blastx_gbnr_files/1200534_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1200534
        (373 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|e311435      (Y08926) AARP1 protein [Plasmodiu... -2   100  7.0e-05   2
A gi|885781            (U18339) D4L [Variola virus] >gi|... -2    95  0.00027   1
A pir||S48472          probable membrane protein YIL100c... -1    94  0.00035   1
A sp|P54683|TAGB_DICDI PRESTALK-SPECIFIC PROTEIN TAGB PR... -2   107  0.00078   1
A pir||S23686          hypothetical protein 3 - Plasmodi... -2    81  0.0083    1
A gi|862343            (L10908) Gcap1 gene product [Mus ... -2    74  0.045     1
A sp|P13824|ARP2_PLAFA CLUSTERED-ASPARAGINE-RICH PROTEIN... -2    84  0.050     2
A pir||S23692          hypothetical protein 9 - Plasmodi... -2    88  0.070     1
A gi|454432            (L28677) ORF4 [Tetrahymena pyrifo... +1    85  0.11      1
A gi|567922            (L36903) varI gene product [Sacch... -2    77  0.20      2
A pir||S23689          hypothetical protein 6 - Plasmodi... -2    67  0.22      1
A pir||G36856          B16L protein - variola virus (str... -2    67  0.22      1
A gi|414322            (L11172) [Plasmodium falciparum R... -2    87  0.24      2
A sp|Q03100|CYAA_DICDI ADENYLATE CYCLASE, AGGREGATION SP... -2    84  0.29      2
A gi|476024            (L32150) carbamoyl phosphate synt... -2    70  0.31      2
A gi|14022             (X14681) C-terminal NADH dehydrog... -2    65  0.35      1
A sp|P54675|P3K3_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 3 (... -2    86  0.53      1
A gi|2258330           (AF007261) RNA polymerase subunit... -2    83  0.67      2
A gi|1526991           (U41289) K7 kinesin-like protein ... -2    84  0.75      1
A gi|552132            (K01664) Bkm-like protein [Drosop... -3    60  0.82      1
A pir||C21124          Bkm-like sex-determining region h... -3    60  0.82      1
A gi|1407697           (U59916) antigen PKX101 [prolifer... -2    82  0.83      1
A pir||S14470          asparagine-rich protein (clone 28... -2    76  0.90      1
A gi|1840087           (U83280) 39 kDa antigen [Leishman... -2    77  0.94      1
A pir||S41483          RNA-directed RNA polymerase - Sac... +3    58  0.95      1
A gi|452428            (X65740) ATPase 3 [Plasmodium fal... -2    78  0.97      1
A gi|2081630           (U20661) unknown [Dictyostelium d... -2    69  0.99      3
A sp|P37492|YYBL_BACSU HYPOTHETICAL 27.9 KD PROTEIN IN C... +1    66  0.99      2
A gi|437641            (L04160) [Plasmodium falciparum 5... -2    75  0.993     1
A gi|1345111           (U36383) ORF72;  Method: conceptu... +1    56  0.995     1
A pir||S47661          topoisomerase II - Plasmodium fal... -2    64  0.996     2
A gi|343949            (J01525) var1(40.0) [Saccharomyce... -2    63  0.996     2
A gi|1658333           (U40232) exported serine/threonin... -2    82  0.997     1
A pir||S23467          hypothetical protein 2 - Plasmodi... -2    78  0.998     1
A sp|Q23868|TAGC_DICDI PRESTALK-SPECIFIC PROTEIN TAGC PR... -2    74  0.998     2
A sp|P40631|MLH_TETTH  MICRONUCLEAR LINKER HISTONE POLYP... -2    77  0.999     1
A pir||S14469          asparagine-rich protein (clone 17... -2    72  0.9997    1
A sp|P36079|YKI3_YEAST HYPOTHETICAL 23.7 KD PROTEIN IN M... -1    71  0.9998    1
A bbs|143530           (S68626) PrP=protease-resistant p... -1    54  0.9999    1
A pir||A45600          asparagine-rich blood stage antig... -2    73  0.9999    1
A pir||A44969          circumsporozoite protein precurso... -2    72  0.99994   1



>gnl|PID|e311435 (Y08926) AARP1 protein [Plasmodium falciparum]
            Length = 3844

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 7.0e-05, Sum P(2) = 7.0e-05
 Identities = 20/42 (47%), Positives = 30/42 (71%), Frame = -2

Query:   126 NKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             NK++++ K+LD +NNN+NNN    NNN  NK  N++ +SS N
Sbjct:  3610 NKILDDNKILDSNNNNNNNN----NNNGENKSWNFQNVSSYN 3647

 Score = 50 (17.6 bits), Expect = 7.0e-05, Sum P(2) = 7.0e-05
 Identities = 25/86 (29%), Positives = 40/86 (46%), Frame = -2

Query:   351 YIFMYVLIHVVISTSLQVNN-QVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIYKPKHI 175
             Y++   LI   IS SL + + Q++N+ +FI   SK  V+       I   +    K K  
Sbjct:  3351 YLYTPSLIKHFISISLIIISFQIMNE-IFIKEISKTYVRF------IFKTIQNYNKIKKY 3403

Query:   174 FCNTEKDYTYEEKIHFNKMIEEKKLLD 94
                  K Y Y +KI+ N +I   + +D
Sbjct:  3404 ITRISK-YMYFQKIYTNYIISHYEYVD 3429

 Score = 36 (12.7 bits), Expect = 0.0019, Sum P(2) = 0.0019
 Identities = 5/11 (45%), Positives = 8/11 (72%), Frame = -1

Query:   343 YVCINPCCYLH 311
             Y+C N  CY++
Sbjct:  1768 YMCKNKNCYIY 1778


>gi|885781 (U18339) D4L [Variola virus] >gi|1150673 (X72086) ORF15L; B16L in
           citation [3] [Variola virus]
           Length = 97

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.00027, P = 0.00027
 Identities = 26/83 (31%), Positives = 42/83 (50%), Frame = -2

Query:   372 IYIYIYIYIFMYVLIHVVISTSLQVNNQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGI 193
             IYIYIYIYI++Y+ I++ I   +  NNQ    N+F   NS+  +    I   + +  + I
Sbjct:     6 IYIYIYIYIYIYIYIYIYILKHM-CNNQHHFSNIFYGNNSRCPLFKSLISKALMSAPYNI 64

Query:   192 --YKPKHIFCNTEKDYTYEEKIHF 127
               Y   +   NT   +T    I++
Sbjct:    65 CVYVTSNKCINTGTHFTSRSLIYY 88

 Score = 66 (23.2 bits), Expect = 2.3, P = 0.90
 Identities = 11/21 (52%), Positives = 15/21 (71%), Frame = -1

Query:   373 YLYIYIYLYIYVCINPCCYLH 311
             Y+YIYIY+YIY+  + C   H
Sbjct:    13 YIYIYIYIYIYILKHMCNNQH 33

 Score = 63 (22.2 bits), Expect = 8.5, P = 1.0
 Identities = 10/14 (71%), Positives = 13/14 (92%), Frame = -1

Query:   373 YLYIYIYLYIYVCI 332
             Y+YIYIY+YIY+ I
Sbjct:     9 YIYIYIYIYIYIYI 22

 Score = 63 (22.2 bits), Expect = 8.5, P = 1.0
 Identities = 10/14 (71%), Positives = 13/14 (92%), Frame = -1

Query:   373 YLYIYIYLYIYVCI 332
             Y+YIYIY+YIY+ I
Sbjct:    11 YIYIYIYIYIYIYI 24


>pir||S48472 probable membrane protein YIL100c-a - yeast (Saccharomyces
            cerevisiae) >gi|558706 (Z38125) orf, len: 112, CAI: 0.07,
            overlapped by orf 36949..36826 qv [Saccharomyces cerevisiae]
            Length = 112

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.00035, P = 0.00035
 Identities = 14/21 (66%), Positives = 19/21 (90%), Frame = -1

Query:   373 YLYIYIYLYIYVCINPCCYLH 311
             Y+YIYIY+YIY+CIN C Y++
Sbjct:    61 YIYIYIYIYIYMCINVCTYMN 81

 Score = 68 (23.9 bits), Expect = 3.5, P = 0.97
 Identities = 12/17 (70%), Positives = 16/17 (94%), Frame = -2

Query:   372 IYIYIYIYIFMYVLIHV 322
             IYIYIYIYI++Y+ I+V
Sbjct:    60 IYIYIYIYIYIYMCINV 76


>sp|P54683|TAGB_DICDI PRESTALK-SPECIFIC PROTEIN TAGB PRECURSOR >gi|664840
            (U20432) TagB [Dictyostelium discoideum]
            Length = 1905

  Minus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.00078, P = 0.00078
 Identities = 33/113 (29%), Positives = 54/113 (47%), Frame = -2

Query:   360 IYIYIFMYVLIHVVISTSLQVN---NQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIY 190
             I I IF+ +   ++  T+   N   N ++N+ +  +++  I  K+K  Q     K++   
Sbjct:    18 ILILIFIGIKFELLEDTNSNRNDKFNNIINRFINYNIDDSIY-KNKQQQQQFSNKIYSNE 76

Query:   189 KPKHIFCNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEEN 25
             K K +  N   D T +  I+ N        L+ +NNN+NNN    NNNN N   N
Sbjct:    77 K-KILLKNKIIDTTIKPSININNNNNNNNKLNNNNNNNNNNNNNNNNNNNNNNNN 130

 Score = 102 (35.9 bits), Expect = 0.0026, P = 0.0026
 Identities = 34/114 (29%), Positives = 55/114 (48%), Frame = -2

Query:   360 IYIYIFMYVLIHVVISTSLQVN---NQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIY 190
             I I IF+ +   ++  T+   N   N ++N+ +  +++  I  K+K  Q     K++   
Sbjct:    18 ILILIFIGIKFELLEDTNSNRNDKFNNIINRFINYNIDDSIY-KNKQQQQQFSNKIYSNE 76

Query:   189 KPKHIFCNTEKDYTYEEKIHFNKMIEEK-KLLDRHNNNDNNNLLCVNNNNLNKEEN 25
             K K +  N   D T +  I+ N       KL + +NNN+NNN    NNNN N   N
Sbjct:    77 K-KILLKNKIIDTTIKPSININNNNNNNNKLNNNNNNNNNNNNNNNNNNNNNNNNN 131

 Score = 99 (34.8 bits), Expect = 0.0055, P = 0.0055
 Identities = 34/118 (28%), Positives = 55/118 (46%), Frame = -2

Query:   360 IYIYIFMYVLIHVVISTSLQVN---NQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIY 190
             I I IF+ +   ++  T+   N   N ++N+ +  +++  I  K+K  Q     K++   
Sbjct:    18 ILILIFIGIKFELLEDTNSNRNDKFNNIINRFINYNIDDSIY-KNKQQQQQFSNKIYSNE 76

Query:   189 KPKHIFCNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEEN----Y 22
             K K +  N   D T +  I+ N        L+ +NNN+NNN    NNNN N   N    Y
Sbjct:    77 K-KILLKNKIIDTTIKPSININNNNNNNNKLNNNNNNNNNNNNNNNNNNNNNNNNNNNNY 135

 Score = 90 (31.7 bits), Expect = 0.10, P = 0.095
 Identities = 29/69 (42%), Positives = 40/69 (57%), Frame = -2

Query:   195 IYKPKHI---FCNTEKDYTYEEKIHF-NKMIEE--KKLLDRHNNNDNNNLLCVNNNNLNK 34
             IYK K     F N  K Y+ E+KI   NK+I+   K  ++ +NNN+NNN L  NNNN N 
Sbjct:    58 IYKNKQQQQQFSN--KIYSNEKKILLKNKIIDTTIKPSININNNNNNNNKLNNNNNNNNN 115

Query:    33 EENYKILSSSN 1
               N    +++N
Sbjct:   116 NNNNNNNNNNN 126

 Score = 89 (31.3 bits), Expect = 0.19, P = 0.17
 Identities = 34/120 (28%), Positives = 55/120 (45%), Frame = -2

Query:   360 IYIYIFMYVLIHVVISTSLQVN---NQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIY 190
             I I IF+ +   ++  T+   N   N ++N+ +  +++  I  K+K  Q     K++   
Sbjct:    18 ILILIFIGIKFELLEDTNSNRNDKFNNIINRFINYNIDDSIY-KNKQQQQQFSNKIYSNE 76

Query:   189 KPKHIFCNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILS 10
             K K +  N   D T +  I+ N        L+ +NNN+NNN    NNNN N   N     
Sbjct:    77 K-KILLKNKIIDTTIKPSININNNNNNNNKLNNNNNNNNNN----NNNNNNNNNN----- 126

Query:     9 SSN 1
               N
Sbjct:   127 --N 127


>pir||S23686 hypothetical protein 3 - Plasmodium falciparum
            Length = 100

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.0084, P = 0.0083
 Identities = 18/44 (40%), Positives = 26/44 (59%), Frame = -2

Query:   126 NKMIEEKKLLDRHNNNDNNNLLCVNNNNLN---KEENYKILSSS 4
             N  +E+K  +  +NNN+NNN   V  NN+    KE NY IL+ +
Sbjct:    35 NSFVEDKADIHNNNNNNNNNNTKVLTNNITNEQKESNYVILNKN 78


>gi|862343 (L10908) Gcap1 gene product [Mus musculus] >prf||2022314A granule
           cell marker protein [Mus musculus] >prf||2022315A granule cell
           marker protein [Mus musculus]
           Length = 85

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 0.046, P = 0.045
 Identities = 11/19 (57%), Positives = 17/19 (89%), Frame = -2

Query:   372 IYIYIYIYIFMYVLIHVVI 316
             IYIYIYIYI++Y+ +H+ +
Sbjct:    55 IYIYIYIYIYLYLCMHIYV 73

 Score = 68 (23.9 bits), Expect = 0.20, P = 0.18
 Identities = 9/15 (60%), Positives = 15/15 (100%), Frame = -1

Query:   373 YLYIYIYLYIYVCIN 329
             Y+YIYIY+Y+Y+C++
Sbjct:    56 YIYIYIYIYLYLCMH 70

 Score = 65 (22.9 bits), Expect = 0.44, P = 0.35
 Identities = 13/21 (61%), Positives = 15/21 (71%), Frame = -1

Query:   373 YLYIYIYLY----IYVCINPC 323
             Y+YIYIYLY    IYVC+  C
Sbjct:    58 YIYIYIYLYLCMHIYVCLCAC 78

 Score = 63 (22.2 bits), Expect = 0.77, P = 0.54
 Identities = 11/21 (52%), Positives = 17/21 (80%), Frame = -2

Query:   372 IYIYIYIYIFMYVLIHVVI-- 316
             IYIYIYIYI++Y+ +H+ +  
Sbjct:    55 IYIYIYIYIYLYLCMHIYVCL 75

 Score = 63 (22.2 bits), Expect = 0.77, P = 0.54
 Identities = 10/22 (45%), Positives = 18/22 (81%), Frame = -1

Query:   373 YLYIYIYLYIYVCINPCCYLHL 308
             Y+YIYIY+YIY+ +  C ++++
Sbjct:    54 YIYIYIYIYIYLYL--CMHIYV 73


>sp|P13824|ARP2_PLAFA CLUSTERED-ASPARAGINE-RICH PROTEIN >pir||A23535
            clustered-asparagine-rich protein - Plasmodium falciparum
            (fragment) >gi|552179 (M13021) antigen [Plasmodium falciparum]
            Length = 451

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.052, Sum P(2) = 0.050
 Identities = 18/56 (32%), Positives = 27/56 (48%), Frame = -2

Query:   168 NTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             N   +Y    K + N M  + ++   H NN+NNN+   NNNN N   N  ++   N
Sbjct:   237 NNNNNYNNNAK-NVNDMYRDGEMSPNHLNNNNNNINNNNNNNNNNNNNNNVMFRQN 291

 Score = 37 (13.0 bits), Expect = 0.052, Sum P(2) = 0.050
 Identities = 8/16 (50%), Positives = 10/16 (62%), Frame = -2

Query:   297 NNQVVNQNVFIDVNSK 250
             NNQ   QN F++ N K
Sbjct:   179 NNQTNTQNNFMNRNMK 194


>pir||S23692 hypothetical protein 9 - Plasmodium falciparum
            Length = 518

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.072, P = 0.070
 Identities = 26/91 (28%), Positives = 45/91 (49%), Frame = -2

Query:   297 NNQVVNQNVFIDVNSKIQ-VKDKPIQVDICTKLWGIYKPKHIFCNTEKDYTYEEKIHFNK 121
             N +V N+N+F   +S  Q + D   Q  +  K++ +   +++  N + D    + ++ N 
Sbjct:   282 NLEVCNKNIFGKYSSNWQAIIDLSSQCLVLPKMFWLSLMEYLPVNKDDDRCIRKNMNPNN 341

Query:   120 MIEEKKLLDRHNNNDNNNLLCVNNNNLNKEEN 25
                  K  D +NNN+ NN    NNNN NK  +
Sbjct:   342 NNNNNKNNDNNNNNNKNN---DNNNNNNKNND 370


>gi|454432 (L28677) ORF4 [Tetrahymena pyriformis]
           Length = 271

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.12, P = 0.11
 Identities = 26/93 (27%), Positives = 51/93 (54%), Frame = +1

Query:    16 YFVIFFFIQIIVIYT*EIIIIIIVMSI*QFLFLYHFIEMYFFFISIILLRITKNVLRFVY 195
             YF+  F IQ  ++Y   ++ ++IV +   ++ LY F+EM  F + I L ++ +    F++
Sbjct:    46 YFLENFLIQFFMLY---LLYLLIVNNNLYYILLYVFMEMVLFGLFICLYQM-ELFTGFLW 101

Query:   196 PP*FSTDIYLDGLIFNLNF-GIYIYKNVLINNLV 294
                F+       L+F LN  G+++  N  +NN++
Sbjct:   102 VAEFTIIFIAVVLLFYLNVDGLHLKYNNNLNNMI 135


>gi|567922 (L36903) varI gene product [Saccharomyces cerevisiae]
           Length = 404

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.22, Sum P(2) = 0.20
 Identities = 17/36 (47%), Positives = 22/36 (61%), Frame = -2

Query:   129 FNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENY 22
             +N MI    LL+ +NNN+NNN +  NNN  N   NY
Sbjct:   272 YNNMIN---LLNNNNNNNNNNNINNNNNYNNNNNNY 304

 Score = 76 (26.8 bits), Expect = 0.31, Sum P(2) = 0.27
 Identities = 19/43 (44%), Positives = 26/43 (60%), Frame = -2

Query:   129 FNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             +N MI    LL+ +NNN+NNN +  NNNN N   N  I + +N
Sbjct:   272 YNNMIN---LLNNNNNNNNNNNIN-NNNNYNNNNNNYIGNINN 310

 Score = 67 (23.6 bits), Expect = 6.9, Sum P(2) = 1.0
 Identities = 13/22 (59%), Positives = 15/22 (68%), Frame = -2

Query:    87 NNNDNNNLLCVNNNNLNKEENY 22
             NNN+NNN    NNNN+N   NY
Sbjct:   280 NNNNNNN----NNNNINNNNNY 297

 Score = 42 (14.8 bits), Expect = 0.22, Sum P(2) = 0.20
 Identities = 7/28 (25%), Positives = 21/28 (75%), Frame = -2

Query:   327 HVVISTSLQ--VNNQVVNQNVFIDVNSK 250
             +++I+ +L   +N +++ +N+ +D+N+K
Sbjct:    21 NIIINNTLDSLMNKKLLLKNMLLDMNNK 48


>pir||S23689 hypothetical protein 6 - Plasmodium falciparum
            Length = 78

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.25, P = 0.22
 Identities = 15/34 (44%), Positives = 18/34 (52%), Frame = -2

Query:   126 NKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEEN 25
             NK        + +NNN+NNN    NNNN NK  N
Sbjct:    11 NKNNNNNNKNNNNNNNNNNNNKNNNNNNNNKNNN 44

 Score = 63 (22.2 bits), Expect = 0.77, P = 0.54
 Identities = 16/42 (38%), Positives = 22/42 (52%), Frame = -2

Query:   126 NKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             NK        + +NNN+NNN    NNNN NK  N    +++N
Sbjct:    11 NKNNNNNNKNNNNNNNNNNNNKNNNNNNNNKNNNNN--NNNN 50

 Score = 62 (21.8 bits), Expect = 1.0, P = 0.64
 Identities = 13/32 (40%), Positives = 20/32 (62%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             +++NNN+NNN    NNNN N   N    +++N
Sbjct:    18 NKNNNNNNNN----NNNNKNNNNNNNNKNNNN 45

 Score = 60 (21.1 bits), Expect = 1.8, P = 0.83
 Identities = 12/21 (57%), Positives = 13/21 (61%), Frame = -2

Query:    87 NNNDNNNLLCVNNNNLNKEEN 25
             NNN+NNN    NNNN N   N
Sbjct:     4 NNNNNNNNKNNNNNNKNNNNN 24

 Score = 60 (21.1 bits), Expect = 1.8, P = 0.83
 Identities = 13/32 (40%), Positives = 18/32 (56%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             + +NNN NNN    NNNN N   N    +++N
Sbjct:     6 NNNNNNKNNNNNNKNNNNNNNNNNNNKNNNNN 37

 Score = 60 (21.1 bits), Expect = 1.8, P = 0.83
 Identities = 13/32 (40%), Positives = 19/32 (59%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             + +NN +NNN    NNNN N   N K  +++N
Sbjct:     7 NNNNNKNNNNNNKNNNNNNNNNNNNKNNNNNN 38

 Score = 59 (20.8 bits), Expect = 2.4, P = 0.91
 Identities = 11/22 (50%), Positives = 16/22 (72%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKE 31
             +++NNN+NNN    NNNN N +
Sbjct:    31 NKNNNNNNNNKNNNNNNNNNND 52

 Score = 59 (20.8 bits), Expect = 2.4, P = 0.91
 Identities = 12/24 (50%), Positives = 16/24 (66%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKEEN 25
             +++NNN+NNN    NNNN N   N
Sbjct:    31 NKNNNNNNNNK---NNNNNNNNNN 51


>pir||G36856 B16L protein - variola virus (strain India-1967) >gi|457075
            (X69198) B16L [Variola virus] >prf||2015436HH B16L gene [Variola
            major virus]
            Length = 86

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.25, P = 0.22
 Identities = 16/41 (39%), Positives = 24/41 (58%), Frame = -2

Query:   372 IYIYIYIYIFMYVLIHVVISTSLQVNNQVVNQNVFIDVNSK 250
             +Y +IYIYI++Y+L H+        NNQ    N+F   NS+
Sbjct:     2 LYSHIYIYIYIYILKHMC-------NNQHHFSNIFYGNNSR 35


>gi|414322 (L11172) [Plasmodium falciparum RNA polymerase I gene, complete
           cds.], gene product [Plasmodium falciparum]
           Length = 2910

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.27, Sum P(2) = 0.24
 Identities = 32/115 (27%), Positives = 53/115 (46%), Frame = -2

Query:   366 IYIYIYIFMYVLIHVVISTSLQVNNQVVNQNVFIDVNSKIQ---VKDKPIQVD-ICTKLW 199
             I++  +IF    ++ + ST+     +  +    ID   K+     KD  I +D I   ++
Sbjct:   120 IFLLKHIFQLKSLNQIESTNKIKYKKNCDYEYIIDQEEKLYKKICKDSNISLDDIVEAIY 179

Query:   198 GIYKPKHIFCNTEKDYTYEEKIHFNKMIEE-KKLLDRHNNNDNNNLLCVNNNNLNKEENY 22
               Y+  H     +KD  ++E +     +E+ K   D  N N+NN     NNNN N   NY
Sbjct:   180 DDYENVH----EDKDGNFDESVDLLDSLEKIKDEPDEKNKNNNNK----NNNNNNNNNNY 231

 Score = 85 (29.9 bits), Expect = 2.1, P = 0.88
 Identities = 32/125 (25%), Positives = 61/125 (48%), Frame = -2

Query:   366 IYIYIYIFMYVLIHVVISTSLQVNNQVVNQNVFIDVNSKIQ---VKDKPIQVD-ICTKLW 199
             I++  +IF    ++ + ST+     +  +    ID   K+     KD  I +D I   ++
Sbjct:   120 IFLLKHIFQLKSLNQIESTNKIKYKKNCDYEYIIDQEEKLYKKICKDSNISLDDIVEAIY 179

Query:   198 GIYKPKHIFCNTEKDYTYEEKIHF----NKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKE 31
               Y+  H     +KD  ++E +       K+ +E    +++NNN NNN    NNNN N +
Sbjct:   180 DDYENVH----EDKDGNFDESVDLLDSLEKIKDEPDEKNKNNNNKNNNNNN-NNNNYNND 234

Query:    30 ENYKILSSSN 1
              +  + +++N
Sbjct:   235 VDIDVDNNNN 244

 Score = 40 (14.1 bits), Expect = 0.27, Sum P(2) = 0.24
 Identities = 7/10 (70%), Positives = 9/10 (90%), Frame = -2

Query:    54 NNNNLNKEEN 25
             NNNN NK++N
Sbjct:   970 NNNNNNKKKN 979


>sp|Q03100|CYAA_DICDI ADENYLATE CYCLASE, AGGREGATION SPECIFIC (ATP
            PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >pir||B42239 adenylate
            cyclase (EC 4.6.1.1) aggregation stage - slime mold (Dictyostelium
            discoideum) >gi|457431 (L05499) adenylyl cyclase aggregation
            protein [Dictyostelium discoideum]
            Length = 1407

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.34, Sum P(2) = 0.29
 Identities = 23/66 (34%), Positives = 32/66 (48%), Frame = -2

Query:   189 KPKHIFCNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNN---NNLNKEENYK 19
             K + I  N E D         + +++     + +NNN NNN    NN   NN N EE++K
Sbjct:   818 KSQSILTNNENDIVSPSLTSNSPILDTTVNNNNNNNNTNNNNKNQNNIYGNNNNNEEDFK 877

Query:    18 ILSSSN 1
             I S SN
Sbjct:   878 IKSKSN 883

 Score = 39 (13.7 bits), Expect = 0.34, Sum P(2) = 0.29
 Identities = 4/12 (33%), Positives = 10/12 (83%), Frame = -3

Query:   368 IYIYISIYLCMY 333
             +++Y+ I+ C+Y
Sbjct:   305 LFLYVVIFCCLY 316


>gi|476024 (L32150) carbamoyl phosphate synthetase II [Plasmodium falciparum]
           Length = 2391

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.37, Sum P(2) = 0.31
 Identities = 25/70 (35%), Positives = 38/70 (54%), Frame = -2

Query:   189 KPKHIFCNTEKDYTYEEKIH-----FNKMIEEKKL-LDRHNNNDNN-NLLCVNNN-NLNK 34
             K K I     K    ++K+H     +N+++++K   L + NNN+NN N   V N   LNK
Sbjct:  1255 KRKKICTLNNKRNANKKKVHVKNHLYNEVVDDKDTQLHKENNNNNNMNSGNVENKCKLNK 1314

Query:    33 EENYKILSSSN 1
             E +Y   +SSN
Sbjct:  1315 E-SYGYNNSSN 1324

 Score = 68 (23.9 bits), Expect = 0.66, Sum P(2) = 0.48
 Identities = 19/47 (40%), Positives = 24/47 (51%), Frame = -2

Query:   156 DYTYEEKIHFNKM---IEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYK 19
             D  Y  +   NKM   I+ + L D +NNN N N  C N NN +   N K
Sbjct:  1572 DSVYNNEYKINKMKELIDNENLNDEYNNNVNMN--CSNYNNASAFVNGK 1618

 Score = 67 (23.6 bits), Expect = 0.37, Sum P(2) = 0.31
 Identities = 16/36 (44%), Positives = 23/36 (63%), Frame = -2

Query:   372 IYIYIYIYIFMYVLIH--VVISTSLQVNNQVVNQNV 271
             +YIYIYIYI+++VLI    V    L+  N+ V  +V
Sbjct:     9 LYIYIYIYIYIFVLIDFKTVGRLILEDGNEFVGYSV 44

 Score = 67 (23.6 bits), Expect = 0.94, Sum P(2) = 0.61
 Identities = 18/64 (28%), Positives = 33/64 (51%), Frame = -2

Query:   195 IYKPKHIFCNT--EKD-YTYEEKIHFNKM----IEEKKLLDRHNNNDNNNLLCVNNNNLN 37
             ++   H++     +KD   ++E  + N M    +E K  L++ +   NN+  C+N NN+N
Sbjct:  1273 VHVKNHLYNEVVDDKDTQLHKENNNNNNMNSGNVENKCKLNKESYGYNNSSNCINTNNIN 1332

Query:    36 KEEN 25
              E N
Sbjct:  1333 IENN 1336

 Score = 65 (22.9 bits), Expect = 1.5, Sum P(2) = 0.77
 Identities = 16/49 (32%), Positives = 26/49 (53%), Frame = -2

Query:   168 NTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENY 22
             N   +Y Y + ++ N  I     ++++NNN+NN     N NN N E +Y
Sbjct:   379 NNVDEYGYYD-VNKNTNILSNNKIEQNNNNENNKN---NKNNNNNEVDY 423

 Score = 62 (21.8 bits), Expect = 1.2, Sum P(2) = 0.69
 Identities = 10/15 (66%), Positives = 14/15 (93%), Frame = -1

Query:   373 YLYIYIYLYIYVCIN 329
             Y+YIYIY+YI+V I+
Sbjct:    10 YIYIYIYIYIFVLID 24

 Score = 60 (21.1 bits), Expect = 4.7, Sum P(2) = 0.99
 Identities = 19/50 (38%), Positives = 24/50 (48%), Frame = -2

Query:   156 DYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSS 7
             D  Y  +   NKM   K+L+D  N ND  N    NN N+N   NY   S+
Sbjct:  1572 DSVYNNEYKINKM---KELIDNENLNDEYN----NNVNMNCS-NYNNASA 1613

 Score = 60 (21.1 bits), Expect = 4.7, Sum P(2) = 0.99
 Identities = 18/61 (29%), Positives = 33/61 (54%), Frame = -2

Query:   207 KLWGIYKPKHIFCNTEKDYTYEEKIHFNKMIEEKKLLDRHNNND--NNNLLCVNNNNLNK 34
             KL+GI +      + E++ ++    H+N  ++E    D + N +  +NN +  NNNN N 
Sbjct:   356 KLYGICEYDKYLIDLEENASF----HYNN-VDEYGYYDVNKNTNILSNNKIEQNNNNENN 410

Query:    33 EEN 25
             + N
Sbjct:   411 KNN 413


>gi|14022 (X14681) C-terminal NADH dehydrogenase (AA 89) [Neurospora crassa]
          Length = 89

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.44, P = 0.35
 Identities = 21/64 (32%), Positives = 34/64 (53%), Frame = -2

Query:   210 TKLWGIYKPKHIF-CNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNK 34
             TKL  I +  +++   T+K  TY   I   K++ +KK    HN+ +N  L+    NN+NK
Sbjct:    29 TKLSPIVQYFNLYPLKTKKYITYFNWIKIYKLVIDKK----HNDPENLLLITKYKNNINK 84

Query:    33 EENYK 19
              +  K
Sbjct:    85 SDYNK 89


>sp|P54675|P3K3_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 3 (PI3-KINASE)
            (PTDINS-3-KINASE) (PI3K) >gi|733524 (U23478)
            phosphatidylinositol-4,5-diphosphate 3-kinase [Dictyostelium
            discoideum]
            Length = 1585

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.76, P = 0.53
 Identities = 16/27 (59%), Positives = 20/27 (74%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKEENYKI 16
             + +NNN+NN  L  NNNN N +ENYKI
Sbjct:   370 NNNNNNNNNEELINNNNNNNNDENYKI 396


>gi|2258330 (AF007261) RNA polymerase subunit beta [Reclinomonas americana]
            Length = 1478

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.1, Sum P(2) = 0.67
 Identities = 34/95 (35%), Positives = 50/95 (52%), Frame = -2

Query:   321 VISTSLQVNNQVVNQNVFID-----VNSKIQVKDKPIQVDICTKLWGIYKP-KHIFC--N 166
             +ISTSL  +N ++  N +I      VN+K    DK +  D+   L  IYK  K IF   N
Sbjct:   258 IISTSLSFDNNLLANNDYISILNTVVNNKFISNDKFLNHDLF--LLDIYKDNKSIFIIEN 315

Query:   165 TEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLN 37
             T  D++Y  ++  NK+      L    N+D   L  + N N+N
Sbjct:   316 TNDDFSYPLEL-LNKVGSH---LSSFKNSDF--LFLIENKNIN 352

 Score = 37 (13.0 bits), Expect = 1.1, Sum P(2) = 0.67
 Identities = 7/21 (33%), Positives = 12/21 (57%), Frame = -2

Query:    63 LCVNNNNLNKEENYKILSSSN 1
             +C N+  + KE+   +LS  N
Sbjct:   895 VCTNDILIGKEKRQLLLSEKN 915


>gi|1526991 (U41289) K7 kinesin-like protein [Dictyostelium discoideum]
            Length = 1254

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.4, P = 0.75
 Identities = 26/105 (24%), Positives = 53/105 (50%), Frame = -2

Query:   315 STSLQVNNQVV----NQNVFIDVNSKIQVKDKPIQVDICTKLWGIYKPKHIFCNTEKDY- 151
             S +L++NN ++    NQ + ++ N K+++ +   Q+         +K     C   K   
Sbjct:   388 SKNLEINNLLIQLENNQKMVVESNQKLELLNS--QISSNHSFDNTFKEIENTCENSKIIF 445

Query:   150 -TYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
                 + I+ N  ++E    + ++NN+N+N    NNNN  +EE+ +    +N
Sbjct:   446 DDLNDHINNNNNVDENNNTNNNDNNNNDN----NNNNQYQEESNQYQQENN 492


>gi|552132 (K01664) Bkm-like protein [Drosophila melanogaster]
           Length = 81

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.7, P = 0.82
 Identities = 14/21 (66%), Positives = 17/21 (80%), Frame = -3

Query:   371 SIY--IYISIYLCMY*SMLLS 315
             SIY  IY+SIYLC+Y S+ LS
Sbjct:    32 SIYLSIYLSIYLCIYLSISLS 52


>pir||C21124 Bkm-like sex-determining region hypothetical protein CS319 - fruit
            fly (Drosophila melanogaster) (fragment)
            Length = 81

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.7, P = 0.82
 Identities = 14/21 (66%), Positives = 17/21 (80%), Frame = -3

Query:   371 SIY--IYISIYLCMY*SMLLS 315
             SIY  IY+SIYLC+Y S+ LS
Sbjct:    32 SIYLSIYLSIYLCIYLSISLS 52


>gi|1407697 (U59916) antigen PKX101 [proliferative kidney organism U59916]
            Length = 872

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 1.8, P = 0.83
 Identities = 28/109 (25%), Positives = 58/109 (53%), Frame = -2

Query:   327 HVVISTSLQVNNQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIYKPKHIFCNTEKDYT 148
             H+ ++T +Q   + +       +N K+  +++ + ++ C+ L  IY  K +  N  K  +
Sbjct:    10 HLYVATGVQTVYKFIGN--LKRINKKLS-RNQSLLIN-CSLL--IYDKKEVVGNFLKTNS 63

Query:   147 YE--EKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKI-LSSSN 1
             Y   + I ++    +K  +D  N+ND  N +C +N+N +K   Y+I ++ SN
Sbjct:    64 YRLTQFIEYSDEYNKKIFID--NSNDEFNFIC-SNDNFSKNTLYQITVAKSN 112


>pir||S14470 asparagine-rich protein (clone 28C6) - Plasmodium falciparum
            (fragment) >gi|9851 (X17487) Plasmodium falciparum mRNA for
            asparagine-rich antigen (clone 28C6) [Plasmodium falciparum]
            Length = 239

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 2.3, P = 0.90
 Identities = 15/32 (46%), Positives = 20/32 (62%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             + HNNN+NNN    NN N  K+ NY   +S+N
Sbjct:    80 NNHNNNNNNNNFDHNNRNSYKKSNYATDNSNN 111


>gi|1840087 (U83280) 39 kDa antigen [Leishmania donovani]
            Length = 322

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 2.7, P = 0.94
 Identities = 12/22 (54%), Positives = 20/22 (90%), Frame = -2

Query:   369 YIYIYIYIFMYVLIHVVISTSL 304
             +IYIYIYI++Y+ IHV+ +++L
Sbjct:   153 HIYIYIYIYIYIYIHVIYTSTL 174


>pir||S41483 RNA-directed RNA polymerase - Saccharomyces cerevisiae virus L-A
            Length = 69

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 3.0, P = 0.95
 Identities = 16/32 (50%), Positives = 19/32 (59%), Frame = +3

Query:     6 MTTIFCNFLLYSNYCYLHIRD-YYYHYCYVYLT 101
             +TT F N  L  NYCYLH  D  +  +  VYLT
Sbjct:    39 LTTFF-NTAL--NYCYLHNGDDVFAEFLRVYLT 68


>gi|452428 (X65740) ATPase 3 [Plasmodium falciparum]
           Length = 493

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 3.6, P = 0.97
 Identities = 28/93 (30%), Positives = 46/93 (49%), Frame = -2

Query:   303 QVNNQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIYKPKHIFCNTEKDYTYEEKIHFN 124
             ++  +  N +V  ++N K Q+ D     +I  K   +YK      NT  +   EEKI+ +
Sbjct:   266 EIYEEKQNNDVLYNLNEKEQLIDDNNMNEI-KKT--VYKEHFENYNTNDEPNTEEKINMD 322

Query:   123 KMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEEN 25
                EE  L + HNN+ NN+    +NN+ N + N
Sbjct:   323 NY-EE--LNNDHNNDHNNDHSNDHNNDHNNDHN 352


>gi|2081630 (U20661) unknown [Dictyostelium discoideum]
            Length = 877

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 6.4, Sum P(2) = 1.0
 Identities = 16/37 (43%), Positives = 21/37 (56%), Frame = -2

Query:   135 IHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEEN 25
             I+F+  +  K L  + NNN+NNN    NNNN N   N
Sbjct:   410 IYFSHSLVMKNLEIKVNNNNNNNNNNNNNNNNNNNNN 446

 Score = 65 (22.9 bits), Expect = 4.3, Sum P(3) = 0.99
 Identities = 14/29 (48%), Positives = 18/29 (62%), Frame = -2

Query:   111 EKKLLDRHNNNDNNNLLCVNNNNLNKEEN 25
             E K+ + +NNN+NNN    NNNN N   N
Sbjct:   422 EIKVNNNNNNNNNNNNNNNNNNNNNNNNN 450

 Score = 63 (22.2 bits), Expect = 8.3, Sum P(3) = 1.0
 Identities = 12/25 (48%), Positives = 16/25 (64%), Frame = -2

Query:    96 DRHNNNDNNNLLCVNNNNLNKEENY 22
             + +NNN+NNN    NNNN N   N+
Sbjct:   429 NNNNNNNNNNNNNNNNNNNNNNNNF 453

 Score = 47 (16.5 bits), Expect = 4.3, Sum P(3) = 0.99
 Identities = 9/48 (18%), Positives = 26/48 (54%), Frame = -2

Query:   372 IYIYIYIYIFMYVLIHVVISTSLQVNNQVVNQ-NVFIDVNSKIQVKDKP 229
             IY+++ +   M +L++  ++  +Q    ++ + N+F+ +  +     KP
Sbjct:   120 IYLFLILLFLMTILVN--LNRHVQTKFSIIQRDNIFLSITPESNPIKKP 166

 Score = 38 (13.4 bits), Expect = 4.3, Sum P(3) = 0.99
 Identities = 8/26 (30%), Positives = 14/26 (53%), Frame = -3

Query:   200 GGYTNRSTFFVIRRRIILMKKKYISI 123
             GG  ++S FF+     ++MK   I +
Sbjct:   400 GGLGSQSQFFIYFSHSLVMKNLEIKV 425


>sp|P37492|YYBL_BACSU HYPOTHETICAL 27.9 KD PROTEIN IN COTF-TETB INTERGENIC
            REGION >pir||S65985 hypothetical protein - Bacillus subtilis
            >gnl|PID|d1005733 (D26185) unknown [Bacillus subtilis]
            Length = 236

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 4.3, Sum P(2) = 0.99
 Identities = 23/91 (25%), Positives = 45/91 (49%), Frame = +1

Query:   112 LYHFIEMYFFFISI-ILLRITKNVLRFVYPP*FSTDIYLDGLIFNLNF----GIYI-YKN 273
             L + I + FF++S+ I+ R+T ++   V    F   I LD L F +      G +  +++
Sbjct:   131 LLNMISLVFFYLSVGIMFRLTYDLFNSVALAIFIVYIILDSLYFGVKLLLPNGYWEPFRD 190

Query:   274 VLINNLVINLQGGGDNNMD*YIHKYIDIYIY 366
             + I   ++N      N +  YI + I ++I+
Sbjct:   191 LAIFTNMLNRYWSTSNLIIVYIRQIIIVFIF 221

 Score = 39 (13.7 bits), Expect = 4.3, Sum P(2) = 0.99
 Identities = 13/37 (35%), Positives = 18/37 (48%), Frame = +2

Query:    26 FSSLFKLLLFTHKRLLLSLLLCLSNNFFSSIILLKCI 136
             FSS+  ++  T   +  S  L +  NF S I LL  I
Sbjct:   100 FSSIHTVINITCTHIFFSKNLLVEANFLS-ICLLNMI 135


>gi|437641 (L04160) [Plasmodium falciparum 5' end.], gene product [Plasmodium
           falciparum]
           Length = 308

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 4.9, P = 0.99
 Identities = 21/65 (32%), Positives = 33/65 (50%), Frame = -2

Query:   189 KPKHIF-CNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKE-ENYKI 16
             K K+ F  +  K+   +EK+  +   E+      +NNN+NNN    NNNN N   +NY +
Sbjct:    78 KSKNNFDISNSKEIDGKEKLVVDDKDEKNDKNSSNNNNNNNNNNNNNNNNNNANVDNYNV 137

Query:    15 LSSSN 1
                +N
Sbjct:   138 YVDNN 142


>gi|1345111 (U36383) ORF72;  Method: conceptual translation supplied by author.
            [Sulfolobus islandicus]
            Length = 72

  Plus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 5.4, P = 1.0
 Identities = 19/53 (35%), Positives = 25/53 (47%), Frame = +1

Query:   106 LFLYHFIE---MYFFFISIILLRITKNVLRFVYPP*FSTD-IYLDGLIFNLNF 252
             LFLY        +FFF S+I L I++ +     PP  +   I LD L   L F
Sbjct:    18 LFLYSLSTASLFFFFFQSLIFLTISRQIPVTPNPPVLTQSLIILDNLSLCLTF 70


>pir||S47661 topoisomerase II - Plasmodium falciparum
            Length = 160

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 20/57 (35%), Positives = 27/57 (47%), Frame = -2

Query:   207 KLWGIYKPKHIF-CNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLN 37
             KL  I+  + I  C    D   ++  + NK    K   D +NNN+NNN    N NN N
Sbjct:    15 KLTNIFSKEFIVQCGDYVDLYLKDNSNDNK--NNKGQNDNNNNNNNNNDENANQNNDN 70

 Score = 35 (12.3 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 6/10 (60%), Positives = 8/10 (80%), Frame = -2

Query:    54 NNNNLNKEEN 25
             NNNN N +E+
Sbjct:    89 NNNNNNNDED 98


>gi|343949 (J01525) var1(40.0) [Saccharomyces cerevisiae]
           Length = 396

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 12/24 (50%), Positives = 16/24 (66%), Frame = -2

Query:    87 NNNDNNNLLCV--NNNNLNKEENY 22
             NNN  NN++ +  NNNN+N   NY
Sbjct:   266 NNNKYNNIINLLNNNNNINNNNNY 289

 Score = 48 (16.9 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 7/28 (25%), Positives = 21/28 (75%), Frame = -2

Query:   327 HVVISTSLQ--VNNQVVNQNVFIDVNSK 250
             +++I+ +L   +N +++ +N+ +D+N+K
Sbjct:    21 NIIINNTLDSLINKKLLLKNILLDINNK 48


>gi|1658333 (U40232) exported serine/threonine protein kinase [Plasmodium
            falciparum]
            Length = 2510

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 5.7, P = 1.0
 Identities = 27/93 (29%), Positives = 46/93 (49%), Frame = -2

Query:   294 NQVVN-QNVFIDVNSKIQVKDKPIQVDICTKLWGIYKPKHIFCNTEKDYTYEEKIHFNKM 118
             N ++N +N+  D N K  +K    +V++ T      K +   C  EK+   ++  H   M
Sbjct:  1045 NGIINKENIENDENIKPDMKKNKEKVNVITNERNKRKREKTKCTDEKNDQGKDNTH-EHM 1103

Query:   117 IEEKKLLDRHNN----NDNNNLLCVNNNNLNKEEN 25
             +E+K  L+  +     N NNN +  + NN N E+N
Sbjct:  1104 VEKKVKLEEDSEEMERNTNNNKINYDKNN-NDEKN 1137


>pir||S23467 hypothetical protein 2 - Plasmodium falciparum >gi|9939 (X63648)
            ORF 2 gene product [Plasmodium falciparum]
            Length = 749

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 6.0, P = 1.0
 Identities = 29/119 (24%), Positives = 59/119 (49%), Frame = -2

Query:   318 ISTSLQVNNQVVNQNVFI---DVNSKIQVKDKPIQVDI----CTKLWGIYKPKHIFCNTE 160
             + + +++  ++V+ ++ I   + N K ++K K   V         L   YK ++I   TE
Sbjct:   165 LESLIKMKEELVDLSILIIYDESNVKQELKQKAKNVGYKLYYYKDLIDKYKNRNIIPQTE 224

Query:   159 K-DYTYEEKIH-----FNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
               D+ + ++ +     ++K+ +E+     +NNN+NNN    NNNN N   N    +++N
Sbjct:   225 MHDHDFHKEHNPNNAFYDKLKKEQADYSNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNN 283


>sp|Q23868|TAGC_DICDI PRESTALK-SPECIFIC PROTEIN TAGC PRECURSOR >gi|1399915
            (U60086) multidrug resistance transporter/Ser protease
            [Dictyostelium discoideum]
            Length = 1743

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 6.3, Sum P(2) = 1.0
 Identities = 20/52 (38%), Positives = 25/52 (48%), Frame = -2

Query:   180 HIFCNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEEN 25
             H   N EKD   EE++  N  +      +  NNN+NNN    NNNN N   N
Sbjct:  1682 HRMFNNEKD---EEELLNNLGLPSNNETNNENNNENNN----NNNNNNNNNN 1726

 Score = 46 (16.2 bits), Expect = 6.3, Sum P(2) = 1.0
 Identities = 10/37 (27%), Positives = 21/37 (56%), Frame = -2

Query:   357 YIYIFMYVLIHVVISTSLQVNNQVVNQNVFIDVNSKI 247
             +I IF+  +I  V ST     + +VN+ + + + +K+
Sbjct:  1072 FILIFILAVIEFVFSTISSWISGIVNEKMVMRLQNKV 1108


>sp|P40631|MLH_TETTH MICRONUCLEAR LINKER HISTONE POLYPROTEIN (CONTAINS: LINKER
            HISTONE PROTEINS ALPHA, BETA, DELTA AND GAMMA) (MIC LH) >gi|161804
            (M87306) micronuclear linker histone polyprotein [Tetrahymena
            thermophila]
            Length = 633

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 6.7, P = 1.0
 Identities = 21/68 (30%), Positives = 31/68 (45%), Frame = -2

Query:   222 VDICTKLWGIYKPKHIFCNTEKDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNN 43
             +++ TK   I  PK  F NT + +  E+K    K  + KK+   +N   NN    +    
Sbjct:     1 MELRTKTLNIQPPKKPFSNTYQAFVLEKKNALGKNFDNKKVQADYNKLSNNEKERLQKLV 60

Query:    42 LNKEENYK 19
              N EE YK
Sbjct:    61 DNAEEKYK 68


>pir||S14469 asparagine-rich protein (clone 17C1) - Plasmodium falciparum
            (fragment) >gi|1335714 (X17484) Plasmodium falciparum mRNA for
            asparagine-rich antigen (clone 17C1) [Plasmodium falciparum]
            Length = 234

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 8.0, P = 1.0
 Identities = 17/48 (35%), Positives = 29/48 (60%), Frame = -2

Query:   141 EKIHFN-KMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             +  H N K  + KK+++R+NNN+ +N+   NNN  N   NY   +++N
Sbjct:    49 KNFHVNQKQNKFKKMINRNNNNNFSNIRQGNNNMNNIMNNYNGNNNNN 96


>sp|P36079|YKI3_YEAST HYPOTHETICAL 23.7 KD PROTEIN IN MDH1-VMA5 INTERGENIC
            REGION >pir||S37908 hypothetical protein YKL083w - yeast
            (Saccharomyces cerevisiae) >gi|486120 (Z28082) ORF YKL083w
            [Saccharomyces cerevisiae]
            Length = 204

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 8.3, P = 1.0
 Identities = 10/21 (47%), Positives = 16/21 (76%), Frame = -1

Query:   373 YLYIYIYLYIYVCINPCCYLH 311
             Y+Y+YIY++ Y+ I  CCY +
Sbjct:    12 YMYLYIYVHTYIYIYYCCYYY 32


>bbs|143530 (S68626) PrP=protease-resistant protein {Tyr-Val peptide} [prion,
            host = golden Syrian hamster, Peptide Partial, 14 aa] [prion]
            Length = 14

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 9.1, P = 1.0
 Identities = 6/11 (54%), Positives = 11/11 (100%), Frame = -1

Query:   373 YLYIYIYLYIY 341
             Y+Y+Y+Y+Y+Y
Sbjct:     1 YIYVYVYVYVY 11


>pir||A45600 asparagine-rich blood stage antigen (clone Pfa55-14) - Plasmodium
            falciparum (fragment) >gi|552185 (M59473) asparagine-rich antigen
            Pfa55-14 [Plasmodium falciparum]
            Length = 307

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 9.2, P = 1.0
 Identities = 26/98 (26%), Positives = 42/98 (42%), Frame = -2

Query:   294 NQVVNQNVFIDVNSKIQVKDKPIQVDICTKLWGIYKPKHIFCNTEKDYTYEEKIHFNKMI 115
             N    QN F  +N +   K + IQV+     +          N    Y + +  +FN   
Sbjct:    70 NDKETQNGFDSLNEEEAFKKEDIQVNPNKNFYDCNNNSSP-TNNISHYKHYDIFNFNDKK 128

Query:   114 EEKKLLDRHNNNDNNNLLCVNNNNLNKEENYKILSSSN 1
             EE    ++ NN++NNN      NNL K   Y +++ +N
Sbjct:   129 EEHTSFNKSNNSNNNN------NNL-KNTTYNMINPNN 159


>pir||A44969 circumsporozoite protein precursor - Plasmodium yoelii nigeriensis
            Length = 264

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 9.7, P = 1.0
 Identities = 19/46 (41%), Positives = 23/46 (50%), Frame = -2

Query:   159 KDYTYEEKIHFNKMIEEKKLLDRHNNNDNNNLLCVNNNNLNKEENY 22
             KD   EEK        + KL    NNN+NNN    NNN  N E++Y
Sbjct:   133 KDAPKEEKKADPPKEAQNKLKQPDNNNNNNNNNNNNNNGNNNEDSY 178


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.98
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.368   0.171   0.719
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.363   0.164   0.573
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.362   0.176   0.569
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.409   0.195   0.861
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.319   0.137   0.401
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.375   0.176   0.601
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      123       123      10. 60 3  12 22    0.10 33
                                                  29    0.11 35
   +2      0      124       124      10. 60 3  12 22    0.10 33
                                                  29    0.11 35
   +1      0      124       124      10. 60 3  12 22    0.10 33
                                                  29    0.11 35
   -1      0      124       124      10. 60 3  12 22    0.10 33
                                                  29    0.11 35
   -2      0      124       124      10. 60 3  12 22    0.10 33
                                                  29    0.11 35
   -3      0      123       123      10. 60 3  12 22    0.10 33
                                                  29    0.11 35


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  41
  No. of states in DFA:  582 (57 KB)
  Total size of DFA:  160 KB (192 KB)
  Time to generate neighborhood:  0.01u 0.02s 0.03t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  92.77u 0.45s 93.22t  Elapsed: 00:00:24
  Total cpu time:  92.87u 0.47s 93.34t  Elapsed: 00:00:24
  Start:  Sat Feb  7 03:54:29 1998   End:  Sat Feb  7 03:54:53 1998

Date: 14:50:31 on Sun 17 Dec 117.