = 1.0
 Identities = 22/86 (25%), Positives = 51/86 (59%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN-- 178
             S++L+ I+ +IYL I +       IF I+ +L    +I   ++  +Y+   L  ++    
Sbjct:    21 SIYLTSIYWLIYLSIFIS------IF-ISIYLSIYLSIYLSIYLSIYLSIHLSIYLSTYQ 73

Query:   177 NIFLFLFLIFLSIC*HIFL-VLLFVYVFL 94
             +I+++L+ I++SI    +L + +++Y++L
Sbjct:    74 SIYIYLY-IYISIYISTYLSIYIYLYIYL 101


>gi|1151158 (U43145) repeat organellar protein [Plasmodium chabaudi]
            Length = 1939

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 2.0, P = 0.86
 Identities = 31/112 (27%), Positives = 54/112 (48%), Frame = +1

Query:    19 MNRPHTSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISN--KI 192
             +   H   + D +  L Q+DE++    +  K E+  N+  +  +     KK I+    K 
Sbjct:  1066 LKEEHKESASDLVEKLYQKDEEVKNSNN--KIEELTNVIKDLNDSIMCYKKQILEEVEKR 1123

Query:   193 LKHIDNIDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRT 354
              ++ + I+KLK V  N + +   K  LE      IKKLNK++++ K    K+ T
Sbjct:  1124 NEYNEEINKLKIVQ-NEMKDMNDKKILEK--ENEIKKLNKKLSNYKVFETKENT 1174


>sp|Q09286|YQK2_CAEEL HYPOTHETICAL 59.9 KD PROTEIN C56G2.2 IN CHROMOSOME III
            >gi|726414 (U23177) C56G2.2 gene product [Caenorhabditis elegans]
            Length = 539

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 2.0, Sum P(2) = 0.86
 Identities = 25/90 (27%), Positives = 42/90 (46%), Frame = +1

Query:    31 HTSISDDNMVVLQQEDEKIDKQKD-----IDKKEDK----KNMSTNRKEYKKKKKKYIIS 183
             H +  D  +V   +E +K  KQK+     IDKK ++    K      +E KK+ ++ ++ 
Sbjct:   237 HVAAGDSGVVSEHKEHDKKTKQKNDEPVSIDKKSEEIEVPKQAGVVNEEPKKQSEETVVE 296

Query:   184 NKILKHIDNIDKLKYVGINRIDEKQKKSYLEN 279
              + +K  +   KLK      +    KK  LEN
Sbjct:   297 EQFVKKEE--PKLKSAPTPLLTMPSKKKVLEN 326

 Score = 45 (15.8 bits), Expect = 2.0, Sum P(2) = 0.86
 Identities = 8/30 (26%), Positives = 17/30 (56%), Frame = +1

Query:   259 KKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             + S ++  P   ++ L +Q N N+  +K+K
Sbjct:   377 ESSDIDRSPASPLRHLQQQHNKNRSSQKRK 406


>gi|2314724 (AE000652) toxR-activated gene (tagE) [Helicobacter pylori]
            Length = 312

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 2.1, P = 0.87
 Identities = 24/87 (27%), Positives = 50/87 (57%), Frame = +1

Query:    52 NMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKIL-KHIDNIDKLKY 228
             +++VL QE + IDKQ  +  KE +K   TN K    +  +++   ++  + I++++++  
Sbjct:    47 SLLVLNQEIKNIDKQHALITKEFEKKKETNEK-LSLQMDEFLDDLQLSGERINDLEEV-- 103

Query:   229 VGINRIDE-KQKKSYLENIPGGRIKKLNK 312
             VG+NR +E K++ ++   +    I  L K
Sbjct:   104 VGVNRPEEEKEEGNFSSRLDVAGITGLQK 132


>gi|2547186 (AF023537) NADH dehydrogenase subunit 4L [Simulium vittatum]
            Length = 74

  Minus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 2.1, P = 0.88
 Identities = 14/41 (34%), Positives = 24/41 (58%), Frame = -3

Query:   215 SILSICFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFC 93
             ++LS+ F +L   ++ F F + +FL  + FF   FL+ S C
Sbjct:    31 TLLSLQFIVLS--LFLFLFEILNFLNYENFFSMMFLTFSVC 69


>pir||S20422 zinc-binding protein - rat >gi|57506 (X64053) zinc binding protein
            [Rattus norvegicus]
            Length = 106

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 2.1, P = 0.88
 Identities = 21/88 (23%), Positives = 41/88 (46%), Frame = +1

Query:    97 KDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQK-KSYL 273
             KD+ +K+DK      RKE KK+  +  +  + ++      KL+ +    + E +K +   
Sbjct:    15 KDLKEKKDKVEEKAGRKERKKEVVEVCVRRRRMELRRRKKKLQRMERMMMKETKKDEEEE 74

Query:   274 ENIPGGRIKKLNKQINDNKDERKKKRTN 357
             E    G ++K   +  D  D +++K  N
Sbjct:    75 EEEDEGPVRKRTAEEEDEADPKRQKTEN 102


>gnl|PID|e317373 (Z79755) F43G9.12 [Caenorhabditis elegans]
            Length = 640

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 2.1, Sum P(2) = 0.88
 Identities = 21/72 (29%), Positives = 41/72 (56%), Frame = +1

Query:    79 EKIDKQKDIDKKEDKKNMSTNRK---EYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +KI K++ + K EDKK  +   K   +Y+ K  K+I +++  ++ +N+D +    I+ + 
Sbjct:    94 DKIVKKEKLSK-EDKKTKNERHKYLDKYRDKSAKHISNSESYEYEENLD-IDAEAISSVS 151

Query:   250 EKQKKSYLENIPGGR 294
              K   ++ E IP  R
Sbjct:   152 NKFNSAF-EGIPDSR 165

 Score = 40 (14.1 bits), Expect = 2.1, Sum P(2) = 0.88
 Identities = 7/23 (30%), Positives = 16/23 (69%), Frame = +1

Query:   292 RIKKLNKQINDNKDERKKKRTNM 360
             RI++ ++ +N  K+E++K   N+
Sbjct:   347 RIQERDEALNFRKEEKRKLEQNI 369


>gnl|PID|e304571 (Z35851) ORF YBL091c [Saccharomyces cerevisiae]
            Length = 72

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 2.1, P = 0.88
 Identities = 16/52 (30%), Positives = 30/52 (57%), Frame = +1

Query:    16 IMNRPHTSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK 171
             I N P + + + N+     E+E +++Q D  K ++   + + +K+ KKKKKK
Sbjct:     6 IENSPASDLKELNL-----ENEGVEQQ-DQAKADESDPVESKKKKNKKKKKK 51

 Score = 58 (20.4 bits), Expect = 2.8, P = 0.94
 Identities = 16/52 (30%), Positives = 27/52 (51%), Frame = +1

Query:    16 IMNRPHTSISD---DNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKK 165
             I N P + + +   +N  V QQ+  K D+   ++ K+ KKN    +K+   KK
Sbjct:     6 IENSPASDLKELNLENEGVEQQDQAKADESDPVESKK-KKNKKKKKKKSNVKK 57


>gnl|PID|e275694 (Z81068) F25H5.a [Caenorhabditis elegans]
            Length = 548

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.2, P = 0.88
 Identities = 16/60 (26%), Positives = 37/60 (61%), Frame = +1

Query:    43 SDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNR-KEYKKKKKKYIISNKILKHIDNIDK 219
             S+D+++ +++   K D +K +DKK+  K +S  + +E KK++ K +   K +   +++D+
Sbjct:    92 SEDDLLDVKKTASKEDDKKRMDKKDPSKKLSKEKLREEKKEQSKKVNKEKKMNKSESVDE 151


>pir||S34959 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 - Crithidia
            oncopelti mitochondrion (SGC6) >gi|12881 (X56015) NADH
            dehydrogenase subunit 4 [Crithidia oncopelti]
            Length = 437

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 2.2, P = 0.89
 Identities = 32/96 (33%), Positives = 49/96 (51%), Frame = -3

Query:   359 IFVLFFFL-SSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL 183
             I V+F  L    + F+ LF  L  P    S  LFF F++ R I   F L I+S   +I+ 
Sbjct:    86 IDVVFIILIDDFVCFMILFESLFFPICFVS--LFFNFNN-RFIFAIFYLVIVSSISSIMC 142

Query:   182 EIIYFFFFFLYSFL----FVDI-FFLSSFLSMSFCLSIF 81
              +I     F ++ L    F+DI FF S +L++   + +F
Sbjct:   143 IMICIIIIFHFNVLNLQSFIDICFFDSLYLAIYIWILLF 181

 Score = 76 (26.8 bits), Expect = 4.2, P = 0.99
 Identities = 37/121 (30%), Positives = 54/121 (44%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRL---IPTYFNLSILS-ICFN 192
             I + F F   L+ F  +F   +L   I S   +FC     +   I   F + I   +CF 
Sbjct:    45 INIWFIFFMGLIVFFLVF---LLTRKIVSYSKYFCIVCTYIFIYIDVVFIILIDDFVCFM 101

Query:   191 ILLEIIYF-------FFFFLYSFLFVDIFFLS--SFLSMSFCLSIFSSSCCSTTILS--S 45
             IL E ++F       FF F   F+F  IF+L   S +S   C+ I         +L+  S
Sbjct:   102 ILFESLFFPICFVSLFFNFNNRFIFA-IFYLVIVSSISSIMCIMICIIIIFHFNVLNLQS 160

Query:    44 LIDVC 30
              ID+C
Sbjct:   161 FIDIC 165


>pir||C64468 hypothetical protein MJ1348 - Methanococcus jannaschii >gi|1591990
            (U67574) M. jannaschii predicted coding region MJ1348
            [Methanococcus jannaschii]
            Length = 336

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 2.3, P = 0.90
 Identities = 21/57 (36%), Positives = 32/57 (56%), Frame = +1

Query:   139 NRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQKKSYLENIPGGRIKKLN 309
             N+K+Y K  + + +SNKI K  +N+ K  Y G+   +E  K+    NI  G IKK +
Sbjct:    31 NKKDYDKAIEYFSLSNKIFK--ENVPKCDYYGLR--EEAYKEILNNNIEEG-IKKFD 82


>gnl|PID|e349668 (Z99292) hypothetical protein [Schizosaccharomyces pombe]
            Length = 230

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 2.4, P = 0.90
 Identities = 32/93 (34%), Positives = 41/93 (44%), Frame = -3

Query:   260 FCFSSIRLIPTY---FNLSILSICFNILLEIIYFFFFFL-YSFLFVDIFFLS-------- 117
             F  S  R  P +   F  S LS+ F  LL   +F  FFL +SF F  +FFLS        
Sbjct:    90 FPLSQKRPFPNFLHPFTGSELSL-FRCLLLFFFFLLFFLSFSFSFSFLFFLSQIFIVYFS 148

Query:   116 SFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIM 15
             SF  + F    F   C   + L SL  +  L I+
Sbjct:   149 SFPILHFLFFFFLCVCVFLSFLFSLSHLLSLAIL 182

 Score = 75 (26.4 bits), Expect = 2.5, P = 0.92
 Identities = 23/65 (35%), Positives = 29/65 (44%), Frame = -2

Query:   264 FFLFFINTINSHVF*FVYIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFID 85
             F LFF++   S  F F      + YF    I  FLF  FL +C  +FL  LF    L   
Sbjct:   122 FLLFFLSFSFSFSFLFFLSQIFIVYFSSFPILHFLFFFFLCVC--VFLSFLFSLSHLLSL 179

Query:    84 FFIFL 70
               +FL
Sbjct:   180 AILFL 184


>sp|P48278|YC38_CYAPA HYPOTHETICAL 33.3 KD PROTEIN YCF38 >gi|1016112 (U30821)
            ycf38 gene product [Cyanophora paradoxa]
            Length = 290

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 2.4, P = 0.91
 Identities = 44/122 (36%), Positives = 54/122 (44%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLI---LPPGI------FSK*LFFCFSSIRLIPTYFNLSIL 207
             + V FFFL  L+  I  FS L+   LP  I      F   L   FSS  L P  F  S L
Sbjct:   163 LIVSFFFLFLLIIGITTFSILLALLLPTHIELIAVIFVLNLPLLFSSTALAPLDFMPSWL 222

Query:   206 SI--CFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDV 33
              I  C N L   I    F LYS       F SS   +SF    FS +   + I+  + D+
Sbjct:   223 QIISCLNPLTYTIEPIRF-LYSHS--SWLFSSSLFELSF----FSINIGQSLIILIIFDL 275

Query:    32 CGLFIMVKI 6
              G  +  KI
Sbjct:   276 VGFLLFKKI 284


>pir||D64506 hypothetical protein MJ1654 - Methanococcus jannaschii >gi|1592343
            (U67606) M. jannaschii predicted coding region MJ1654
            [Methanococcus jannaschii]
            Length = 225

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 2.4, P = 0.91
 Identities = 23/116 (19%), Positives = 59/116 (50%), Frame = +1

Query:     7 IFTIMNRPHTSISDDNMV--VLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYII 180
             I  ++ RP T   +  ++  ++++ DE+  K +D++ K+ +K +    + Y+++ ++  +
Sbjct:    98 IVDVIGRPRTYDGEKYIMAEIIRKRDERWIKLRDLEIKKTRKYLLERAELYEEENEEMSL 157

Query:   181 SNKILKHIDNIDKLKYVGINRIDEKQKKSYLE-----NIPGGRIKKLNKQINDNKD 333
               ++   I N D +K   +  I+   + +Y E     NIP   ++K   ++ ++ D
Sbjct:   158 EEEVYTEILNSDVIKDKILAIIENVGEITYEELAEKINIPEEDLEKYLSELKESGD 213


>gi|476024 (L32150) carbamoyl phosphate synthetase II [Plasmodium falciparum]
           Length = 2391

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 2.4, P = 0.91
 Identities = 26/93 (27%), Positives = 47/93 (50%), Frame = +1

Query:     4 HIFTIMNRPHTSISDDNMVVLQQED--EKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYI 177
             H   + NR  T+     MV  ++E   EK  ++  ++KK  +KNM  N+ + K KK  + 
Sbjct:  1639 HYNRLNNRRSTNERMMLMVNNEKESNHEKGHRRNGLNKKNKEKNMEKNKGKNKDKKNYHY 1698

Query:   178 ISNKILKHIDNIDKLKYVGINRIDEKQKKSYLEN 279
             +++K      N + ++    N +D+  KK Y E+
Sbjct:  1699 VNHKRNNEY-NSNNIESKFNNYVDDINKKEYYED 1731


>pir||S30782 integrin homolog - yeast (Saccharomyces cerevisiae)
            Length = 1726

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 2.5, P = 0.92
 Identities = 26/107 (24%), Positives = 54/107 (50%), Frame = +1

Query:    37 SISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRK-EYKKKKKKYIISNKILKHID-N 210
             SI  + + + + +DE   K+K++ + EDK   S ++  +Y + +K+   S KI + +D  
Sbjct:  1182 SIESETVKIKELQDECNFKEKEVSELEDKLKASEDKNSKYLELQKE---SEKIKEELDAK 1238

Query:   211 IDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTN 357
               +LK + + ++    K          R+KK + +   N +E+ +K  N
Sbjct:  1239 TTELK-IQLEKVTNLSKAKEKSESELSRLKKTSSEERKNAEEQLEKLKN 1286


>gi|1890814 (U88504) NADH dehydrogenase 1 [Flexamia huroni]
            Length = 310

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 2.6, P = 0.93
 Identities = 34/119 (28%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SF+  ++F   L   + S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFMSYYNFHFTLWLIVVSLPLFFCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSDLCSLFFYIKLVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890828 (U88511) NADH dehydrogenase 1 [Flexamia prairiana]
            Length = 310

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 2.6, P = 0.93
 Identities = 35/119 (29%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICL--FSFLILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICF 195
             I + FF L    SFI    F F +   G+ S  +FFC+ S  +     T F+ S      
Sbjct:   149 ILLCFFLLVDSYSFISYYNFQFSLWLIGL-SMPIFFCWLSCCMAESNRTPFDFSEGESEL 207

Query:   194 NILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIM 15
                  + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI 
Sbjct:   208 VSGFNVEYGGGGF--ALLFISEYSSIIFISMITCVIFLGSDLCSLIFYMKLVLMCFLFIW 265

Query:    14 VK 9
             V+
Sbjct:   266 VR 267


>gi|1890838 (U88516) NADH dehydrogenase 1 [Flexamia serrata]
            Length = 310

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 2.6, P = 0.93
 Identities = 34/119 (28%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF-LILPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SF+  ++F   L   + S  LFFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFMSYYNFHFTLWLIVVSLPLFFCWLSCCMAESNRTPFDFSEEESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSHLCSLFFYIKLVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gnl|PID|e264286 (Z79755) F43G9.10 [Caenorhabditis elegans]
            Length = 466

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 2.6, P = 0.93
 Identities = 24/92 (26%), Positives = 49/92 (53%), Frame = +1

Query:    70 QEDEKIDKQKDIDKK-EDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             QE EK +K+K+I KK ED+K     ++E  K  +K +   +  +     D++    +   
Sbjct:   238 QEAEK-EKEKEILKKIEDEKRAEERKRESAKLVEKVLQEEEAAEKRKTEDRVDLSSVLTD 296

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKK 345
             DE +  +Y       +++++ K++  N+DER++
Sbjct:   297 DETENMAY----EAWKLREM-KRLKRNRDEREE 324


>gi|1397347 (U61956) R13H7.1 gene product [Caenorhabditis elegans]
            Length = 298

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 2.6, P = 0.93
 Identities = 23/70 (32%), Positives = 40/70 (57%), Frame = -2

Query:   279 IFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN-NIFLFL---FLIFLSIC*HIFLVLL 112
             IF+++  L FIN+ N  VF  VY+I++ +    N N ++ +   + I + +C   F  LL
Sbjct:    86 IFEVSAQLNFINSFN-RVF-SVYVIFLYEKVFSNFNTYIMICMAYAIAIVMC-TTFYELL 142

Query:   111 FVYVFLFIDFFIF 73
               Y++   D +IF
Sbjct:   143 ECYLYFHADLWIF 155


>sp|P25386|USO1_YEAST INTRACELLULAR PROTEIN TRANSPORT PROTEIN USO1 >gi|4778
            (X54378) Uso1 protein [Saccharomyces cerevisiae]
            Length = 1790

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 2.6, P = 0.93
 Identities = 26/107 (24%), Positives = 54/107 (50%), Frame = +1

Query:    37 SISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRK-EYKKKKKKYIISNKILKHID-N 210
             S+  + + + + +DE   K+K++ + EDK   S ++  +Y + +K+   S KI + +D  
Sbjct:  1252 SVESETVKIKELQDECNFKEKEVSELEDKLKASEDKNSKYLELQKE---SEKIKEELDAK 1308

Query:   211 IDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTN 357
               +LK + + +I    K          R+KK + +   N +E+ +K  N
Sbjct:  1309 TTELK-IQLEKITNLSKAKEKSESELSRLKKTSSEERKNAEEQLEKLKN 1356


>pir||S67593 transport protein USO1 - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e253003 (Z74106) ORF YDL058w [Saccharomyces cerevisiae]
            Length = 1790

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 2.6, P = 0.93
 Identities = 26/107 (24%), Positives = 54/107 (50%), Frame = +1

Query:    37 SISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRK-EYKKKKKKYIISNKILKHID-N 210
             S+  + + + + +DE   K+K++ + EDK   S ++  +Y + +K+   S KI + +D  
Sbjct:  1252 SVESETVKIKELQDECNFKEKEVSELEDKLKASEDKNSKYLELQKE---SEKIKEELDAK 1308

Query:   211 IDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTN 357
               +LK + + +I    K          R+KK + +   N +E+ +K  N
Sbjct:  1309 TTELK-IQLEKITNLSKAKEKSESELSRLKKTSSEERKNAEEQLEKLKN 1356


>bbs|162669 (S76367) heat shock protein 90, hsp90, Bm14=excretory/secretory
            antigen [Brugia malayi, male, adult, Peptide Partial, 72 aa]
            [Brugia malayi]
            Length = 72

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 2.8, P = 0.94
 Identities = 16/53 (30%), Positives = 30/53 (56%), Frame = +1

Query:    13 TIMNRPHTSISDDNMVVLQQEDEKIDKQKDI-DKKEDKKNMSTNRKEYKKKKKK 171
             T+       +SDD     +++++K  K+ +I D  ED++    ++K+  KKKKK
Sbjct:    19 TVEKERDKEVSDDEAEEEKKDEDKEKKEGEIEDVGEDEEE---DKKDKDKKKKK 69

 Score = 57 (20.1 bits), Expect = 3.7, P = 0.97
 Identities = 14/54 (25%), Positives = 29/54 (53%), Frame = +1

Query:    13 TIMNRPHTSISDDNMVVLQQEDEKIDKQKDI-----DKKEDKKNMSTNRKEYKK 159
             T+       +SDD     +++++K  K+ +I     D++EDKK+    +K+ K+
Sbjct:    19 TVEKERDKEVSDDEAEEEKKDEDKEKKEGEIEDVGEDEEEDKKDKDKKKKKIKE 72


>gi|2622752 (AE000921) phosphoserine phosphatase [Methanobacterium
            thermoautotrophicum]
            Length = 495

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 2.8, P = 0.94
 Identities = 22/102 (21%), Positives = 56/102 (54%), Frame = +1

Query:    55 MVVLQQEDEKIDKQKDIDKKEDKKN-----MSTNRKEYKKKKKKYII-SNKILKHIDNID 216
             ++ +Q++DE  +K  ++ KK ++ +     +S   + Y +K  +Y   +++I K  D   
Sbjct:   352 LMKIQEDDETREKALELRKKSEEYHEKVVALSEEAQGYHEKMLEYFRKTDEIRKKADEAH 411

Query:   217 KLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             + K++   R+  ++ + +   +  G I+++N++IN  + E +  R
Sbjct:   412 E-KFLEFRRMASEKHEEFKSTL--GEIRQINERINALRSENRSAR 453


>gi|437639 (L04159) [Plasmodium falciparum 3' end.], gene product [Plasmodium
           falciparum]
           Length = 503

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 2.9, P = 0.94
 Identities = 21/111 (18%), Positives = 62/111 (55%), Frame = +1

Query:    16 IMNRPHTSISD--DNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNK 189
             +++  +  I D  D  ++L++E+E+ ++++    K++++     R E +K++K+ +   K
Sbjct:    26 LLSHNNNDIKDLGDEKLILKEEEERKERERLEKAKQEEERKERERIEKEKQEKERLEREK 85

Query:   190 ILKHIDNIDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
               + +   ++L+     R +++QK+  L+     R++K  +++   + ER ++
Sbjct:    86 -QEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQK-EEELKRQEQERLER 136


>gi|2314527 (AE000636) competence locus E (comE3) [Helicobacter pylori]
            Length = 417

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 2.9, P = 0.94
 Identities = 42/116 (36%), Positives = 58/116 (50%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILL- 183
             +F+L + L  LL F+  F F     G+       CF  +RL+   F L IL+ C  I L 
Sbjct:   202 VFLLGYLL--LLDFLPSF-FRAFLMGLLG--FLACFFGVRLLS--FKLLILACCIAIALL 254

Query:   182 -EIIYFFFFFL------YSFLFV---DIFF-LSSFLSMSFCLSIFSSSCCSTTILSSLID 36
              ++++   F L      Y FLF+    IFF  SSFL  SF     + S  +   L+ LI 
Sbjct:   255 PKLLFSVGFLLSVCGVWYIFLFLKHTQIFFKTSSFLMRSFQ----AISLSALVFLNMLII 310

Query:    35 VCGLFIM 15
             V   F M
Sbjct:   311 VHAFFPM 317


>gi|2313448 (AE000551) H. pylori predicted coding region HP0345 [Helicobacter
            pylori]
            Length = 111

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 2.9, P = 0.94
 Identities = 15/38 (39%), Positives = 26/38 (68%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK-YI 177
             +Q+ EK DKQ+   K+E +++ S  ++E KK+K+  YI
Sbjct:    27 EQKQEKQDKQEQKPKQEKEESKSKEQEENKKQKRSSYI 64


>gi|1066807 (L47285) heat shock protein 82 [Anopheles albimanus] >gi|1066808
            (L47285) heat shock protein 82 [Anopheles albimanus]
            Length = 721

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 3.0, P = 0.95
 Identities = 22/79 (27%), Positives = 42/79 (53%), Frame = +1

Query:    40 ISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMS-TNRKEYKKKKKKYIISNKILKHIDNID 216
             +SDD     + ED+K +++K+ DKK+D+  +      + KK KKK  +  K  +  + ++
Sbjct:   220 VSDD-----EAEDDKKEEKKEEDKKDDEPKLEDAEDDDDKKDKKKKTVKVKYTED-EELN 273

Query:   217 KLKYVGINRIDEKQKKSYLE 276
             K K +     D+  ++ Y E
Sbjct:   274 KTKPIWTRNADDISQEEYGE 293


>gnl|PID|e293723 (Y10137) homologue [Mycoplasma mycoides]
            Length = 412

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 3.1, P = 0.95
 Identities = 31/106 (29%), Positives = 53/106 (50%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDK---KNMSTNRKEYKKKKKKYI-ISNKILKHIDNI----DK-L 222
             +E +K +KQK+ DKK +K   K+     K+ KK  KKY    ++  + ++++    D  +
Sbjct:    84 KEKKKREKQKEKDKKVEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGM 143

Query:   223 KYV--GINRIDEKQKK-SYLENIPGGRIKKLNKQINDNKDERKKKR 351
             K V    N + +K K+ +  ENI    ++ L +   DN    KK R
Sbjct:   144 KMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWTNKKYR 189


>gi|806319 (M22580) unknown protein [Saccharomyces cerevisiae]
           Length = 210

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 3.2, Sum P(2) = 0.96
 Identities = 21/84 (25%), Positives = 45/84 (53%), Frame = +1

Query:   106 DKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYV-GINRIDEKQKKSYLENI 282
             D++ED++      K+ +++K++    NK+     +I  L+Y+  +  +    +KS LE  
Sbjct:   114 DEEEDEEEDEEEGKDGEERKEEEEEENKLEDKDSSITLLEYIIRLTSLQSNDQKSILEVS 173

Query:   283 PGGRIKKLNKQIND-NKDERKKKRTN 357
                  ++L+  +ND N + RK + +N
Sbjct:   174 D----ERLSIYLNDENTNSRKDRISN 195

 Score = 42 (14.8 bits), Expect = 3.2, Sum P(2) = 0.96
 Identities = 11/34 (32%), Positives = 22/34 (64%), Frame = +1

Query:    37 SISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMST 138
             S+S   ++ L+++D  +   K ID+ +DK+N S+
Sbjct:    59 SVSG-KLLRLEEQDSPVLVLK-IDRSDDKENESS 90


>gi|347377 (L22179) MLL-AF4 der(11) fusion protein [Homo sapiens]
           >prf||1919460A MLL-AF4 fusion protein [Homo sapiens]
           Length = 2311

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 3.2, Sum P(2) = 0.96
 Identities = 20/52 (38%), Positives = 31/52 (59%), Frame = +1

Query:    79 EKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVG 234
             EK DK ++ D++ +K+N   +RKE K+KK   I S+  L  +  + K K VG
Sbjct:   910 EK-DKSRERDREREKENKRESRKE-KRKKGSEIQSSSALYPVGRVSKEKVVG 959

 Score = 41 (14.4 bits), Expect = 3.2, Sum P(2) = 0.96
 Identities = 9/33 (27%), Positives = 18/33 (54%), Frame = +1

Query:   253 KQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             +Q+K+  +  P G+     K+ +D+  +  KKR
Sbjct:  1882 RQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKR 1914


>bbs|83873 neurofilament protein M [rats, Peptide Partial, 435 aa]
           Length = 435

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 3.3, P = 0.96
 Identities = 23/101 (22%), Positives = 49/101 (48%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYK------KKKKKYIISNKILKHIDNIDKLKY 228
             Q+E+EK++++K++  KE  K     +KE K      KKK +  +  K ++ +  I K   
Sbjct:   217 QKEEEKVEEKKEV-AKESPKEEKVEKKEEKPKDVPDKKKAESPVKEKAVEEMITITKSVK 275

Query:   229 VGINRIDEKQKKSYLENIPGGRIKK--LNKQINDNKDERKKK 348
             V + +  +++K    E +     ++    +++ D   +  KK
Sbjct:   276 VSLEKDTKEEKPQQQEKVKEKAEEEGGSEEEVGDKSPQESKK 317


>sp|P24889|NU2M_CAEEL NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 2 >pir||S26030 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - Caenorhabditis
            elegans mitochondrion (SGC4) >gi|559500 (X54252) ND2 protein (AA 1
            - 282) [Caenorhabditis elegans]
            Length = 282

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 3.3, P = 0.96
 Identities = 29/82 (35%), Positives = 44/82 (53%), Frame = -3

Query:   341 FLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC--FN-ILLEIIY 171
             FL+ LL    L S  IL   +F   L  C+  I ++ +Y NL I+S    FN I+L + +
Sbjct:   112 FLTILLQIFWLSSVYIL---LFG--LLICYVQIFVMKSYKNLLIISSTESFNWIVLGVFF 166

Query:   170 FFF--FFLYSFLFV-DIFFLSSFLSMS 99
               F  F+L+ + FV  +  +S F   S
Sbjct:   167 SMFNTFYLFIYYFVLMVLLISKFSKTS 193


>sp|P06266|NU6C_MARPO NADH-PLASTOQUINONE OXIDOREDUCTASE CHAIN 6, CHLOROPLAST
            >pir||DELVN6 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 6 -
            liverwort (Marchantia polymorpha) chloroplast >gi|11726 (X04465)
            ORF191 [Marchantia polymorpha]
            Length = 191

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 3.4, P = 0.97
 Identities = 26/79 (32%), Positives = 41/79 (51%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             +LFL F+F+ I L   L N       QI   L ++  +N  +   V +I   QY   +N 
Sbjct:    36 ALFLGFVFVCISLLYLLLNADFVAAAQI---LIYVGAVNVLIIFAVMLINKKQY---SNF 89

Query:   171 FLFLFL---IFLSIC*HIFLVL 115
             F++  +   I L++C  IFL+L
Sbjct:    90 FVYWTIGDGITLTLCTSIFLLL 111


>sp|P39532|YJU2_YEAST HYPOTHETICAL 12.9 KD PROTEIN IN PRP21-UBP12 INTERGENIC
            REGION >pir||S46629 probable membrane protein YJL202c - yeast
            (Saccharomyces cerevisiae) >gi|547590 (X77688) hypothetical protein
            J0323 [Saccharomyces cerevisiae] >gi|1008424 (Z49478) ORF YJL202c
            [Saccharomyces cerevisiae]
            Length = 115

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 3.4, P = 0.97
 Identities = 27/68 (39%), Positives = 35/68 (51%), Frame = -3

Query:   221 NLSILSICFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCL----SIFSSSCCSTTI 54
             NL IL   F+   E  +  FF L S   + + FL   LS  FCL    +IFSSS     +
Sbjct:    23 NLYILLANFDFH-EAYFLLFFNLVSPTALILRFLP-LLSPPFCLPWSDTIFSSSFVGLIL 80

Query:    53 LSSLIDVCGL 24
              ++LI VC L
Sbjct:    81 SNNLIPVCTL 90


>pir||S67087 hypothetical protein YOR195w - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e252389 (Z75103) ORF YOR195w [Saccharomyces cerevisiae]
            Length = 821

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 3.5, P = 0.97
 Identities = 31/108 (28%), Positives = 55/108 (50%), Frame = +1

Query:    22 NRPHTSISDDNMVVLQQEDEKID---KQ-KDIDKKEDKKNMSTNRKEYKKKKKKYIISNK 189
             N    ++S+D      ++DEKI    KQ +D  +K + K   TN++     +  YI  + 
Sbjct:   704 NNNSVTLSNDQK---DRDDEKIKSLGKQVQDWKEKYEAKEKDTNKRLKLLAEDLYIQYSS 760

Query:   190 ILKHIDNIDKLKYVGINRIDEKQKKSYLENIP-GGRIKKLNKQINDNKDERKK 345
               KH   +  LK    N+   K  +  LEN      I++LNKQ++  ++E+++
Sbjct:   761 --KHEQKVKLLKKGYENKYQNKFDQLNLENKTLSEEIEQLNKQLSSEREEKQE 811


>pir||S72689 probable membrane protein Q0225 - yeast (Saccharomyces cerevisiae)
            mitochondrion (SGC2)
            Length = 107

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 3.5, P = 0.97
 Identities = 15/40 (37%), Positives = 30/40 (75%), Frame = -2

Query:   219 FVYII-YMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYV 100
             ++Y+I YM  Y + N IF ++F I++SI  +I+++ +F+Y+
Sbjct:    32 YMYMIHYMYMYMMINTIF-YMF-IYMSI--YIYILYMFIYM 68


>gi|2313204 (AE000533) H. pylori predicted coding region HP0119 [Helicobacter
            pylori]
            Length = 461

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 3.5, P = 0.97
 Identities = 22/109 (20%), Positives = 60/109 (55%), Frame = +1

Query:    34 TSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNI 213
             ++I  +N + ++Q+ +K +++K   +K +++   T +++ K +++K   SN     I+  
Sbjct:   153 SNIETNNQIKVEQKQQKTEQEK---QKTEQEKQKTEQEKQKTEQEKQKTSN-----IETN 204

Query:   214 DKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
             +++K      +++KQ+K+  E     + K+  +Q     ++ K+K +N+
Sbjct:   205 NQIK------VEQKQQKTEQEKQKTEQEKQKTEQEKQKTEQEKQKTSNI 247


>gi|495840 (L19851) NADH dehydrogenase [Graminella sonora]
           Length = 45

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.6, P = 0.97
 Identities = 13/27 (48%), Positives = 18/27 (66%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYS 147
             Y  LS+  I F ILL+++ F+ FFL S
Sbjct:    19 YLPLSLNYIFFFILLKLLCFYHFFLXS 45


>gi|496230 (L19861) NADH dehydrogenase [Reventazonia sp.]
           Length = 46

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.6, P = 0.97
 Identities = 11/28 (39%), Positives = 18/28 (64%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  L++  ICF I L+++  + FFL S+
Sbjct:    19 YLPLALNYICFFIFLKMLCIYHFFLXSY 46


>pir||S44136 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - yeast
            (Candida parapsilosis) mitochondrion (SGC3) (fragment) >gi|996061
            (X75676) NADH dehydrodgenase subunit 2 [Candida parapsilosis]
            Length = 40

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.6, P = 0.97
 Identities = 12/33 (36%), Positives = 21/33 (63%), Frame = -3

Query:   224 FNLSI-LSICFNILLEIIYFFFFFLYSFLFVDI 129
             +NL I  S+ F I L +++F  +F+Y F  +D+
Sbjct:     2 YNLPINKSLAFVISLLLVFFITYFVYIFNLLDV 34


>gi|2314322 (AE000622) tetracycline resistance protein tetA(P), putative
            [Helicobacter pylori]
            Length = 386

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 3.6, P = 0.97
 Identities = 34/113 (30%), Positives = 55/113 (48%), Frame = -3

Query:   353 VLFFFLSSLLSFICL-FSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICF--NILL 183
             +L ++ ++ L  I       IL P + SK L    S I L+ T+F+  +L   +   +L 
Sbjct:     6 ILAYYGANFLLIIAQSLPHAILTPLLLSKGL--SLSEILLVQTFFSFCVLVAEYPSGVLA 63

Query:   182 EIIYFFFFFLYS--FL---FVDIFFLSSFLSMSFCLSIFS--SSCCSTTILSSLI 39
             +++     FL S  FL   F  + F  SF+ M     ++   S+C S TI +SLI
Sbjct:    64 DLMSRKNLFLVSNAFLIASFSFVLFFDSFIFMLLAWGLYGLYSACSSGTIEASLI 118


>sp|P44300|YH36_HAEIN HYPOTHETICAL PROTEIN HI1736 >pir||D64041 hypothetical
            protein HI1736 - Haemophilus influenzae (strain Rd KW20)
            >gi|1574594 (U32846) H. influenzae predicted coding region HI1736
            [Haemophilus influenzae]
            Length = 77

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.7, P = 0.97
 Identities = 17/68 (25%), Positives = 34/68 (50%), Frame = -2

Query:   225 F*FV-YIIYMLQYFVGNNIFLFLFLIFLSIC*HIFLVLLFVYVFLFIDFFIFLL*YNHII 49
             F F+ ++ YM  +FV  + FLF  ++ L I   I  +L  +Y  +   + + LL    ++
Sbjct:     3 FNFIEFLGYMATFFVAAS-FLFKSIVHLRIVNSIGAILFVIYSLIITAYPVALLNAFLVV 61

Query:    48 ITDRCMWSI 22
             +    +W +
Sbjct:    62 VNIYQLWRL 70


>pir||S60816 M protein precursor - Streptococcus pyogenes (serotype M44)
            (fragment) >gi|1235823 (U11964) emml gene product [Streptococcus
            pyogenes]
            Length = 70

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.7, P = 0.97
 Identities = 12/41 (29%), Positives = 25/41 (60%), Frame = +1

Query:    31 HTSISDDNMVVLQQEDEKIDKQKDIDK--KEDKKNMSTNRK 147
             +  +SD+N ++ +++DE + K   +DK  KE    ++ N+K
Sbjct:    30 YDKLSDENDILREKQDEYLTKIDGLDKENKEYASQLAKNQK 70


>gi|1890794 (U88494) NADH dehydrogenase 1 [Flexamia celata]
            Length = 310

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 3.8, P = 0.98
 Identities = 34/119 (28%), Positives = 51/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIF-SK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SF+  ++F      IF S  LF C+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLLDSYSFMSYYNFHFSVWLIFISMPLFLCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S+ CS      L+ +C LFI V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCVVFLGSNLCSLLFYMKLVFMCFLFIWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gi|1890812 (U88503) NADH dehydrogenase 1 [Flexamia graminea]
            Length = 310

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 3.8, P = 0.98
 Identities = 34/119 (28%), Positives = 50/119 (42%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLI-LPPGIFSK*LFFCFSSIRLIP---TYFNLSILSICFN 192
             I + FF L    SFI  ++F   L   IFS  +FFC+ S  +     T F+ S       
Sbjct:   149 ILLCFFLLVDSYSFISYYNFQFSLWLIIFSLPIFFCWLSCCMAESNRTPFDFSEGESELV 208

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
                 + Y    F  + LF+  +    F+SM  C+    S  CS      L+ +C L   V
Sbjct:   209 SGFNVEYGGGGF--ALLFISEYSSIIFISMITCIIFLGSDLCSLLFYIKLVFMCVLIYWV 266

Query:    11 K 9
             +
Sbjct:   267 R 267


>gnl|PID|e284877 (Z83246) ZK795.a [Caenorhabditis elegans]
            Length = 387

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 3.8, P = 0.98
 Identities = 27/98 (27%), Positives = 45/98 (45%), Frame = +1

Query:    64 LQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILK--HIDNIDKL--KYV 231
             L+QE +K  +QK  +K E       + K  K +K +     ++LK  H  N  K+  K  
Sbjct:   207 LEQEKQKKHEQKTAEKSEKAVKPEASEKSVKSEKSEKPQKAELLKCKHEPNFSKIWKKSS 266

Query:   232 GINRIDEKQKKSYLENIPG--GRIKKLNKQINDNKDER 339
              I     ++ K  +E      G+  +L  ++N+ KDER
Sbjct:   267 KIAWPKNQELKGKVEEASDIVGKTHRLLSRVNELKDER 304


>sp|P05513|NU1M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 1 >pir||S07752 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 1 - Paramecium
            tetraurelia mitochondrion (SGC6) >gi|578767 (X15917) ND1 protein
            (AA 1-261) (unusual start codon) [Paramecium aurelia]
            Length = 261

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 4.0, P = 0.98
 Identities = 31/89 (34%), Positives = 44/89 (49%), Frame = -3

Query:   335 SSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSI-LSICF-NI--LLEIIYF 168
             +SLLS   LF   ++  G FSK  +   + +R      NL I L I F N+  L+E   F
Sbjct:   106 ASLLSI--LFGLCVMLTGYFSKNKYSVMAGLRAAILMLNLEIFLGIVFLNVCFLVESFSF 163

Query:   167 FFFFLYSFLFVDIF---FLSSFLSMSFCLSI 84
               F +Y  +F  IF   FL S + + F L +
Sbjct:   164 AAFAVYQEIFWLIFLFFFLLSNILLVFLLEV 194


>pir||A41464 hemolysin secretion protein CylB - Enterococcus faecalis
            >gi|148309 (M38052) cytolysin B transport protein [Enterococcus
            faecalis] >gi|559862 (L37110) clyB [Plasmid pAD1]
            Length = 714

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 4.1, P = 0.98
 Identities = 28/99 (28%), Positives = 46/99 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             F  +FF   +LSF+     L++P  I +K       S + IPTY  L IL+  F++L  +
Sbjct:   152 FKRYFFSLIILSFVSQLLLLLIP--IATKYSIDNIRSFQEIPTYVLLLILTSFFSVLYVV 209

Query:   176 IYFFFFFLYSFLF-VDIFFLSSFLSMSFCLSIFSSSCCST 60
              Y     +  F +  D   + S++   F + +   S  ST
Sbjct:   210 QYLKSSVVAEFQYEFDFKLMFSYIDKLFSMPLMYFSNRST 249


>gi|309695 (M77713) major merozoite surface antigen [Plasmodium falciparum]
           >gi|309699 (M77715) major merozoite surface antigen [Plasmodium
           falciparum] >gi|309704 (M77718) major merozoite surface antigen
           [Plasmodium falciparum] >gi|309706 (M77719) major merozoite surface
           antigen [Plasmodium falciparum] >gi|309717 (M77725) major merozoite
           surface antigen [Plasmodium falciparum]
           Length = 213

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 4.2, P = 0.99
 Identities = 28/107 (26%), Positives = 59/107 (55%), Frame = +1

Query:    49 DNMVVLQQEDEK-IDKQKDIDKKEDKKNMSTNRKE---YKKK-KKKYIISNKILKHIDNI 213
             +N+  L +E +K IDK K+  K+E+KK +   + +   Y K+ ++ + + + + K ID +
Sbjct:    97 ENINELIEESKKTIDKNKNATKEEEKKKLYQAQYDLSIYNKQLEEAHNLISVLEKRIDTL 156

Query:   214 DKLKYVG--INRIDEKQKKSYLE--NIPGGRIKKLNKQINDNKDERKK 345
              K + +   +++I+E +        N P   + K NK+I +++ E K+
Sbjct:   157 KKNENIKELLDKINEIKNPPPANSGNTPNTLLDK-NKKIEEHEKEIKE 203


>gi|309708 (M77720) major merozoite surface antigen [Plasmodium falciparum]
           >gi|309733 (M77733) major merozoite surface antigen [Plasmodium
           falciparum]
           Length = 213

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 4.2, P = 0.99
 Identities = 28/107 (26%), Positives = 59/107 (55%), Frame = +1

Query:    49 DNMVVLQQEDEK-IDKQKDIDKKEDKKNMSTNRKE---YKKK-KKKYIISNKILKHIDNI 213
             +N+  L +E +K IDK K+  K+E+KK +   + +   Y K+ ++ + + + + K ID +
Sbjct:    97 ENINELIEESKKTIDKNKNATKEEEKKKLYQAQYDLFIYNKQLEEAHNLISVLEKRIDTL 156

Query:   214 DKLKYVG--INRIDEKQKKSYLE--NIPGGRIKKLNKQINDNKDERKK 345
              K + +   +++I+E +        N P   + K NK+I +++ E K+
Sbjct:   157 KKNENIKELLDKINEIKNPPPANSGNTPNTLLDK-NKKIEEHEKEIKE 203


>gnl|PID|e310324 (Z81557) F59A1.e [Caenorhabditis elegans]
            Length = 321

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 4.3, P = 0.99
 Identities = 24/100 (24%), Positives = 49/100 (49%), Frame = -1

Query:   361 SYLFSFSFFHLYYHLFVYLAF*SSPLVYFPNNFFFVFHQYD*-FPRILICLYYLYASIFC 185
             +Y F    F ++  +F ++   + P+++F N  + +F +     PR  I  +Y+  +  C
Sbjct:     3 NYRFLMLIFSIFGIIFAFIDGTNQPMLHFYNGAYVIFSRNVLGLPR-QISFWYIALNCAC 61

Query:   184 WK*YISFSFSYIPFYLLTYFS-CPPFCLCLFVYRFFHLLVVV 62
             +   I     Y   +L  + + C P  L +F Y +F +LV++
Sbjct:    62 YG-MIMLLLVY--HFLYRFLAVCHPTRLKIFSYPYFSILVLI 100


>sp|P35600|GNF1_DROME GERMLINE TRANSCRIPTION FACTOR 1 >gi|304728 (L17340)
            transcription factor [Drosophila melanogaster]
            Length = 986

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 4.3, P = 0.99
 Identities = 25/95 (26%), Positives = 50/95 (52%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKY-VGINRI 246
             +E++K  K++   +++ KK + T+R+   KK+K+   + K LK+ +  D  K+ V     
Sbjct:   320 KEEKKSPKKEHSSEEKGKKEVKTSRRSSDKKEKE---ATK-LKYGEKHDIAKHKVKEEHT 375

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRT 354
               K+ K  L ++P   +K + K+ +  K+     RT
Sbjct:   376 SPKETKDKLNDVPAVTLK-VKKEPSSQKEHPPSPRT 410


>gi|2121267 (U97685) replication factor C large subunit [Drosophila
            melanogaster]
            Length = 986

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 4.3, P = 0.99
 Identities = 25/95 (26%), Positives = 50/95 (52%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKY-VGINRI 246
             +E++K  K++   +++ KK + T+R+   KK+K+   + K LK+ +  D  K+ V     
Sbjct:   320 KEEKKSPKKEHSSEEKGKKEVKTSRRSSDKKEKE---ATK-LKYGEKHDIAKHKVKEEHT 375

Query:   247 DEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRT 354
               K+ K  L ++P   +K + K+ +  K+     RT
Sbjct:   376 SPKETKDKLNDVPAVTLK-VKKEPSSQKEHPPSPRT 410


>sp|P24873|NU6M_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 6 >pir||S26014 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 6 - pig roundworm
            mitochondrion (SGC4) >gi|559488 (X54253) ND6 protein [Ascaris suum]
            Length = 144

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 4.5, P = 0.99
 Identities = 30/92 (32%), Positives = 46/92 (50%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGN 178
             IC LFLS IF+I+  F  L      Y+  +T F +F+  + S VF F    Y +   V  
Sbjct:    52 ICLLFLSGIFVILVYFSSLSKIG--YV--VTPF-YFVGGVLS-VFFFYPFFYSVTDVVAV 105

Query:   177 NIFLFLFLIFLSIC*HIFLVLLFV-YVFLFIDF 82
             N F F     L +   IF+++ F+ +   F++F
Sbjct:   106 NNFYFSVYWMLLVW-VIFVLIFFMNFTSYFLNF 137


>bbs|121322 (S51495) 42 kda antigenic protein [Anisakis simplex, larvae,
            Peptide Partial, 284 aa] [Anisakis simplex]
            Length = 284

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 4.5, P = 0.99
 Identities = 30/101 (29%), Positives = 48/101 (47%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLF---SFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNI 189
             +F L      LL   CL    +  I+    +S+ L   F    L+  Y +L +LSI F++
Sbjct:    58 VFALHVAFVDLLVICCLLYHIAMTIVAYPRYSR-LHLVFFPPHLL--YLSLGMLSISFSV 114

Query:   188 LLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTT 57
              +     F   +++   +  F L  F++ S C SI SSSC S +
Sbjct:   115 PIR----FTVTVFTSSVLSSFILPLFIT-SICCSIVSSSCVSVS 153


>sp|P15583|NU5M_LEITA NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >pir||A26696 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Sauroleishmania
            tarentolae mitochondrion (SGC6) (fragment)
            Length = 101

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 4.6, P = 0.99
 Identities = 23/88 (26%), Positives = 38/88 (43%), Frame = -2

Query:   351 SLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVGNNI 172
             +LF  FI  II  +I   +   +Y F I   +FF          F++ I+   YF+   +
Sbjct:    13 ALFTVFIIDIIKFYI--LSGVIFYFFNIDCIMFFWRVFLFITMGFLFFIFTTWYFICFYM 70

Query:   171 FLFLFLIFLSIC*HIFLVLLFVYVFLFI 88
             ++ +F+  L I     L     +  LFI
Sbjct:    71 YICMFIWNLVIYFRYNLKYCLFFCMLFI 98


>pir||S36956 cytochrome-c oxidase (EC 1.9.3.1) chain III - Herpetomonas
            mariadeanei mitochondrion (SGC6)
            Length = 288

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 4.6, P = 0.99
 Identities = 31/115 (26%), Positives = 54/115 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             F  ++F   L + + + +FL+   G+F   + F F        +F    + ICF + L +
Sbjct:   138 FCFYWFYLDLFNLL-INTFLLFVSGLFLNFVLFLF--------WFRFFCMVICF-LWLGL 187

Query:   176 IYFFFFFLYSFL--FVDIFFLSS---FLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMV 12
             + F F FL + L  FV +F   S   F S+ FC+ I   +     +    I +C  F+ +
Sbjct:   188 L-FGFMFLCNQLWEFVILFVTCSCGLFGSILFCIDILHFTHVFLGVFLMFICICRCFVFL 246

 Score = 72 (25.3 bits), Expect = 9.4, P = 1.0
 Identities = 33/111 (29%), Positives = 58/111 (52%), Frame = -2

Query:   357 ICSLFLSFI-FIIIYLFI*LFNPPPWYIFQITF-FLFFINTINSHVF*FVY--------I 208
             +  LFL+F+ F+  + F  +     W    + F F+F  N +   V  FV         I
Sbjct:   159 VSGLFLNFVLFLFWFRFFCMVICFLW--LGLLFGFMFLCNQLWEFVILFVTCSCGLFGSI 216

Query:   207 IYMLQYFVGNNIFLFLFLIFLSIC*-HIFLVLLFVYVFLFIDFFIFLL*YNHIIITDRCM 31
             ++ +      ++FL +FL+F+ IC   +FL +   +VFL++   + L  Y H +  D C+
Sbjct:   217 LFCIDILHFTHVFLGVFLMFICICRCFVFLCMDTRFVFLYV---VVL--YWHFV--D-CV 268

Query:    30 W 28
             W
Sbjct:   269 W 269


>pir||S36953 cytochrome-c oxidase (EC 1.9.3.1) chain III - Herpetomonas
            samuelpessoai mitochondrion (SGC6)
            Length = 288

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 4.6, P = 0.99
 Identities = 31/114 (27%), Positives = 53/114 (46%), Frame = -3

Query:   356 FVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFSSIRLIPTYFNLSILSICFNILLEI 177
             FV ++F   L + + + +FL+   G+F   LFFC         +F   +  +C  +L   
Sbjct:   138 FVFYWFFIDLFNLL-INTFLLFVSGLFCNFLFFC--------VWFRFFV--VCVFVLWCG 186

Query:   176 IYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIM 15
             I F F FL++ L+    F   F++ S C  +F S      +L     V G+F++
Sbjct:   187 ILFGFLFLWNQLWE---FALLFVTCS-C-GVFGSILFVIDLLHFTHVVLGVFLL 235


>gi|833602 (X54277) cardiac tropomyosin [Coturnix coturnix]
           Length = 284

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 4.8, P = 0.99
 Identities = 29/111 (26%), Positives = 61/111 (54%), Frame = +1

Query:     4 HIFTIMNRPHTSISDDNMVVLQQEDEKIDKQKDI------DKKEDKKNMSTNRKEYKKKK 165
             HI    +R +  ++   +V+L+ E E+ +++ ++      D +E+ KN++ N K  + + 
Sbjct:   153 HIAEEADRKYEEVAR-KLVILEGELERAEERAEVSEVKCSDLEEELKNVTNNLKSLEAQS 211

Query:   166 KKYIISNKILKHIDNIDKLKYVGINRIDEKQKKS-YLENIPGGRIKKLNKQINDNKDE 336
             +KY  S K  K+ + I  L     +++ E + ++ + E      + KL K I+D +DE
Sbjct:   212 EKY--SEKEDKYEEEIKILS----DKLKEAETRAEFAER----SVAKLEKSIDDLEDE 259


>gi|1045294 (Z66527) cardiac tropomyosin [Salmo trutta]
            Length = 284

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 4.8, P = 0.99
 Identities = 29/111 (26%), Positives = 60/111 (54%), Frame = +1

Query:     4 HIFTIMNRPHTSISDDNMVVLQQEDEKIDKQKDI------DKKEDKKNMSTNRKEYKKKK 165
             HI    +R +  ++   +V+L+ E E+ +++ ++      D +E+ KN++ N K  +   
Sbjct:   153 HIAEEADRKYEEVAR-KLVILEGELERAEERAEVSELKCSDLEEELKNVTNNLKSLEASS 211

Query:   166 KKYIISNKILKHIDNIDKLKYVGINRIDEKQKKS-YLENIPGGRIKKLNKQINDNKDE 336
             +KY  S K  K+ + I  L     +++ E + ++ + E      + KL K I+D +DE
Sbjct:   212 EKY--SEKEDKYEEEIKVLS----DKLKEAETRAEFAERT----VAKLEKSIDDLEDE 259


>gi|1209836 (U45422) minus strand repeat motif-containing gene [Borrelia
            burgdorferi]
            Length = 174

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 4.9, P = 0.99
 Identities = 39/113 (34%), Positives = 55/113 (48%), Frame = -3

Query:   347 FFFLSSLLSFICLFSFLILPPGIFSK*-LFFC--FSSIRLIPTYFNLSILSICFNILLEI 177
             FF   S+L+F   FS L +   + SK  + FC  FS++ ++ +   LSIL+  F   L I
Sbjct:    49 FFSTLSILAFK-FFSTLSI---LVSKLDISFCKFFSTVSILVS--KLSILAFKFFSTLSI 102

Query:   176 IYFFFFFLYSFL-----------FVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVC 30
               F FF   S L           F  +  L+S L +SFC   FS+       LS+ I  C
Sbjct:   103 FKFKFFSTVSILVSKLSILAFKFFSTVSILTSKLDISFC-KFFSTLSILKIRLSNFISNC 161


>gi|1890808 (U88501) NADH dehydrogenase 1 [Flexamia flexulosa]
            Length = 310

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 5.2, P = 0.99
 Identities = 31/119 (26%), Positives = 52/119 (43%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSF------LILPPGIFSK*LFFCFSSIRLIPTYFNLSILSIC 198
             I + FF L    SFI  ++F      +++   +F   L  C +    +P  F+     + 
Sbjct:   149 ILLCFFLLLDSYSFISYYNFHFSLWLILISMPLFLCWLSCCMAESNRMPFDFSEGESELV 208

Query:   197 FNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFI 18
                 +E  Y    F  + LF+  +    F+SM  C+    S+ CS      L+ +C LFI
Sbjct:   209 SGFNVE--YGGGGF--ALLFISEYSSIIFISMITCVVSLGSALCSLLFYIKLVFMCFLFI 264

Query:    17 MVK 9
              V+
Sbjct:   265 WVR 267


>sp|P41512|TOP1_XENLA DNA TOPOISOMERASE I >gi|214834 (L07777) DNA topoisomerase
            I [Xenopus laevis]
            Length = 829

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 5.3, P = 0.99
 Identities = 26/80 (32%), Positives = 49/80 (61%), Frame = +1

Query:    70 QEDEKIDKQKDIDK-KEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRI 246
             ++ EK  K+KDI+K KE +K+   + +++K+K  +      + KH D  +K K+   +R 
Sbjct:    94 RDGEK-HKEKDIEKHKEVEKHRVKDGEKHKEKDVEKHKEKDVEKHRDG-EKHKHRDKDR- 150

Query:   247 DEKQKKSYLENIPGG-RIKKLN 309
              EK+K+  +++  GG ++KK N
Sbjct:   151 -EKKKEEKMKSSSGGVKVKKEN 171


>sp|P37748|RFC_ECOLI O-ANTIGEN POLYMERASE >pir||I69644 probable O-antigen
            polymerase - Escherichia coli >gi|508243 (U09876) putative
            O-antigen polymerase [Escherichia coli] >gi|510254 (U03041) orf4;
            similar to Swiss-Prot Accession Number P26479 [Escherichia coli]
            >gnl|PID|d1016601 (D90841) O-antigen polymerase. [Escherichia coli]
            >gnl|PID|d1016613 (D90842) O-antigen polymerase. [Escherichia coli]
            >gi|1788347 (AE000294) o-antigen polymerase [Escherichia coli]
            Length = 388

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 5.3, Sum P(2) = 0.99
 Identities = 13/41 (31%), Positives = 26/41 (63%), Frame = -3

Query:   191 ILLEIIYFFFFFLYSFLFVDIFFL---SSFLSMSFCLSIFS 78
             I ++I Y +F + +SF+F    F+   SS++ ++ C+ +FS
Sbjct:   339 ISVKIFYSYFIYTFSFIFYHESFMTNISSWIQITLCIIVFS 379

 Score = 40 (14.1 bits), Expect = 5.3, Sum P(2) = 0.99
 Identities = 10/24 (41%), Positives = 13/24 (54%), Frame = -2

Query:   288 PWYIFQITFFLFFINTINSHVF*F 217
             P   FQ  +F    N+ +SHVF F
Sbjct:   250 PIIAFQEFYFQQVSNSASSHVFWF 273

 Score = 39 (13.7 bits), Expect = 6.6, Sum P(2) = 1.0
 Identities = 15/47 (31%), Positives = 22/47 (46%), Frame = -2

Query:   357 ICSLFLSFIFIIIYLFI*LFNPPPWYIFQITFFLFFIN-TINSHVF*F 217
             + S+FL   FI +YL   +F P       I F L  +   I S ++ F
Sbjct:     5 VISVFLITAFICLYLKKDIFYPA--VCVNIIFALVLLGYEITSDIYAF 50

 Score = 38 (13.4 bits), Expect = 8.3, Sum P(2) = 1.0
 Identities = 10/24 (41%), Positives = 13/24 (54%), Frame = -2

Query:   336 FIFIIIYLFI*LFNPPPWYIFQIT 265
             F+ II Y FI   N    Y++ IT
Sbjct:   196 FMVIISYAFIVGVNRVKHYVYLIT 219


>gi|552199 (M63269) malaria antigen [Plasmodium falciparum]
           Length = 138

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 5.3, P = 1.0
 Identities = 28/77 (36%), Positives = 40/77 (51%), Frame = +1

Query:   112 KEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQKKSYLENIPGG 291
             KE KK+ + NRK+ +K+ KK    NK LK I+  +K+ +      + KQ     +N    
Sbjct:    21 KEKKKDSNENRKKKQKEDKKNPNDNK-LKKIEYTNKITHF-FKAKNNKQNNVTHKN--NE 76

Query:   292 RIKKLN-KQI-NDNKDERK 342
              IK  N K I NDN  + K
Sbjct:    77 DIKNDNSKDIKNDNSKDIK 95


>pir||A56577 microtubule-associated protein MAP 1B - rat (fragment)
            Length = 2364

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 5.6, P = 1.0
 Identities = 25/83 (30%), Positives = 44/83 (53%), Frame = +1

Query:    64 LQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGIN- 240
             +++E    D +K++ KK++KK +    KE KK+ KK  IS  I K     D  K   +  
Sbjct:   602 VKKETPLKDAKKEV-KKDEKKEVKKEEKEPKKEIKK--ISKDIKKSTPLSDTKKPAALKP 658

Query:   241 RIDEKQKKSYLENIPGGRIKKLNK 312
             ++ +K++ +  E I  G++K   K
Sbjct:   659 KVAKKEEPTKKEPIAAGKLKDKGK 682


>sp|Q05019|S40B_CHITE SALIVARY GLAND SP38-40.B PROTEIN PRECURSOR >pir||S33820
            secretory protein Sp38-40.B - midge (Chironomus tentans) >gi|7110
            (X70063) 38-40.B gene product [Chironomus tentans]
            Length = 253

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 5.7, P = 1.0
 Identities = 33/109 (30%), Positives = 53/109 (48%), Frame = +1

Query:    67 QQEDEKIDKQKD-IDKKEDKKNMSTN-RKEYKKKKKKYIISNKILKHID-NIDKLKYVGI 237
             + E E I  QK+  +KKE +K      +K+ K K+KK++  ++ILK      +K    G 
Sbjct:    54 EYEIEVIKHQKEKTEKKEKEKKAHVEIKKKIKNKEKKFVPCSEILKDEKLECEKNATPGY 113

Query:   238 NRIDE-KQKKSYLE------NIPGGRI-----KKLNKQINDNKDERKKK 348
               + E K+ +S+ E       IPG +      KK+ K I   K++  KK
Sbjct:   114 KALFEFKESESFCEWECDYEAIPGAKKDEKKEKKVVKVIKPPKEKPPKK 162


>gi|1657845 (U73211) cold acclimation protein WCOR410c [Triticum aestivum]
            Length = 259

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 5.7, Sum P(2) = 1.0
 Identities = 13/46 (28%), Positives = 25/46 (54%), Frame = +1

Query:    13 TIMNRPHTSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKE 150
             T+ ++ H S S  +    ++E+E ID   ++ K++ KK +    KE
Sbjct:    73 TLFSKLHRSSSSSSSSSDEEEEEVIDDNGEVIKRKKKKGLKEKLKE 118

 Score = 45 (15.8 bits), Expect = 5.7, Sum P(2) = 1.0
 Identities = 13/38 (34%), Positives = 20/38 (52%), Frame = +1

Query:   202 IDNID-KLKYVGINRIDEKQKKSYLENI----PGGRIK 300
             ++ ID  +K      + E++KK +LE I    PGG  K
Sbjct:   153 VEKIDGDVKTEAAPAVPEEEKKGFLEKIKEKLPGGHKK 190


>gi|2088720 (AF003139) F53G12.8 gene product [Caenorhabditis elegans]
            Length = 323

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 5.8, P = 1.0
 Identities = 19/57 (33%), Positives = 30/57 (52%), Frame = +1

Query:    61 VLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYII--SNKILKHIDNIDKLK 225
             +  +E    D++KD  K E KK+    +KE KKK+   II   N   +HI  I+ ++
Sbjct:   222 IAPKEKPAADEKKDEKKDESKKDKKEEKKEEKKKENDEIIIPRNLFARHIWCIESIE 278


>gi|1123053 (U41994) F59A6.2 gene product [Caenorhabditis elegans]
            Length = 118

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 6.0, P = 1.0
 Identities = 14/31 (45%), Positives = 22/31 (70%), Frame = +1

Query:    79 EKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK 171
             E+I KQ D  K+E++K  +  RKE K+K+K+
Sbjct:    68 ERIQKQSD-QKREERKLAAQKRKELKQKQKE 97


>gi|2353181 (AF015565) VacA [Dictyostelium discoideum]
            Length = 708

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 6.0, P = 1.0
 Identities = 23/106 (21%), Positives = 55/106 (51%), Frame = +1

Query:    49 DNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKL-K 225
             +N  V QQ+ ++ +K+K+ + +E    +  +  +Y+K+K +   + K ++ ++N  KL +
Sbjct:   600 NNKTVHQQQQQQKEKEKEKEDEELLDAVKFDVSKYEKEKTQKETA-KYMERLENYSKLNR 658

Query:   226 YVGINRID-----EKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
              +G +        E   K      P GR+++  +Q    + +++K+R
Sbjct:   659 RIGYSNYTAFKSFESHDKEQKSQKPKGRVQQHMQQHQQQQQQQQKQR 705


>gnl|PID|e1168590 (Z99168) hypothetical protein [Schizosaccharomyces pombe]
            Length = 144

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 6.1, P = 1.0
 Identities = 14/46 (30%), Positives = 28/46 (60%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHI 204
             ++ED K+ K+ +I+KK+  +  + N    K K+ + I+ N+I  H+
Sbjct:    92 EKEDAKVQKRLEIEKKQKDREQTRNMLSKKTKRGQPIMRNQI-NHL 136


>pir||S43286 MURF4 protein - Trypanosoma cruzi (fragment)
            Length = 64

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 6.3, P = 1.0
 Identities = 19/62 (30%), Positives = 27/62 (43%), Frame = -3

Query:   200 CFNILLEIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLF 21
             CF   L  I F F F +  LF    +L    +    L IF    C+  IL  ++D   LF
Sbjct:     7 CFLDFLVFILFIFVFCFCLLFYGFLYLLDLFAAILQLFIF----CNM-ILQLIMDFL-LF 60

Query:    20 IM 15
             ++
Sbjct:    61 LL 62

 Score = 54 (19.0 bits), Expect = 8.4, P = 1.0
 Identities = 11/33 (33%), Positives = 21/33 (63%), Frame = -2

Query:   165 FLFLIFLSIC*HIFLVLLFVYVFLFIDF-FIFLL 67
             F+F  FL     +F++ +FV+ F  + + F++LL
Sbjct:     3 FIFFCFLDFL--VFILFIFVFCFCLLFYGFLYLL 34


>sp|P21536|ATP8_SCHPO ATP SYNTHASE PROTEIN 8 (A6L) >gnl|PID|e26535 (X54421)
            ATPase 8 [Schizosaccharomyces pombe]
            Length = 48

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 6.3, P = 1.0
 Identities = 14/47 (29%), Positives = 28/47 (59%), Frame = -3

Query:   182 EIIYFFFFFLYSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSL 42
             +++ F+F  + SF F+ IF +  ++S  + L  ++    S +I+SSL
Sbjct:     3 QLVPFYFINILSFGFL-IFTVLLYISSVYVLPRYNELFISRSIMSSL 48


>gi|1809305 (U72241) histone H1-3 [Arabidopsis thaliana] >gi|1809315 (U73781)
            histone H1-3 [Arabidopsis thaliana]
            Length = 167

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 6.6, P = 1.0
 Identities = 14/36 (38%), Positives = 23/36 (63%), Frame = +1

Query:    64 LQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK 171
             ++QED++I K+        KK +S N++E K+K KK
Sbjct:   110 MKQEDKEITKRTRSSSTRPKKTVSVNKQEKKRKVKK 145


>pir||PQ0818 expressed sequence tag R80 - rape (fragment) >bbs|156141
            heat-shock protein 84 homolog {EST} [Brassica napus, Naehan, root,
            Peptide Partial, 100 aa]
            Length = 100

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 6.8, P = 1.0
 Identities = 20/56 (35%), Positives = 35/56 (62%), Frame = +1

Query:   187 KILKHIDNIDKLKYVGINRI-DEKQKKSYLENIPGGR-IKK-LNKQINDNKDERKKK 348
             K++ H+   D+L+Y+   R+ D  QK S   + P    I+K + K+I+D++DE +KK
Sbjct:    39 KMVLHLKE-DQLEYLEERRLKDLVQKHSEFISYPISLWIEKTIEKEISDDEDEEEKK 94


>pir||S61312 cap protein 1, merozoite - Plasmodium falciparum >gi|604220
            (U14189) MCP1 gene product [Plasmodium falciparum]
            Length = 361

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 6.8, P = 1.0
 Identities = 28/85 (32%), Positives = 42/85 (49%), Frame = +1

Query:    97 KDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQKKSYLE 276
             K  +KK  KKN S  +KE  KKK K   +NK      N+  LK   + +  +    S  +
Sbjct:   279 KGANKKGGKKN-SVVKKEDNKKKGK---NNKKKNKNQNLKDLKKKNV-KSGKGSVSSSNK 333

Query:   277 NIPGG---RIKKLNKQINDNKDERKKKR 351
              +P G     KK  K+I+  K++  KK+
Sbjct:   334 KLPKGLKNAAKKAGKKIDKKKEQANKKK 361

 Score = 74 (26.0 bits), Expect = 6.8, P = 1.0
 Identities = 29/89 (32%), Positives = 47/89 (52%), Frame = +1

Query:    94 QKDIDK--KEDKKNMSTNRKEYKKKKKKYIISNKILKHIDN-IDKLKYVGINRIDEKQKK 264
             +K + K  K  KKN+   +KE KKK  K    NK  K+++N + K    G N+   K K 
Sbjct:   233 KKSVKKSNKVVKKNVKV-KKEIKKKTNKKA-DNKKGKNVNNKLMKSNAKGANKKGGK-KN 289

Query:   265 SYLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
             S ++     +  K NK+ N N++ +  K+ N+
Sbjct:   290 SVVKKEDNKKKGKNNKKKNKNQNLKDLKKKNV 321


>sp|Q10175|YAV6_SCHPO PROBABLE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C27F1.06C
            (PPIASE) (ROTAMASE) >gi|1182043 (Z69368) unknown
            [Schizosaccharomyces pombe]
            Length = 362

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 6.8, P = 1.0
 Identities = 27/107 (25%), Positives = 49/107 (45%), Frame = +1

Query:    40 ISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDK 219
             ++ D     Q E+E ++K    D+  +K +    +KE K+KK    +S+ +        K
Sbjct:   175 LNSDEEDAEQAEEEILEKPVPKDEVAEKHSKDKLKKEEKEKKTAVDVSDSVN---GKKRK 231

Query:   220 LKYVGINRIDEKQKKS---YLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
              +  G     EK+ KS   Y + +  G +   +K   D    ++KKR +M
Sbjct:   232 TEPAGEGEQTEKKSKSTKTYPKQVLEGNVTVQDKVKGDGPAAKRKKRVSM 281


>gi|1513319 (U67068) CCAAT/enhancer-binding protein [Hirudo medicinalis]
            Length = 115

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 7.3, P = 1.0
 Identities = 10/41 (24%), Positives = 24/41 (58%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKI 192
             ++ +K++K ++  KK ++ N+S      KK++   I+  K+
Sbjct:     3 KKSKKVNKDEEYRKKRERNNVSVRESREKKRQNALIVEQKV 43


>gi|860681 (U27312) F26A1.5 gene product [Caenorhabditis elegans]
           Length = 89

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 7.3, P = 1.0
 Identities = 13/49 (26%), Positives = 28/49 (57%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNID 216
             ++ EK +K+ D  KK+D+K    ++ +  +KK+   I+  +   + NI+
Sbjct:     9 EKKEKEEKKADESKKKDEKKEEKSKGKEDEKKENQKIAGAVHNQMKNIN 57


>pir||I30010 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 502

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 7.4, P = 1.0
 Identities = 29/86 (33%), Positives = 40/86 (46%), Frame = -3

Query:   347 FFFLSSLLSFICLFSFLILPPGIFSK*LFF--CF--SSIRLIPTYFNLSILSICFNILLE 180
             FFF+   L F+C+  F I    I++  L F  CF      L+ T F L     C      
Sbjct:   417 FFFI---LEFLCVCLFFIFFTVIYNYFLLFFLCFVFKCFCLVDTLFLLFDFECCLVYCTF 473

Query:   179 IIYFFFFFLYSFLFVDIFFLSSFLSMSFCL 90
              +Y  F  L+   FV + FL  F+  S+CL
Sbjct:   474 CLYMCFVLLF---FV-LDFLYVFIFSSYCL 499

 Score = 75 (26.4 bits), Expect = 7.8, P = 1.0
 Identities = 30/95 (31%), Positives = 46/95 (48%), Frame = -2

Query:   357 ICSLFL-SFIFIIIYLFI*LFNPPPWYIFQITFFLFFINTINSHVF*FVYIIYMLQYFVG 181
             +C L L SF FI+ +L + LF            F+FF    N  +  F+  ++     V 
Sbjct:   409 LCLLMLTSFFFILEFLCVCLF------------FIFFTVIYNYFLLFFLCFVFKCFCLVD 456

Query:   180 NNIFLFLF---LIFLSIC*HIFLVLLFVYVFLFIDFFIF 73
                 LF F   L++ + C ++  VLLF +V  F+  FIF
Sbjct:   457 TLFLLFDFECCLVYCTFCLYMCFVLLF-FVLDFLYVFIF 494


>pir||A45669 neurofilament triplet M protein - rat >gi|205688 (M18628) NF-M
            protein [Rattus norvegicus]
            Length = 845

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 7.4, P = 1.0
 Identities = 23/101 (22%), Positives = 49/101 (48%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYK------KKKKKYIISNKILKHIDNIDKLKY 228
             Q+E+EK++++K++  KE  K     +KE K      KKK +  +  K ++ +  I K   
Sbjct:   626 QKEEEKVEEKKEV-AKESPKEEKVEKKEEKPKDVPDKKKAESPVKEKAVEEMITITKSVK 684

Query:   229 VGINRIDEKQKKSYLENIPGGRIKK--LNKQINDNKDERKKK 348
             V + +  +++K    E +     ++    +++ D   +  KK
Sbjct:   685 VSLEKDTKEEKPQQQEKVKEKAEEEGGSEEEVGDKSPQESKK 726


>gi|56752 (Z12152) Neurofilament protein middle (NF-M) [Rattus norvegicus]
          Length = 845

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 7.4, P = 1.0
 Identities = 23/101 (22%), Positives = 49/101 (48%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYK------KKKKKYIISNKILKHIDNIDKLKY 228
             Q+E+EK++++K++  KE  K     +KE K      KKK +  +  K ++ +  I K   
Sbjct:   626 QKEEEKVEEKKEV-AKESPKEEKVEKKEEKPKDVPDKKKAESPVKEKAVEEMITITKSVK 684

Query:   229 VGINRIDEKQKKSYLENIPGGRIKK--LNKQINDNKDERKKK 348
             V + +  +++K    E +     ++    +++ D   +  KK
Sbjct:   685 VSLEKDTKEEKPQQQEKVKEKAEEEGGSEEEVGDKSPQESKK 726


>sp|P12839|NFM_RAT NEUROFILAMENT TRIPLET M PROTEIN (160 KD NEUROFILAMENT
            PROTEIN) (NF-M)
            Length = 846

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 7.4, P = 1.0
 Identities = 23/101 (22%), Positives = 49/101 (48%), Frame = +1

Query:    67 QQEDEKIDKQKDIDKKEDKKNMSTNRKEYK------KKKKKYIISNKILKHIDNIDKLKY 228
             Q+E+EK++++K++  KE  K     +KE K      KKK +  +  K ++ +  I K   
Sbjct:   627 QKEEEKVEEKKEV-AKESPKEEKVEKKEEKPKDVPDKKKAESPVKEKAVEEMITITKSVK 685

Query:   229 VGINRIDEKQKKSYLENIPGGRIKK--LNKQINDNKDERKKK 348
             V + +  +++K    E +     ++    +++ D   +  KK
Sbjct:   686 VSLEKDTKEEKPQQQEKVKEKAEEEGGSEEEVGDKSPQESKK 727


>gi|833603 (X54278) cytoskeletal tropomyosin [Coturnix coturnix]
           Length = 248

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 7.4, P = 1.0
 Identities = 30/119 (25%), Positives = 65/119 (54%), Frame = +1

Query:     4 HIFTIMNRPHTSISDDNMVVLQQEDEKIDKQKDI------DKKEDKKNMSTNRKEYKKKK 165
             HI    +R +  ++   +V+L+ E E+ +++ ++      D +E+ KN++ N K  + + 
Sbjct:   117 HIAEEADRKYEEVAR-KLVILEGELERAEERAEVSEVKCSDLEEELKNVTNNLKSLEAQS 175

Query:   166 KKYIISNKILKHIDNIDKLKYVGINRIDEKQKKS-YLENIPGGRIKKLNKQINDNKDE-R 339
             +KY  S K  K+ + I  L     +++ E + ++ + E      + KL K I+D +D+  
Sbjct:   176 EKY--SEKEDKYEEEIKILS----DKLKEAETRAEFAER----SVAKLEKSIDDLEDKLA 225

Query:   340 KKKRTNM 360
             + K  N+
Sbjct:   226 QAKEENL 232


>gnl|PID|d1010105 (D50867) troponin T [Halocynthia roretzi]
            Length = 248

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 7.4, P = 1.0
 Identities = 23/95 (24%), Positives = 57/95 (60%), Frame = +1

Query:    67 QQEDEKIDKQK-DIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINR 243
             +QE+E++++ +  ++K+++++      +E +K K++     +  KH +  D+ K     +
Sbjct:    65 KQEEEQLEELRLRLEKRKEERAERLRIRE-EKTKERVAREREERKHKEEEDEKK----RK 119

Query:   244 IDEKQKKSYLENIP---GGRIKKLNK-QINDNKDERKKKR 351
              +E++KK+ + N+    GG + +  K + N  + ER+KK+
Sbjct:   120 EEEEKKKAAIANMSLHYGGYLARAEKNKPNKRQTEREKKK 159


>gi|1786037 (U72284) NADH dehydrogenase subunit 2 [Apis mellifera]
            Length = 248

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 7.4, P = 1.0
 Identities = 28/91 (30%), Positives = 47/91 (51%), Frame = -2

Query:   279 IFQITFFLFFINTINSHVF*FVYIIYMLQYFVG----N--NIFLFLFLIFLSIC*HIFLV 118
             IF  +F+  FI  +N ++F  + I+Y   YF+     N  NI  F F+ +     + FL 
Sbjct:   118 IFN-SFYFIFILELNKNMFIAMIILYSFNYFLLISFLNKFNIQNFNFMFYNKYQMYTFLT 176

Query:   117 LLFVYVFLFIDFFIFLL*YNHI--IITDRCM-W 28
             L+F Y    I F  F++ +N I  +++D+   W
Sbjct:   177 LMFNYSMYPI-FLSFVIKWNLIFMMVSDKAYNW 208


>gi|1890830 (U88512) NADH dehydrogenase 1 [Flexamia producta]
            Length = 310

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 7.4, P = 1.0
 Identities = 15/48 (31%), Positives = 25/48 (52%), Frame = -3

Query:   152 YSFLFVDIFFLSSFLSMSFCLSIFSSSCCSTTILSSLIDVCGLFIMVK 9
             ++ LF+  +    F+SM  C+    +  CS T    L+ +C LFI V+
Sbjct:   220 FALLFISEYSSIIFISMITCVIFLGADLCSLTFYIKLVLMCFLFIWVR 267


>gi|662259 (L39769) ORF1 [Plasmid pIP501]
           Length = 654

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 7.5, P = 1.0
 Identities = 25/90 (27%), Positives = 48/90 (53%), Frame = +1

Query:    16 IMNRPHTSISDDNMVVLQQEDEKI--DKQKDIDKKEDKKNMSTNRK-EYKKKKKKYIISN 186
             ++NR +  + D + + L +E E    D+ +++DK   +KN  T +  ++ K   + +  N
Sbjct:   566 VVNR-NAYLPDSDKIELSKEIENTNKDQSQELDKDVPEKNEVTVKMFQFAKSINRLLSGN 624

Query:   187 KILKHIDNIDKLKYVGINRIDEKQKKSYLENIP 285
             ++ K   N+DKL    I +   K+ +S   NIP
Sbjct:   625 QLQKK-RNLDKL----IKQTKAKKNQSLQRNIP 652


>pir||S22183 lysine/aspartic acid-rich protein - Plasmodium chabaudi >gi|9806
            (X63619) lysine-rich aspartic acid-rich protein [Plasmodium
            chabaudi]
            Length = 234

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 7.5, Sum P(2) = 1.0
 Identities = 22/84 (26%), Positives = 35/84 (41%), Frame = +1

Query:   106 DKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRIDEKQKKSYLENIP 285
             D K+D+  +   + +   K K  I+ N   K  D  D++K     + D+   K     +P
Sbjct:   100 DDKKDEVKIDEKKDDSDVKGKFVIVPNTPAKADDKKDEVKID--EKKDDSDVKGKFVIVP 157

Query:   286 GGRIKKLNKQINDNKDERKKKRTN 357
                 K   K+    KDE KK  T+
Sbjct:   158 NTPAKSEEKKDEVKKDEIKKDDTH 181

 Score = 41 (14.4 bits), Expect = 7.5, Sum P(2) = 1.0
 Identities = 9/24 (37%), Positives = 15/24 (62%), Frame = +1

Query:    58 VVLQQEDEKIDKQKDIDKKEDKKN 129
             V++     K D++KD  K +DKK+
Sbjct:     3 VIVGSAPAKPDEKKDEVKTDDKKD 26


>gnl|PID|e219154 (Z68879) K08F4.5 [Caenorhabditis elegans]
            Length = 215

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 7.8, P = 1.0
 Identities = 31/113 (27%), Positives = 58/113 (51%), Frame = +1

Query:    13 TIMNRPHTSISDDNMVVLQQED--EKIDKQKDIDKKE--DKKNMSTNRKEYKKKKKKYII 180
             T M     ++     VV ++E+  EK+ ++K+ +KK+   K+     +KE ++K++K   
Sbjct:    50 TTMGSTTANMHPAEPVVEKKEEPKEKVPEKKEEEKKDATKKEEAKEEKKEEERKEEKKEE 109

Query:   181 SNKILKHIDNIDKLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKR 351
             S +  K     +K K  G  + +E  KK   ++   G  K+  K+  D KDE +K +
Sbjct:   110 SKEGEKKNSGEEK-KNSGDEKKEEGGKK---DDAKDGEKKEEAKE-GDKKDEDQKPK 161


>sp|P28540|SECY_PAVLU PREPROTEIN TRANSLOCASE SECY SUBUNIT >pir||S23425 secY
            protein - chromophytic alga (Pavlova lutheri) chloroplast >gi|12120
            (X64732) secY gene product [Pavlova lutherii] >prf||1813203A secY
            gene [Pavlova lutherii]
            Length = 419

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 7.9, P = 1.0
 Identities = 22/63 (34%), Positives = 34/63 (53%), Frame = -3

Query:   287 PGIFSK*-LFFCFSSIRLIPTYFNLSILSICFNILLEIIYFFFFFLYSFLFVDIFFLSSF 111
             P IFS   L F  +SI+ +P   N++   I  ++ L+ I++FF FL   +F   F+    
Sbjct:   262 PIIFSSSILLFLTTSIKQLPNA-NIATRVILDSVNLQQIFYFFTFLVLIIFFSFFYTLII 320

Query:   110 LSMS 99
             LS S
Sbjct:   321 LSPS 324


>gi|2190539 (AC001229) F5I14.2 gene product [Arabidopsis thaliana]
            Length = 406

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 8.0, P = 1.0
 Identities = 29/104 (27%), Positives = 54/104 (51%), Frame = +1

Query:    49 DNMVVLQQEDEKIDKQKDIDKKEDK---KNMSTNRKEYKKKKKKYIISNKILKH-IDNID 216
             DNM  +Q+   ++  +KD  K+E+K   K +  NR E +K+KK+  +  ++LK  +    
Sbjct:   226 DNM--MQKNSSEM-AEKD-SKREEKLLLKQLEKNRCEAEKEKKR--MERQVLKEKLQQEK 279

Query:   217 KLKYVGINRIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKKRTNM 360
             + K +    +DE  K+   E     RIKK   +    +  R+K++  +
Sbjct:   280 EQKLLQKAIVDENNKEKE-ETESRKRIKKQQDESEKEQKRREKEQAEL 326


>pir||S26025 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - pig
            roundworm mitochondrion (SGC4)
            Length = 528

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 8.1, Sum P(2) = 1.0
 Identities = 26/80 (32%), Positives = 37/80 (46%), Frame = -3

Query:   254 FSSIRLIPTYFNLSILSICFNILLEIIYFFFFFL---YSFLFVDIFFLSSFLSMSFCLSI 84
             FSS  +   Y      S  F ++   ++FF  FL   YS+     FF+S F    FC   
Sbjct:   339 FSSGAVSKDYILEFFFSNFFMVVFACMFFFSVFLTFGYSYRLWKGFFMS-FSRPVFC--- 394

Query:    83 FSSSCCSTTILSSLIDVCGLFIM 15
             FSSS      LS L+ +  +F +
Sbjct:   395 FSSSVVMN-FLSLLLVLFSIFFI 416

 Score = 56 (19.7 bits), Expect = 8.1, Sum P(2) = 1.0
 Identities = 17/37 (45%), Positives = 21/37 (56%), Frame = -3

Query:   359 IFVLFFFLSSLLSFICLFSFLILPPGIFSK*LFFCFS 249
             IF  ++FLS  LSF C  S L+L    F+K   F FS
Sbjct:   151 IFSSYYFLS--LSFFCWLSSLMLLLASFTKSAQFPFS 185


>sp|P52582|VEGF_COTJA VASCULAR ENDOTHELIAL GROWTH FACTOR >pir||I51295 vascular
            endothelial growth factor - quail (fragment)
            Length = 128

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 8.2, P = 1.0
 Identities = 16/49 (32%), Positives = 25/49 (51%), Frame = +1

Query:    25 RPHTSISDDNMVVLQQEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKK 171
             +PH S    +M  LQ        +KD+  K++KK+     K  K+K+KK
Sbjct:    51 KPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKRGKGKGQKRKRKK 99


>gi|495747 (L19841) NADH dehydrogenase [Commellus comma]
           Length = 46

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 8.2, P = 1.0
 Identities = 11/28 (39%), Positives = 18/28 (64%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  I F I ++++ F+ FFL S+
Sbjct:    19 YLPLSLNYILFFIFMKLMCFYHFFLXSY 46


>gi|495834 (L19848) NADH dehydrogenase [Flexamia graminea]
           Length = 46

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 8.2, P = 1.0
 Identities = 12/28 (42%), Positives = 17/28 (60%), Frame = -3

Query:   227 YFNLSILSICFNILLEIIYFFFFFLYSF 144
             Y  LS+  I F I L+ + F+ FFL S+
Sbjct:    19 YLPLSLNYILFFIFLKTLCFYHFFLXSY 46


>gi|606881 (U12395) unknown [Trypanosoma brucei]
           Length = 74

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 8.2, P = 1.0
 Identities = 21/73 (28%), Positives = 35/73 (47%), Frame = -3

Query:   353 VLFFFLSSLLSFICLFSFLILPPGIFSK*LF-FCFSSIRLIPTYFNLSILSICFNILLEI 177
             VL FF    + F C F F+     +F   LF FCF  +      FN+ +L +CF + + +
Sbjct:     6 VLLFFYCLFVHFFC-FLFVC---DLFLCLLFSFCF--LLDFCFLFNMGLL-LCFILQILV 58

Query:   176 IYFFFFFLYSFLFV 135
             +   +    SF+ +
Sbjct:    59 LSNCYLLFSSFILL 72


>gi|1345111 (U36383) ORF72;  Method: conceptual translation supplied by author.
            [Sulfolobus islandicus]
            Length = 72

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 8.2, P = 1.0
 Identities = 13/40 (32%), Positives = 19/40 (47%), Frame = -3

Query:   245 IRLIPTYFNLSILSIC-FNILLEIIYFFFFFLYSFLFVDI 129
             + + P YF+   L+   F   L     FFFF  S +F+ I
Sbjct:     2 LTMFPFYFHYLFLAFALFLYSLSTASLFFFFFQSLIFLTI 41


>gi|495790 (L19847) NADH dehydrogenase [Exitianus exitiosus] >gi|495793
           (L19846) NADH dehydrogenase [Exitianus exitiosus] >gi|495796
           (L19845) NADH dehydrogenase [Exitianus exitiosus]
           Length = 46

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 8.4, P = 1.0
 Identities = 8/22 (36%), Positives = 14/22 (63%), Frame = -1

Query:   184 WK*YISFSFSYIPFYLLTYFSC 119
             WK Y+  S +Y+ F++L   +C
Sbjct:    16 WKCYLPMSLNYMMFFILVKLAC 37


>gi|496104 (L19854) NADH dehydrogenase [Laevicephalus sp.]
           Length = 46

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 8.4, P = 1.0
 Identities = 9/22 (40%), Positives = 14/22 (63%), Frame = -1

Query:   184 WK*YISFSFSYIPFYLLTYFSC 119
             WK Y+ F+ +Y+ F+LL    C
Sbjct:    16 WKCYLPFTLNYMLFFLLVKSMC 37


>gi|1208822 (U49945) coded for by C. elegans cDNA yk91d12.5; coded for by C.
            elegans cDNA yk91d12.3;  short region of similarity to myosin heavy
            chain [Caenorhabditis elegans]
            Length = 535

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 8.4, P = 1.0
 Identities = 27/88 (30%), Positives = 45/88 (51%), Frame = +1

Query:    70 QEDEKIDKQKDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGINRID 249
             +E EK +K+K  ++KE KK  S++++ +K   +    S++  K  +   K K    +  D
Sbjct:   153 EEKEKSEKKKSAEEKEKKKKSSSSKERHKSSDR----SSE--KSSEKSSKEKKKEKSTTD 206

Query:   250 EKQKKSYLENIPGGR-IKKLNKQINDNKD 333
             EK KKS  +  P  R  K+ +  I  N D
Sbjct:   207 EKPKKSKKD--PSERHFKRQDSMIAVNGD 233

 Score = 75 (26.4 bits), Expect = 8.4, P = 1.0
 Identities = 26/95 (27%), Positives = 42/95 (44%), Frame = +1

Query:    64 LQQEDEKIDKQ-KDIDKKEDKKNMSTNRKEYKKKKKKYIISNKILKHIDNIDKLKYVGIN 240
             +++ED+K D++ K   KK   K  +   KE  +KKK      K  K   +  K ++   +
Sbjct:   127 VKKEDKKGDEEEKSTTKKRSSKKETHEEKEKSEKKKS--AEEKEKKKKSSSSKERHKSSD 184

Query:   241 RIDEKQKKSYLENIPGGRIKKLNKQINDNKDERKKK 348
             R  EK  +         + KK  K   D K ++ KK
Sbjct:   185 RSSEKSSEK------SSKEKKKEKSTTDEKPKKSKK 214


WARNING:  HSPs involving 15 database sequences were not reported due to the
          limiting value of parameter B = 250.


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.96
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.396   0.187   0.720
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.366   0.165   0.575
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.310   0.132   0.350    same    same    same
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.365   0.169   0.686
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.365   0.173   0.637
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.357   0.163   0.536
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      119       119      10. 60 3  12 22   0.096 33
                                                  29    0.11 35
   +2      0      120       120      10. 60 3  12 22   0.097 33
                                                  29    0.11 35
   +1      0      120       120      10. 61 3  12 23    0.12 33
                                                  29    0.11 35
   -1      0      120       120      10. 60 3  12 22   0.097 33
                                                  29    0.11 35
   -2      0      120       120      10. 60 3  12 22   0.097 33
                                                  29    0.11 35
   -3      0      119       119      10. 60 3  12 22   0.096 33
                                                  29    0.11 35


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  265
  No. of states in DFA:  576 (57 KB)
  Total size of DFA:  150 KB (192 KB)
  Time to generate neighborhood:  0.01u 0.01s 0.02t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  104.44u 0.73s 105.17t  Elapsed: 00:00:27
  Total cpu time:  104.88u 0.84s 105.72t  Elapsed: 00:00:27
  Start:  Sat Feb  7 04:16:49 1998   End:  Sat Feb  7 04:17:16 1998

WARNINGS ISSUED:  1

Date: 17:24:2 on Mon 18 Dec 117.