blastx_gbnr_files/1200635_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1200635
        (515 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|1519536           (U66912) ORF DG1016; initially de... -2   142  4.0e-08   1
A sp|P14196|AAC2_DICDI AAC-RICH MRNA CLONE AAC11 PROTEIN... -2   136  9.7e-08   1
A sp|P04931|ARP_PLAFA  ASPARAGINE-RICH PROTEIN (AG319) (... -2   137  1.0e-07   1
A bbs|170479           (S79359) arabinogalactan-protein,... -2   136  1.0e-07   1
A gnl|PID|d1007032     (D30801) TED3 [Zinnia elegans]       -2   133  1.1e-07   1
A gi|1513238           (U66369) ORFveg132; similar to Ca... -2   136  1.6e-07   1
A sp|P13824|ARP2_PLAFA CLUSTERED-ASPARAGINE-RICH PROTEIN... -2   134  1.6e-07   1
A pir||S14535          asparagine-rich protein (clone 25... -2   135  2.3e-07   1
A gi|452428            (X65740) ATPase 3 [Plasmodium fal... -2   131  3.9e-07   1
A gi|171388            (M36110) DDR48 stress protein [Sa... -2   130  4.0e-07   1
A sp|P18899|DR48_YEAST DDR48 STRESS PROTEIN (DNA DAMAGE-... -2   130  4.0e-07   1
A sp|P54677|PI4K_DICDI PHOSPHATIDYLINOSITOL 4-KINASE (PI... -2   134  5.5e-07   1
A pir||S14469          asparagine-rich protein (clone 17... -2   123  1.8e-06   1
A gi|2425113           (AF019981) HelE [Dictyostelium di... -2   125  2.6e-06   2
A pir||A42239          adenylate cyclase (EC 4.6.1.1) ge... -2   125  3.7e-06   1
A sp|P18160|KYK1_DICDI NON-RECEPTOR TYROSINE KINASE SPOR... -2   126  6.0e-06   1
A gi|1526991           (U41289) K7 kinesin-like protein ... -2   124  7.5e-06   1
A pir||C44863          R45 antigen - Plasmodium falcipar... -2   109  9.0e-06   1
A pir||S14508          asparagine-rich protein (clone 52... -2   122  1.1e-05   1
A sp|Q03101|CYAG_DICDI ADENYLATE CYCLASE, GERMINATION SP... -2   123  1.8e-05   1
A pir||S51910          cryptogene protein G4 - Sauroleis... +2   112  4.0e-05   1
A gi|437641            (L04160) [Plasmodium falciparum 5... -2   117  6.3e-05   1
A pir||S14556          asparagine-rich protein (clone 18... -2   117  8.4e-05   2
A gi|552163            (J03986) 10b antigen [Plasmodium ... -2   117  9.0e-05   1
A gi|454844            (M74170) ORF 3 [Schistosoma mansoni] +2   117  9.8e-05   1
A sp|P40467|YIN0_YEAST PUTATIVE 108.8 KD TRANSCRIPTIONAL... -2   119  0.00015   1
A gi|2149437           (U85963) asparigine-rich protein ... -2   117  0.00020   1
A gi|1762998           (U67260) RING-finger protein [Hel... -2   114  0.00024   1
A gi|1685115           (U68754) putative transcription f... -2   114  0.00027   2
A sp|P14248|RPB1_PLAFD DNA-DIRECTED RNA POLYMERASE II LA... -2   120  0.00029   1
A pir||S23692          hypothetical protein 9 - Plasmodi... -2   115  0.00032   1
A pir||S14548          asparagine-rich protein (clone 37... -2   117  0.00038   1
A pir||C45600          asparagine-rich blood stage antig... -2   113  0.00041   1
A pir||S67568          probable membrane protein YDL035c... -2   116  0.00047   1
A gnl|PID|e311435      (Y08926) AARP1 protein [Plasmodiu... -2   120  0.00047   1
A sp|P54682|D7_DICDI   CAMP-INDUCIBLE PRESPORE PROTEIN D... -2   115  0.00060   1
A gi|1513240           (U66370) ORFveg110 [Dictyostelium... -2    92  0.00072   2
A pir||S14470          asparagine-rich protein (clone 28... -2   108  0.00073   1
A gi|1620096           (U42580) Asn-rich, VKKNN (5x) [Pa... -2    92  0.00077   1
A pir||S50977          hypothetical protein YDL005c - ye... -2   111  0.00088   1
A gi|160616            (M83791) trophozoite antigen [Pla... -2    91  0.0010    1
A gi|467292            (U07817) glutamine-asparagine ric... -2    99  0.0010    2
A pir||F22845          hypothetical protein 6 - Trypanos... +2   109  0.0012    1
A gi|1136289           (U42597) histidine kinase A [Dict... -2   115  0.0017    1
A gi|2393951           (AF012944) ORF DG1053 [Dictyostel... -2   110  0.0017    1
A gi|2425143           (AF020407) WimA [Dictyostelium di... -2   110  0.0017    1
A pir||E22845          hypothetical protein 4 - Trypanos... +2   109  0.0018    1
A gi|436923            (U01849) ORF1 [Trypanosoma brucei]   +2    97  0.0027    1
A gi|2213862           (AF003086) PfSNF2L [Plasmodium fa... -2   112  0.0030    1
A sp|P54637|PTP3_DICDI PROTEIN-TYROSINE PHOSPHATASE 3 (P... -2   110  0.0035    1
A pir||B26696          hypothetical protein 1 (CYb-COII ... +2   106  0.0043    1
A sp|Q03100|CYAA_DICDI ADENYLATE CYCLASE, AGGREGATION SP... -2    87  0.0047    2
A gi|9857              (X17490) Plasmodium falciparum mR... -2    95  0.0050    1
A gi|2078309           (U67264) HOAR [Helicoverpa zea nu... -2   107  0.0059    1
A gi|414322            (L11172) [Plasmodium falciparum R... -2   101  0.0064    2
A bbs|137318           DNA polymerase alpha, DNAPol alph... -2   110  0.0072    1
A pir||S41649          DNA polymerase - Plasmodium falci... -2   110  0.0072    1
A gi|535260            (Z30339) STARP antigen [Plasmodiu... -2   105  0.0098    1
A gi|1763000           (U67261) RING-finger protein [Hel... -2   102  0.0098    1
A pir||S23689          hypothetical protein 6 - Plasmodi... -2    82  0.011     1
A pir||B45600          asparagine-rich blood stage antig... -2   103  0.012     1
A gi|897642            (M14820) ORF2 bases 1807-2850; fi... +2    99  0.015     1
A gi|160383            (M63276) malaria antigen [Plasmod... -2    94  0.015     1
A pir||A05235          hypothetical protein A-288 - Tryp... +2    99  0.016     1
A sp|P09547|ADR6_YEAST TRANSCRIPTION REGULATORY PROTEIN ... -2   106  0.017     1
A sp|P27625|RPC1_PLAFA DNA-DIRECTED RNA POLYMERASE III L... -2   108  0.017     1
A pir||A45597          DNA-directed RNA polymerase (EC 2... -2   108  0.017     1
A gnl|PID|e276379      (Y08924) AARP2 protein [Plasmodiu... -2   106  0.018     1
A gi|476024            (L32150) carbamoyl phosphate synt... -2   108  0.018     1
A sp|P34127|MYBH_DICDI MYB-LIKE PROTEIN                     -2   101  0.019     1
A pir||S14577          asparagine-rich protein (clone 14... -2   100  0.021     1
A gi|1816500           (L06303) 8b2 protein [Plasmodium ... -2    98  0.022     1
A sp|P10961|HSF_YEAST  HEAT SHOCK FACTOR PROTEIN (HSF) (... -2    97  0.025     2
A pir||S29870          DNA-binding protein BAF1 - yeast ... -2   102  0.027     1
A sp|P29126|XYNA_RUMFL BIFUNCTIONAL ENDO-1,4-BETA-XYLANA... -2   103  0.028     1
A gi|1762996           (U67259) RING-finger protein [Hel... -2    97  0.040     1
A gnl|PID|e213552      (Z26318) royal jelly protein RJP5... -2    99  0.043     1
A gi|160385            (M63277) malaria antigen [Plasmod... -2    94  0.045     1
A pir||S34960          NADH dehydrogenase (ubiquinone) (... +2    99  0.048     1
A gi|499325            (Z26314) STARP antigen [Plasmodiu... -2    99  0.049     1
A pir||S23686          hypothetical protein 3 - Plasmodi... -2    76  0.054     1
A gi|340613            (L07545) A 'c' was inserted after... +2    96  0.054     1
A gi|1142984           (U28773) odorant receptor [Mus mu... +2    80  0.057     1
A gi|453517            (L28677) ORF3 [Tetrahymena pyrifo... +2    75  0.071     1
A pir||S47042          protein kinase (EC 2.7.1.37) cdc2... -2    98  0.075     1
A sp|P34250|YKK5_YEAST HYPOTHETICAL 125.6 KD PROTEIN IN ... -2   100  0.079     1
A gi|552199            (M63269) malaria antigen [Plasmod... -2    86  0.079     1
A pir||S69691          hypothetical protein YDR409w - ye... -2    99  0.080     1
A gi|575365            (X80759) cdc2-related protein kin... -2    98  0.082     1
A sp|P54675|P3K3_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 3 (... -2   101  0.087     1
A gi|1763002           (U67262) RING-finger protein [Hel... -2    94  0.094     1
A gi|1236921           (U49822) Var1p [Saccharomyces dou... -2    94  0.10      1
A gi|2460283           (AF024654) hybrid histidine kinas... -2   101  0.11      1
A gi|1513232           (U66366) ORFveg109 [Dictyostelium... -2    91  0.11      1
A pir||A44863          trophozoite antigen R45 - Plasmod... -2    93  0.11      1
A gnl|PID|e316524      (Y13119) pleiotropic effects on c... -2    85  0.11      2
A gi|160373            (M63271) malaria antigen [Plasmod... -2    73  0.12      1
A gi|1022332           (X83707) protein kinase [Plasmodi... -2    93  0.12      2
A sp|P30397|YCX4_EUGGR HYPOTHETICAL 64.3 KD PROTEIN IN R... +2    95  0.12      1
A gi|2149570           (U87912) MAP kinase kinase protei... -2    90  0.12      2
A pir||S23691          hypothetical protein 8 - Plasmodi... -2    91  0.12      1
A pir||A45600          asparagine-rich blood stage antig... -2    92  0.13      1
A gnl|PID|e8900        (X05182) RESA FC27 Ag46 (1 is 3rd... -2    92  0.14      1
A sp|P54673|P3K1_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 1 (... -2    99  0.14      1
A gi|2331032           (AF012551) ornithine decarboxylas... -2    97  0.14      1
A pir||A45612          ATPase 6 - Sauroleishmania tarent... +2    84  0.17      2
A pir||E64434          hypothetical protein MJ1078 - Met... -3    89  0.18      1
A gi|1519703           (U67923) pXi [Dictyostelium disco... -2    65  0.20      2
A pir||S47661          topoisomerase II - Plasmodium fal... -2    85  0.20      1
A pir||C22845          NADH dehydrogenase (ubiquinone) (... +2    92  0.21      1
A pir||S49313          protein kinase - slime mold (Dict... -2    96  0.21      1
A gnl|PID|e316518      (Y13097) STAT protein [Dictyostel... -2    94  0.22      1
A gi|288590            (X68020) ARP gene product [Saccha... -2    94  0.23      1
A gi|3413              (X16385) Baf1 protein (AA 1-731) ... -2    87  0.25      2
A gnl|PID|e16326       (X15081) MURF2 protein (AA 1-348)... +2    90  0.26      1
A gi|343539            (M14820) NADH dehydrogenase subun... +2    91  0.27      1
A gi|1658333           (U40232) exported serine/threonin... -2    98  0.29      1
A gi|887563            (Z22868) serine/threonine-protein... -2    93  0.31      1
A pir||A54813          cAMP receptor CAR4 - slime mold (... -2    90  0.35      1
A pir||C30010          hypothetical ORF-6 protein - Saur... +2    86  0.39      1
A pir||S36953          cytochrome-c oxidase (EC 1.9.3.1)... +2    87  0.40      1
A gi|2258300           (AF001783) AgrC [Staphylococcus a... +2    89  0.41      1
A sp|P40002|YEA7_YEAST HYPOTHETICAL 72.5 KD PROTEIN IN G... -2    91  0.42      1
A sp|P34787|TBG_PLAFO  TUBULIN GAMMA CHAIN >gi|396806 (X... -2    83  0.43      2
A prf||1411304A        thrombospondin related protein TR... -2    90  0.44      1
A gnl|PID|e220208      (X95276) ORF78 [Plasmodium falcip... -3    67  0.45      1
A pir||S51911          cryptogene protein G5(ND3) - Saur... +2    67  0.45      1
A gi|9872              (X65738) ATPase I [Plasmodium fal... -2    95  0.46      1
A pir||A44396          P-type cation translocating ATPas... -2    95  0.46      1
A sp|P04540|NU5M_TRYBB NADH-UBIQUINONE OXIDOREDUCTASE CH... +2    90  0.46      1
A sp|P35352|CAR3_DICDI CYCLIC AMP RECEPTOR 3 >pir||A4639... -2    89  0.47      1
A pir||C26696          hypothetical protein (CYb-COII in... +2    84  0.48      1
A gi|1513298           (U66526) AbcA [Dictyostelium disc... -2    75  0.50      2
A sp|P15577|NU2M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CH... +2    83  0.50      1
A pir||JS0233          NADH dehydrogenase (ubiquinone) (... +2    83  0.50      1
A sp|P27571|XIST_MOUSE X INACTIVE SPECIFIC TRANSCRIPT PR... +3    86  0.51      1
A pir||S51908          cryptogene protein G1(ND9) - Saur... +2    83  0.52      1
A gi|794235            (U10128) NADH dehydrogenase subun... +2    85  0.53      1
A gnl|PID|e233513      (X96869) histidine kinase [Dictyo... -2    84  0.53      2
A pir||D44863          R45 antigen - Plasmodium falcipar... -2    66  0.54      1
A prf||2015259H        NADH dehydrogenase:SUBUNIT=5 [Ano... +2    89  0.55      1
A sp|P33510|NU5M_ANOQU NADH-UBIQUINONE OXIDOREDUCTASE CH... +2    89  0.55      1
A sp|P32770|ARP_YEAST  ARP PROTEIN >pir||S61046 ARP1 pro... -2    90  0.55      1
A gi|295139            (L13334) ORFB [Staphylococcus lug... +2    85  0.56      1
A gi|501027            (U01849) ORF2 [Trypanosoma brucei]   +2    79  0.56      1
A gi|605651            (M97918) regulatory protein [Sacc... -2    82  0.57      1
A pir||S34959          NADH dehydrogenase (ubiquinone) (... +2    87  0.62      1
A pir||F30010          NADH dehydrogenase (ubiquinone) (... +2    87  0.62      1
A sp|P54674|P3K2_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 2 (... -2    93  0.63      1
A gi|940761            (X85877) invasive associated prot... -2    65  0.63      1
A gi|794226            (U10125) NADH dehydrogenase subun... +2    84  0.64      1
A gi|794229            (U10126) NADH dehydrogenase subun... +2    84  0.64      1
A gi|794232            (U10127) NADH dehydrogenase subun... +2    84  0.64      1
A gi|794238            (U10129) NADH dehydrogenase subun... +2    84  0.64      1
A gi|794241            (U10130) NADH dehydrogenase subun... +2    84  0.64      1
A sp|P51899|NU5M_ANOAR NADH-UBIQUINONE OXIDOREDUCTASE CH... +2    84  0.64      1
A gi|343544            (M33228) ATPase 6 [Trypanosoma br... +2    83  0.64      1
A gi|1022918           (U38184) ATPase subunit 6 [Trypan... +2    83  0.65      1
A sp|Q94481|CIGB_DICDI CIGB PROTEIN >gi|1513302 (U66528)... -2    89  0.66      1
A gi|1405368           (U60170) RegA [Dictyostelium disc... -2    89  0.69      1
A pir||G64417          hypothetical protein MJ0943 - Met... -2    86  0.69      1
A pir||A05236          hypothetical protein B-114 - Tryp... +2    74  0.71      1
A sp|P39001|UME6_YEAST TRANSCRIPTIONAL REGULATOR UME6 (N... -2    89  0.71      1
A gnl|PID|d1005428     (D23663) NIM2 protein [Saccharomy... -2    89  0.71      1
A gi|479019            (L32186) car80 [Saccharomyces cer... -2    89  0.71      1
A sp|Q23868|TAGC_DICDI PRESTALK-SPECIFIC PROTEIN TAGC PR... -2    80  0.71      2
A pir||S61977          RLM1 protein - yeast (Saccharomyc... -2    88  0.72      1
A gnl|PID|e332342      (Y11183) 235kDa rhoptry protein [... -2    76  0.72      1
A gi|794253            (U10134) NADH dehydrogenase subun... +2    83  0.73      1
A sp|P15911|VFP3_FOWPV PROTEIN FP3 >pir||WMVZP3 F3 prote... +2    68  0.75      1
A pir||S65062          fiber protein E6 (clone CKE6-4A) ... -2    82  0.77      1
A gi|457146            (L27838) rhoptry protein [Plasmod... -2    92  0.81      1
A gi|1216394           (U40265) ATPase subunit 6 [Trypan... +2    79  0.81      1
A sp|Q02510|LIP_STAEP  LIPASE PRECURSOR (GLYCEROL ESTER ... -2    87  0.82      1
A gi|160727            (M96815) thrombospondin related a... -2    86  0.82      1
A gi|160714            (M96807) thrombospondin related a... -2    86  0.83      1
A sp|P24499|ATP6_TRYBB ATP SYNTHASE A CHAIN (PROTEIN 6)     +2    81  0.83      1
A sp|P41696|AZF1_YEAST ASPARAGINE-RICH ZINC FINGER PROTE... -2    88  0.83      1
A sp|P14164|BAF1_YEAST TRANSCRIPTION FACTOR BAF1 (ARS BI... -2    87  0.84      1
A sp|P26694|CSP_PLARE  CIRCUMSPOROZOITE PROTEIN PRECURSO... -2    84  0.84      1
A sp|P40957|MAD1_YEAST SPINDLE ASSEMBLY CHECKPOINT COMPO... -2    87  0.85      1
A gi|567922            (L36903) varI gene product [Sacch... -2    84  0.86      1
A sp|P40070|USS1_YEAST U6 SNRNA-ASSOCIATED PROTEIN >pir|... -2    79  0.86      1
A pir||S67087          hypothetical protein YOR195w - ye... -2    87  0.88      1
A pir||S28831          microtubule-associated protein H1... -2    83  0.88      1
A pir||S54067          probable membrane protein YPR042c... -2    88  0.88      1
A gi|1620042           (U42580) a370R [Paramecium bursar... +2    62  0.89      1
A gi|1262910           (U51645) cytidine triphosphate sy... -2    87  0.89      1
A gi|794145            (X83690) MPT5=HTR1 gene product [... -3    64  0.91      2
A pir||S23684          hypothetical protein 1 - Plasmodi... -2    81  0.91      1
A pir||S23467          hypothetical protein 2 - Plasmodi... -2    86  0.91      1
A gi|552200            (M63270) malaria antigen [Plasmod... -2    71  0.92      1
A sp|P39016|MPT5_YEAST SUPPRESSOR PROTEIN MPT5 (HTR1 PRO... -3    64  0.92      2
A pir||A35349          H+-transporting ATP synthase (EC ... +2    79  0.93      1
A gi|294158            (M83161) circumsporozoite protein... -2    83  0.93      1
A pir||S64195          HTR1 protein - yeast (Saccharomyc... -3    64  0.93      2
A sp|P24874|NULM_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CH... +2    61  0.94      1
A gi|695356            (M19879) calbindin 27 [Homo sapiens] -2    61  0.94      1
A gi|854471            (Z49809) unknown [Saccharomyces c... -2    85  0.95      1
A gi|309064            (L20934) NADH dehydrogenase subun... +2    84  0.96      1
A sp|P34854|NU5M_ANOGA NADH-UBIQUINONE OXIDOREDUCTASE CH... +2    84  0.96      1
A gnl|PID|e276616      (Z81317) hypothetical protein [Sc... -2    84  0.97      1
A gi|2367390           (U82512) random slug cDNA21 prote... -2    81  0.97      2
A pir||S36956          cytochrome-c oxidase (EC 1.9.3.1)... +2    80  0.97      1
A sp|P13568|MDR_PLAFF  MULTIDRUG RESISTANCE PROTEIN (CHL... -2    88  0.97      2
A sp|P53036|SAP4_YEAST SIT4-ASSOCIATING PROTEIN SAP4 >pi... -2    85  0.97      1
A sp|P36123|SAP3_YEAST SIT4-ASSOCIATING PROTEIN SAP190 >... -2    86  0.97      1
A pir||S43574          C05B5.3 protein (clone C05B5) - C... -2    81  0.98      1
A pir||S38100          hypothetical protein YKR028w - ye... -2    86  0.98      1
A prf||1708291A        thrombospondin related protein [P... -2    83  0.98      1
A gi|1527182           (U67764) PfTRAP [Plasmodium falci... -2    83  0.98      1
A sp|P41001|TOP2_PLAFK DNA TOPOISOMERASE II                 -2    85  0.98      2
A gi|940755            (X85939) invasive associated prot... -2    64  0.98      1
A gi|343949            (J01525) var1(40.0) [Saccharomyce... -2    81  0.99      1
A sp|P51022|PNT1_DROME ETS-LIKE PROTEIN POINTED P1 (D-ET... -2    83  0.99      1
A sp|Q60303|YY04_METJA HYPOTHETICAL PROTEIN MJECS04 >pir... -2    73  0.99      1
A prf||1602249A        SWI4 gene [Saccharomyces cerevisiae] -2    86  0.99      2
A gi|666106            (X51606) regulatory protein SWI4 ... -2    86  0.99      2
A sp|P25302|SWI4_YEAST REGULATORY PROTEIN SWI4 (CELL-CYC... -2    86  0.99      2
A sp|P34291|YKO3_CAEEL HYPOTHETICAL 45.3 KD PROTEIN C05B... -2    81  0.99      1
A sp|P46760|RT13_ACACA MITOCHONDRIAL RIBOSOMAL PROTEIN S... -2    71  0.99      1
A gnl|PID|e349490      (Z82275) K01G12.b [Caenorhabditis... -2    78  0.990     1
A gi|2353256           (AF016024) cytochrome oxidase II ... +2    66  0.990     1
A gi|1698593           (U61846) 3' end, includes homeodo... -2    76  0.991     1
A gnl|PID|e307036      (Y11396) erythrocyte binding prot... -2    85  0.991     1
A gi|2598948           (AF027143) zinc finger protein [H... +1    59  0.992     1
A gi|393266            (M90693) glycerol ester hydrolase... -2    83  0.993     1
A sp|P34855|NU5M_APIME NADH-UBIQUINONE OXIDOREDUCTASE CH... +2    82  0.993     1
A pir||S52967          NADH dehydrogenases chain 5 - hon... +2    82  0.993     1
A gi|1468983           (U64830) protein tyrosine kinase ... -2    65  0.994     2
A gi|160712            (M96806) thrombospondin related a... -2    82  0.994     1
A pir||JH0163          No-on-transient A protein form II... -2    83  0.994     1
A gnl|PID|e1169961     (AJ002383) MybS protein [Dictyost... -2    83  0.994     1
A sp|Q04047|NONA_DROME NO-ON-TRANSIENT A PROTEIN >pir||J... -2    83  0.994     1
A pir||A48334          no-on transient A protein - fruit... -2    83  0.994     1
A pir||B44863          R45 antigen - Plasmodium falcipar... -2    79  0.995     1
A sp|P41453|LEF3_NPVAC LATE EXPRESSION FACTOR 3 >pir||A4... -2    80  0.995     1
A gi|1151158           (U43145) repeat organellar protei... -2    87  0.996     1
A gi|552190            (M57498) circumsporozoite protein... -2    80  0.996     1
A sp|P16463|F801_SCHMA FEMALE SPECIFIC 800 PROTEIN (FS80... -2    77  0.997     1
A sp|Q05854|YL78_YEAST PUTATIVE 151.3 KD TRANSCRIPTIONAL... -2    74  0.997     2
A gi|294134            (M83172) circumsporozoite protein... -2    80  0.997     1
A sp|Q04978|YMF3_YEAST HYPOTHETICAL 23.9 KD PROTEIN IN C... -2    76  0.998     1
A sp|P15305|DYHC_ONCMY DYNEIN HEAVY CHAIN (DYHC) >pir||S... +1    81  0.998     1
A gi|552191            (M57499) circumsporozoite protein... -2    80  0.998     1
A gi|294129            (M83169) circumsporozoite protein... -2    80  0.998     1
A sp|P13814|CSP_PLAFT  CIRCUMSPOROZOITE PROTEIN PRECURSO... -2    80  0.998     1
A pir||S28832          microtubule-associated protein H1... -2    78  0.998     1
A sp|Q02653|ATP8_PODAN ATP SYNTHASE PROTEIN 8 >gi|133456... +2    58  0.998     1
gi|994809            (Z37724) pid:e118903 [Plasmodium ... -2    82  0.998     1
gi|294121            (M83165) circumsporozoite protein... -2    80  0.998     1
gi|294123            (M83166) circumsporozoite protein... -2    80  0.998     1
gi|160652            (M34283) rhoptry protein [Plasmod... -2    72  0.998     1
gi|294136            (M83173) circumsporozoite protein... -2    80  0.998     1
sp|P08307|CSP_PLAFW  CIRCUMSPOROZOITE PROTEIN PRECURSO... -2    80  0.998     1
sp|P36079|YKI3_YEAST HYPOTHETICAL 23.7 KD PROTEIN IN M... +1    58  0.998     2
gi|1118126           (U41625) K03A1.3 gene product [Ca... -2    81  0.999     1
pir||C45521          rhoptry protein S8 - Plasmodium y... -2    72  0.999     1
gi|3763              (X16727) HAP4 (AA 1-554) [Sacchar... -2    81  0.999     1
sp|P14064|HAP4_YEAST HAP4 TRANSCRIPTIONAL ACTIVATOR >p... -2    81  0.999     1
gnl|PID|e349174      (Z81508) F20E11.b [Caenorhabditis... +2    78  0.999     1
sp|P05691|CSP_PLAFL  CIRCUMSPOROZOITE PROTEIN (CS) >gi... -2    78  0.9990    1
sp|P54683|TAGB_DICDI PRESTALK-SPECIFIC PROTEIN TAGB PR... -2    86  0.9991    1
sp|P18015|COP_CLOPE  COPY NUMBER PROTEIN (ORF4) >pir||... +2    75  0.9991    1
gi|170732            (M11336) gamma-gliadin [Triticum ... -2    78  0.9993    1
sp|P02381|RMAR_YEAST MITOCHONDRIAL RIBOSOMAL PROTEIN V... -2    79  0.9993    1
pir||S69023          hypothetical protein YPR133c - ye... -2    79  0.9995    1
pir||S42928          probable membrane-spanning protei... +3    64  0.9995    2
gi|2425133           (AF020282) DG2033 gene product [D... -2    84  0.9996    1
sp|Q03661|YM67_YEAST HYPOTHETICAL 187.1 KD PROTEIN IN ... -2    85  0.9996    1
gi|340588            (L07539) cytochrome oxidase [Leis... +2    77  0.9996    1
gi|294138            (M83174) circumsporozoite protein... -2    79  0.9996    1
gnl|PID|e332344      (Y11185) 235kDa rhoptry protein [... -2    70  0.9996    1
gi|552228            (M83790) trophozoite antigen [Pla... -2    57  0.9997    1
gi|2209198           (AF004386) LOX6 [Helobdella robusta] -2    77  0.9997    1
gi|294125            (M83167) circumsporozoite protein... -2    79  0.9997    1
pir||B21124          Bkm-like sex-determining region h... +2    67  0.9998    1
gi|294151            (M83156) circumsporozoite protein... -2    79  0.9998    1
gnl|PID|e348262      (Z81483) C43D7.c [Caenorhabditis ... -2    72  0.9998    1
gnl|PID|e348265      (Z81483) C43D7.g [Caenorhabditis ... -2    72  0.9999    1
sp|Q00275|ATP6_APIME ATP SYNTHASE A CHAIN (PROTEIN 6) ... +2    75  0.9999    1



>gi|1519536 (U66912) ORF DG1016; initially derived from a plasmid disrupted
            gene; similar to protein-tyrosine phosphatase dlar precursor,
            Swiss-Prot Accession Number P16621 [Dictyostelium discoideum]
            Length = 660

  Minus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 4.0e-08, P = 4.0e-08
 Identities = 48/167 (28%), Positives = 78/167 (46%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKN---VHKK---DIQNINQNNNIV-GSDQXDDIFFKNNNDNFGE 326
             +PID+  NN N+ I+N N    +K        IN+ N++V G     +I   NN +N   
Sbjct:   383 QPIDNNSNNNNNIINNTNGIGFNKAFPTSRDPINRGNSVVLGGIMQSNITISNNQNNNNN 442

Query:   325 GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPG 146
               +  NI +N+ NN   + N  + + +++  NN  ++N   +  + + + NNV I E P 
Sbjct:   443 NNN-NNIINNI-NNNENNNNNDDDDNKNNNNNNNNNNNNNNNNNNNNNNDNNVTIVEPPP 500

Query:   145 DAHE----KELN---NIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                       LN   N F+N +  NN+  +   INN       NN+   N  N
Sbjct:   501 TLTRTVTASTLNSQLNAFLNNMNENNNNNNNNNINNNI----NNNNNNNNNNN 549

 Score = 117 (41.2 bits), Expect = 0.00021, P = 0.00021
 Identities = 43/154 (27%), Positives = 69/154 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDST---KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             N+GN+ V    + S     NN+N+N +N N     I NIN N N   +D  D+   KNNN
Sbjct:   416 NRGNSVVLGGIMQSNITISNNQNNNNNNNN--NNIINNINNNENNNNNDDDDN---KNNN 470

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             +N     +  N ++N  NN   D N    E   +    +   +T+ S ++  +++ N   
Sbjct:   471 NN---NNNNNNNNNNNNNNNNNDNNVTIVEPPPTLTRTVTA-STLNSQLNAFLNNMNENN 526

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTI 50
             N    +     +NN   N   NN   +    +NN T+
Sbjct:   527 NNNNNNNINNNINNNNNNNNNNNGTTKPIAIVNNFTL 563

 Score = 81 (28.5 bits), Expect = 8.2, P = 1.0
 Identities = 38/170 (22%), Positives = 67/170 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N+ N   D+   D  KNN N+N +N N +  +  N N +NN+   +    +        
Sbjct:   454 NNENNNNNDD---DDNKNNNNNNNNNNNNNNNNNNNNNNDNNVTIVEPPPTLTRTVTAST 510

Query:   334 FGEGQD--IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
                  +  + N++ N  NN   + N       ++  NN  +  T    +  +   N   +
Sbjct:   511 LNSQLNAFLNNMNEN--NNNNNNNNINNNINNNNNNNNNNNGTTKPIAIVNNFTLNRANM 568

Query:   160 N-EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             N    G+ H   LN   +N +     + S    N+  IF   +N    NQ N+
Sbjct:   569 NTSVVGEQHGF-LN---INSVAKTGMSLSS---NSMAIFSAVDNPNSPNQNNQ 614

 Score = 70 (24.6 bits), Expect = 7.8, Sum P(2) = 1.0
 Identities = 27/101 (26%), Positives = 40/101 (39%), Frame = -2

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFN---NIQHDNTMKSPVDKHMDHNNVPINEWPGDA 140
             N ++N+ NNT      K +       N   ++     M+S +    + NN   N      
Sbjct:   390 NNNNNIINNTNGIGFNKAFPTSRDPINRGNSVVLGGIMQSNITISNNQNNNNNNN----- 444

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +   +NNI  N+  NNND    K  NN       NN+   N  N
Sbjct:   445 NNNIINNINNNENNNNNDDDDNKNNNNNNNNNNNNNNNNNNNNN 488

 Score = 50 (17.6 bits), Expect = 7.8, Sum P(2) = 1.0
 Identities = 15/61 (24%), Positives = 26/61 (42%), Frame = -2

Query:   511 NKGNTYVDEEPI-DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             N G+   D+E   +  K    +    K   K++ + +    NI+  +  +  F  NNN N
Sbjct:    13 NSGDKEKDKEKEKEKEKEKEKEKEREKEKEKENAKGVTSPKNILPIN-LNSSFLPNNNGN 71

Query:   334 FG 329
              G
Sbjct:    72 NG 73


>sp|P14196|AAC2_DICDI AAC-RICH MRNA CLONE AAC11 PROTEIN >pir||S05355
            hypothetical protein (clone AAC11) - slime mold (Dictyostelium
            discoideum) (fragment) >gi|7174 (X16522) coding region (AA 448);
            pid:g7174 [Dictyostelium discoideum]
            Length = 448

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 9.7e-08, P = 9.7e-08
 Identities = 39/136 (28%), Positives = 62/136 (45%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N+N +N N +  +I NIN NNN   S+  ++    NNN+N     +  N ++N  NNT
Sbjct:   268 NSNNNNNNNN-NNSNINNINNNNNN-NSNNNNNSSNNNNNNNNSTNNNTNNNNNNTNNNT 325

Query:   280 PTDQNK--KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
               + N         ++  NN  + NT  + +  + ++NN P N    + H+   NN   N
Sbjct:   326 NNNNNNINNNNNNTNNNNNNANNQNTNNNNMGNNSNNNNNPNN----NNHQNNNNNNTSN 381

Query:   106 KIKNNNDAQSYKGINNKT 53
                      +  G NN T
Sbjct:   382 NSNTTTATTTAPGGNNLT 399

 Score = 114 (40.1 bits), Expect = 0.00035, P = 0.00035
 Identities = 29/107 (27%), Positives = 53/107 (49%), Frame = -2

Query:   472 STKNNRNDNISN-KNVHKKDIQNINQNNNIVGSDQXDDIFFKNN--NDNFGEGQDIQNIH 302
             +  NN N+N SN  N++  +  N N NNN   ++  ++    NN  N+N     +  N +
Sbjct:   270 NNNNNNNNNNSNINNINNNNNNNSNNNNNSSNNNNNNNNSTNNNTNNNNNNTNNNTNNNN 329

Query:   301 HNVYNNTP-TDQNKKEYEEESSGFNNI-QHDNTMKSPVDK-HMDHNN 170
             +N+ NN   T+ N      +++  NN+  + N   +P +  H ++NN
Sbjct:   330 NNINNNNNNTNNNNNNANNQNTNNNNMGNNSNNNNNPNNNNHQNNNN 376

 Score = 100 (35.2 bits), Expect = 0.026, P = 0.025
 Identities = 36/169 (21%), Positives = 67/169 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             S+  NT   +   D T   R      K     +  + +  +N +G+   +     NNN+N
Sbjct:   223 SDYNNTSFSDSNTDGTPKKRGRPPKAKG----ESPSASPTHNTLGNGILNS---NNNNNN 275

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGF-NNIQHDNTMKSPVDKHMDHNNVPIN 158
                  +I NI++N  NN+  + N       ++   NN  ++N   +  + + ++NN+  N
Sbjct:   276 NNNNSNINNINNNNNNNSNNNNNSSNNNNNNNNSTNNNTNNNNNNTNNNTNNNNNNINNN 335

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                 + +    NN   N     N++ +    NN       NN+   N  N
Sbjct:   336 NNNTNNNNNNANNQNTNNNNMGNNSNNNNNPNNNN-HQNNNNNNTSNNSN 384

 Score = 100 (35.2 bits), Expect = 0.026, P = 0.025
 Identities = 38/171 (22%), Positives = 67/171 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             S+  NT   +   D T   R      K     +  + +  +N +G+   +     NNN+N
Sbjct:   223 SDYNNTSFSDSNTDGTPKKRGRPPKAKG----ESPSASPTHNTLGNGILNS---NNNNNN 275

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
                  +I NI++N  NN+  + N       ++   N  + N   +  + + ++NN  IN 
Sbjct:   276 NNNNSNINNINNNNNNNSNNNNNSSNNNNNNNNSTN-NNTNNNNNNTNNNTNNNNNNINN 334

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                       NN   N   NNN+  + +  NN  +    NN+   N  N +
Sbjct:   335 ----------NN---NNTNNNNNNANNQNTNNNNMGNNSNNNNNPNNNNHQ 372

 Score = 98 (34.5 bits), Expect = 0.046, P = 0.045
 Identities = 27/97 (27%), Positives = 42/97 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             S   NT  +    ++  NN N+NI+N N       N N NNN   +   ++    NN++N
Sbjct:   309 STNNNTNNNNNNTNNNTNNNNNNINNNN------NNTNNNNNNANNQNTNNNNMGNNSNN 362

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI 224
                  +  N  +N  NNT  + N       + G NN+
Sbjct:   363 -NNNPNNNNHQNNNNNNTSNNSNTTTATTTAPGGNNL 398

 Score = 98 (34.5 bits), Expect = 0.046, P = 0.045
 Identities = 29/116 (25%), Positives = 49/116 (42%), Frame = -2

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NNN+N     +I NI++N  NN+  + N       ++   N  + N   +  + + ++NN
Sbjct:   271 NNNNNNNNNSNINNINNNNNNNSNNNNNSSNNNNNNNNSTN-NNTNNNNNNTNNNTNNNN 329

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
               IN           NN   N   NNN+  + +  NN  +    NN+   N  N +
Sbjct:   330 NNINN----------NN---NNTNNNNNNANNQNTNNNNMGNNSNNNNNPNNNNHQ 372

 Score = 76 (26.8 bits), Expect = 0.012, Sum P(2) = 0.012
 Identities = 19/75 (25%), Positives = 31/75 (41%), Frame = -2

Query:   232 NNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKT 53
             NN  ++N   S ++   ++NN   N     ++    NN   N   NNN+  +    NN  
Sbjct:   270 NNNNNNNNNNSNINNINNNNNNNSNNNNNSSNNNNNNNNSTNNNTNNNNNNTNNNTNNNN 329

Query:    52 IFLEENNDERYNQEN 8
               +  NN+   N  N
Sbjct:   330 NNINNNNNNTNNNNN 344

 Score = 67 (23.6 bits), Expect = 0.012, Sum P(2) = 0.012
 Identities = 22/93 (23%), Positives = 40/93 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N GN     +   +  N  +  I N++   + I N N NNN       ++    NNN+N
Sbjct:    81 NNSGNNNGQPQMHGTNLNGLSLAIQNQSSLPQPINNNNNNNN-------NNSNINNNNNN 133

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSG 236
                  +  N +  + N++PT  +    ++ S G
Sbjct:   134 SNNNNNNNNSNLGI-NSSPTQSSANSADKRSRG 165

 Score = 59 (20.8 bits), Expect = 0.075, Sum P(2) = 0.072
 Identities = 25/112 (22%), Positives = 45/112 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N GN     +   +  N  +  I N++   + I N N NNN       ++    NNN+N
Sbjct:    81 NNSGNNNGQPQMHGTNLNGLSLAIQNQSSLPQPINNNNNNNN-------NNSNINNNNNN 133

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
                  +  N +  + N++PT  +    ++ S G          K+P  +  D
Sbjct:   134 SNNNNNNNNSNLGI-NSSPTQSSANSADKRSRG-------RPRKNPPSEPKD 177

 Score = 53 (18.7 bits), Expect = 0.30, Sum P(2) = 0.26
 Identities = 15/60 (25%), Positives = 27/60 (45%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N++ +N    +    N+N  +  + +         NNN+N     +I N ++N  NN
Sbjct:    78 NNGNNSGNNNGQPQMHGTNLNGLSLAIQNQSSLPQPINNNNNNNNNNSNINNNNNNSNNN 137

 Score = 52 (18.3 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 20/79 (25%), Positives = 33/79 (41%), Frame = -2

Query:   244 SSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGI 65
             +S  +N   +  + S  + + ++NN  IN    + +    NN   N   NNN+  +    
Sbjct:   255 ASPTHNTLGNGILNSNNNNNNNNNNSNINNINNNNNNNSNNN---NNSSNNNNNNN-NST 310

Query:    64 NNKTIFLEENNDERYNQEN 8
             NN T     NN+   N  N
Sbjct:   311 NNNT---NNNNNNTNNNTN 326

 Score = 49 (17.2 bits), Expect = 0.76, Sum P(2) = 0.53
 Identities = 20/92 (21%), Positives = 35/92 (38%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N++ +N    +    N+N  +  + +         NNN+N        N + N+ NN
Sbjct:    78 NNGNNSGNNNGQPQMHGTNLNGLSLAIQNQSSLPQPINNNNNN-------NNNNSNINNN 130

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDK 188
                  N       + G N+    ++  S  DK
Sbjct:   131 NNNSNNNNNNNNSNLGINSSPTQSSANS-ADK 161


>sp|P04931|ARP_PLAFA ASPARAGINE-RICH PROTEIN (AG319) (ARP) >pir||A23770
            asparagine-rich protein - Plasmodium falciparum >gi|160092 (M24328)
            asparagine-rich protein [Plasmodium falciparum]
            Length = 537

  Minus Strand HSPs:

 Score = 137 (48.2 bits), Expect = 1.0e-07, P = 1.0e-07
 Identities = 46/162 (28%), Positives = 77/162 (47%), Frame = -2

Query:   478 IDSTKNNRN--DNISNKNVH---KKDIQNINQNN------NIVGSDQXDDIFFKNNNDNF 332
             +++  NN N  D+  + N H   K  + N N N       N +  +Q ++   K  N+N 
Sbjct:   307 MNNNMNNINSLDSDMSPNYHAHVKMSMMNYNNNESNTANPNQMNFEQTNNDNMKRENNNM 366

Query:   331 GE-GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNN--IQHDNTMKSPVDKHMDHNNVPI 161
                G D   +H N  NNTP+     ++   + G+NN  + ++N M S V+ +  + N   
Sbjct:   367 NNYGYDDNTVHVN--NNTPST----DFFSRAVGYNNNYLNNNNNMNSAVNNNSSNGNNMK 420

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             NE   + +  + N+   N   NNN+    + INN       NN+  YN +N
Sbjct:   421 NENSENKNVADNNDSLNNNKNNNNNINMNESINNNNTL---NNNNEYNNQN 468

 Score = 122 (42.9 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 52/182 (28%), Positives = 81/182 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNIS-NKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNND 338
             N  N Y +    D   NN N   S N NV +    N I+ NN+ + +       F +  +
Sbjct:    32 NFKNQYNNNYKFDENMNNSNTMHSRNSNVEEHLRNNSIDMNNSNINNYTNQQTRFSSFME 91

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNT-----MKSPVDK---HM 182
             N  E ++ +N H    NN    +NK  Y+  +S   N  ++ T     MK  ++    +M
Sbjct:    92 NENENEN-KNYHTGGMNNNIHFKNK--YDNNNSSMKNTDNNKTDTSYNMKGTINNDNNNM 148

Query:   181 DH-NNVP-INEWPGDAHEKELNNIFVNK-----IKNNNDAQSYKGINNKTIFLEENNDER 23
             D+  N+  INE+ G A  K   N ++NK      +NNND  +    NN       NN+  
Sbjct:   149 DYLRNINNINEYKGSAKNKFYTN-YMNKNNLKFTQNNNDNMNINEDNNNNNNNNNNNNGV 207

Query:    22 Y-NQEN 8
             + N +N
Sbjct:   208 FSNYQN 213

 Score = 121 (42.6 bits), Expect = 2.7e-05, P = 2.7e-05
 Identities = 50/171 (29%), Positives = 79/171 (46%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNIS-NKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNND 338
             N  N Y +    D   NN N   S N NV +    N I+ NN+ + +       F +  +
Sbjct:    32 NFKNQYNNNYKFDENMNNSNTMHSRNSNVEEHLRNNSIDMNNSNINNYTNQQTRFSSFME 91

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNT-----MKSPVDK---HM 182
             N  E ++ +N H    NN    +NK  Y+  +S   N  ++ T     MK  ++    +M
Sbjct:    92 NENENEN-KNYHTGGMNNNIHFKNK--YDNNNSSMKNTDNNKTDTSYNMKGTINNDNNNM 148

Query:   181 DH-NNVP-INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             D+  N+  INE+ G A  K   N ++NK   NN    +   NN  + + E+N+   N  N
Sbjct:   149 DYLRNINNINEYKGSAKNKFYTN-YMNK---NN--LKFTQNNNDNMNINEDNNNNNNNNN 202

 Score = 120 (42.2 bits), Expect = 4.8e-05, P = 4.8e-05
 Identities = 39/151 (25%), Positives = 72/151 (47%), Frame = -2

Query:   511 NKGNT-YVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             NK  T Y+++  +  T+NN NDN+ N N    +  N N NNN V S+  ++   +NN+ N
Sbjct:   166 NKFYTNYMNKNNLKFTQNN-NDNM-NINEDNNNNNNNNNNNNGVFSNYQNNNMNRNNSIN 223

Query:   334 FGEG-QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
                   +  NI++N+      D+N+         +N     N+M + ++ +M++N   +N
Sbjct:   224 IKRNLNNNNNINNNMNKMGSQDKNQNSNNNFYMNYNYQNRKNSMNNNMNNNMNNN---MN 280

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
                 +     +NN   + + NN +      +NN
Sbjct:   281 HNMNNNMNHNMNNNMNHNMNNNMNHNMNNNMNN 313

 Score = 120 (42.2 bits), Expect = 4.8e-05, P = 4.8e-05
 Identities = 42/163 (25%), Positives = 75/163 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNI-VGSDQXDDIFFKNNND 338
             +N  N  ++E   D+  NN N+N +N         N+N+NN+I +  +  ++    NN +
Sbjct:   183 NNNDNMNINE---DNNNNNNNNNNNNGVFSNYQNNNMNRNNSINIKRNLNNNNNINNNMN 239

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN-NVPI 161
               G     QN ++N Y N    QN+K     ++  NN  ++N M   ++ +M+HN N  +
Sbjct:   240 KMGSQDKNQNSNNNFYMNY-NYQNRKN--SMNNNMNNNMNNN-MNHNMNNNMNHNMNNNM 295

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
             N    +     +NN   N    ++D       + K   +  NN+E
Sbjct:   296 NHNMNNNMNHNMNNNMNNINSLDSDMSPNYHAHVKMSMMNYNNNE 340

 Score = 116 (40.8 bits), Expect = 0.00022, P = 0.00022
 Identities = 41/132 (31%), Positives = 57/132 (43%), Frame = -2

Query:   448 NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN---NNDNFGEGQDIQNIHHNVYNNTP 278
             N +NKN +  D  NIN  N     D   ++ FKN   NN  F E  +  N  H+  +N  
Sbjct:     2 NNNNKNNNNNDDGNINYQNTNEFKDNKKNMNFKNQYNNNYKFDENMNNSNTMHSRNSNVE 61

Query:   277 TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI--FVNK 104
                     +  +S  NN  +  T  S     M++ N   N+   + H   +NN   F NK
Sbjct:    62 EHLRNNSIDMNNSNINNYTNQQTRFS---SFMENENENENK---NYHTGGMNNNIHFKNK 115

Query:   103 IKNNNDAQSYKGINNKT 53
               NNN +      NNKT
Sbjct:   116 YDNNNSSMKNTD-NNKT 131

 Score = 115 (40.5 bits), Expect = 0.00033, P = 0.00033
 Identities = 42/155 (27%), Positives = 62/155 (40%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             S KN    N  NKN + K  QN N N NI   D  ++    NNN+N   G     +  N 
Sbjct:   163 SAKNKFYTNYMNKN-NLKFTQNNNDNMNI-NEDNNNN----NNNNNNNNG-----VFSNY 211

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIF 113
              NN     N    +   +  NNI ++       DK+ + NN     +     +  +NN  
Sbjct:   212 QNNNMNRNNSINIKRNLNNNNNINNNMNKMGSQDKNQNSNNNFYMNYNYQNRKNSMNNNM 271

Query:   112 VNKIKNNNDAQSYKGIN---NKTIFLEENNDERYNQEN 8
              N + NN +      +N   N  +    NN+  +N  N
Sbjct:   272 NNNMNNNMNHNMNNNMNHNMNNNMNHNMNNNMNHNMNN 309

 Score = 115 (40.5 bits), Expect = 0.00033, P = 0.00033
 Identities = 48/173 (27%), Positives = 81/173 (46%), Frame = -2

Query:   514 SNKGNTYVDEE-PIDSTKN-NRNDNISNKNVHKKDIQNINQNNN----IVGSDQXDDIFF 353
             SN  N  ++    I+  +N N N+NI+N N++K   Q+ NQN+N    +  + Q      
Sbjct:   209 SNYQNNNMNRNNSINIKRNLNNNNNINN-NMNKMGSQDKNQNSNNNFYMNYNYQNRKNSM 267

Query:   352 KNN-NDNFGEGQDIQ---NIHHNVYNNTPTDQNKKEYEEESSGFNNIQH-DNTMKSPVDK 188
              NN N+N     +     N++HN+ NN   + N       ++  NNI   D+ M      
Sbjct:   268 NNNMNNNMNNNMNHNMNNNMNHNMNNNMNHNMNNNMNHNMNNNMNNINSLDSDMSPNYHA 327

Query:   187 H-----MDHNNVPINEW-PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEEN 35
             H     M++NN   N   P   + ++ NN   N  + NN+  +Y G ++ T+ +  N
Sbjct:   328 HVKMSMMNYNNNESNTANPNQMNFEQTNND--NMKRENNNMNNY-GYDDNTVHVNNN 381

 Score = 112 (39.4 bits), Expect = 0.00090, P = 0.00090
 Identities = 34/126 (26%), Positives = 60/126 (47%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFF-KNNNDNFGEGQDIQNIHHN 296
             +  NN N  ++N + +  +++N N  N  V +D  D +   KNNN+N    + I N +  
Sbjct:   400 NNNNNMNSAVNNNSSNGNNMKNENSENKNV-ADNNDSLNNNKNNNNNINMNESINNNNTL 458

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE-KELNN 119
               NN   +QN  E +E+   +  +  D  +   ++  M   NV +N+   D ++  +  N
Sbjct:   459 NNNNEYNNQNNNE-DEDDDDWGELGEDKYID--INSIMKKKNVILNQLEADLNDLSKKGN 515

Query:   118 IFVNKIKN 95
                NK KN
Sbjct:   516 DGKNKKKN 523

 Score = 112 (39.4 bits), Expect = 0.00090, P = 0.00090
 Identities = 46/163 (28%), Positives = 73/163 (44%), Frame = -2

Query:   472 STKNNRNDNISN--KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN----FGEGQDIQ 311
             +T ++RN N+    +N +  D+ N N NN           F +N N+N    +  G    
Sbjct:    51 NTMHSRNSNVEEHLRN-NSIDMNNSNINN-YTNQQTRFSSFMENENENENKNYHTGGMNN 108

Query:   310 NIHH-NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
             NIH  N Y+N  +     +  +  + +N     N   + +D   + NN  INE+ G A  
Sbjct:   109 NIHFKNKYDNNNSSMKNTDNNKTDTSYNMKGTINNDNNNMDYLRNINN--INEYKGSAKN 166

Query:   133 KELNNIFVNK--IK---NNNDAQSYKGINNKTIFLEENNDERY-NQEN 8
             K   N ++NK  +K   NNND  +    NN       NN+  + N +N
Sbjct:   167 KFYTN-YMNKNNLKFTQNNNDNMNINEDNNNNNNNNNNNNGVFSNYQN 213

 Score = 108 (38.0 bits), Expect = 0.0031, P = 0.0031
 Identities = 43/169 (25%), Positives = 77/169 (45%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND---NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN 344
             +NK +T  + +   +  NN  D   NI+N N +K   +N    N +   ++ +  F +NN
Sbjct:   128 NNKTDTSYNMKGTINNDNNNMDYLRNINNINEYKGSAKNKFYTNYM---NKNNLKFTQNN 184

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             NDN    +D  N ++N  NN     N   Y+      NN+  +N++   + +++++NN  
Sbjct:   185 NDNMNINEDNNNNNNNNNNNNGVFSN---YQN-----NNMNRNNSIN--IKRNLNNNN-N 233

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             IN        ++ N    N    N + Q+ K   N  +    NN+  +N  N
Sbjct:   234 INNNMNKMGSQDKNQNSNNNFYMNYNYQNRKNSMNNNMNNNMNNNMNHNMNN 285

 Score = 107 (37.7 bits), Expect = 0.0041, P = 0.0041
 Identities = 48/177 (27%), Positives = 83/177 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFK-NNN-DNFGE-GQDIQ- 311
             +S  NN N+N++N   H  +  N+N N NN +  +  +++    NNN +N      D+  
Sbjct:   265 NSMNNNMNNNMNNNMNHNMN-NNMNHNMNNNMNHNMNNNMNHNMNNNMNNINSLDSDMSP 323

Query:   310 NIHHNV------YNNTPTDQ-NKKEYEEESSGFNNIQHDNT-MKS-PVDKHMDH--NNVP 164
             N H +V      YNN  ++  N  +   E +  +N++ +N  M +   D +  H  NN P
Sbjct:   324 NYHAHVKMSMMNYNNNESNTANPNQMNFEQTNNDNMKRENNNMNNYGYDDNTVHVNNNTP 383

Query:   163 INEWPGDA---HEKELNNIF-VNKIKNNNDAQ--SYKGINNKTIFLEENNDERYNQEN 8
               ++   A   +   LNN   +N   NNN +   + K  N++   + +NND   N +N
Sbjct:   384 STDFFSRAVGYNNNYLNNNNNMNSAVNNNSSNGNNMKNENSENKNVADNNDSLNNNKN 441

 Score = 106 (37.3 bits), Expect = 0.0057, P = 0.0057
 Identities = 47/168 (27%), Positives = 76/168 (45%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNIS-NKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNND 338
             N  N Y +    D   NN N   S N NV +    N I+ NN+ + +       F +  +
Sbjct:    32 NFKNQYNNNYKFDENMNNSNTMHSRNSNVEEHLRNNSIDMNNSNINNYTNQQTRFSSFME 91

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNT-----MKSPVDKHMDHN 173
             N  E ++ +N H    NN    +NK  Y+  +S   N  ++ T     MK  ++   D+N
Sbjct:    92 NENENEN-KNYHTGGMNNNIHFKNK--YDNNNSSMKNTDNNKTDTSYNMKGTINN--DNN 146

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTI--FLEENNDE-RYNQEN 8
             N+         + + +NNI  N+ K +   + Y    NK    F + NND    N++N
Sbjct:   147 NMD--------YLRNINNI--NEYKGSAKNKFYTNYMNKNNLKFTQNNNDNMNINEDN 194

 Score = 105 (37.0 bits), Expect = 0.0076, P = 0.0076
 Identities = 41/147 (27%), Positives = 67/147 (45%), Frame = -2

Query:   475 DSTKNNRNDNISNKNV-HKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             D  +N+ N+   N N  ++K+  N N NNN+            NNN N        N++H
Sbjct:   245 DKNQNSNNNFYMNYNYQNRKNSMNNNMNNNM------------NNNMNHNMNN---NMNH 289

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQH-DNTMKSPVDKH-----MDHNNVPINEW-PGDA 140
             N+ NN   + N       ++  NNI   D+ M      H     M++NN   N   P   
Sbjct:   290 NMNNNMNHNMNNNMNHNMNNNMNNINSLDSDMSPNYHAHVKMSMMNYNNNESNTANPNQM 349

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEEN 35
             + ++ NN   N  + NN+  +Y G ++ T+ +  N
Sbjct:   350 NFEQTNND--NMKRENNNMNNY-GYDDNTVHVNNN 381

 Score = 103 (36.3 bits), Expect = 0.014, P = 0.014
 Identities = 39/146 (26%), Positives = 69/146 (47%), Frame = -2

Query:   463 NNRNDNISNKN-VHKKDIQNIN---QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             NN   N +N N ++ +   N N   +NNN+      D+    NNN    +       ++N
Sbjct:   337 NNNESNTANPNQMNFEQTNNDNMKRENNNMNNYGYDDNTVHVNNNTPSTDFFSRAVGYNN 396

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
              Y N   + N       S+G NN++++N+     +K++  NN  +N      ++   NNI
Sbjct:   397 NYLNNNNNMNSAVNNNSSNG-NNMKNENSE----NKNVADNNDSLNN-----NKNNNNNI 446

Query:   115 FVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
              +N+  NNN+      +NN   +  +NN+E
Sbjct:   447 NMNESINNNNT-----LNNNNEYNNQNNNE 471

 Score = 103 (36.3 bits), Expect = 0.014, P = 0.014
 Identities = 47/163 (28%), Positives = 81/163 (49%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFK-NNN-DNFGE-GQDIQ- 311
             +S  NN N+N++N   H  +  N+N N NN +  +  +++    NNN +N      D+  
Sbjct:   265 NSMNNNMNNNMNNNMNHNMN-NNMNHNMNNNMNHNMNNNMNHNMNNNMNNINSLDSDMSP 323

Query:   310 NIHHNV------YNNTPTDQ-NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE- 155
             N H +V      YNN  ++  N  +   E +  +N++ +N   +  +   D N V +N  
Sbjct:   324 NYHAHVKMSMMNYNNNESNTANPNQMNFEQTNNDNMKRENNNMN--NYGYDDNTVHVNNN 381

Query:   154 WPG-DAHEKEL--NNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              P  D   + +  NN ++N   NNN+  S   +NN +     NN +  N EN+
Sbjct:   382 TPSTDFFSRAVGYNNNYLN---NNNNMNS--AVNNNSS--NGNNMKNENSENK 427

 Score = 103 (36.3 bits), Expect = 0.014, P = 0.014
 Identities = 45/174 (25%), Positives = 78/174 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHK-KDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +N  N  ++     +  NN N N++N   H   +  N N NNN+   +  D     N + 
Sbjct:   268 NNNMNNNMNNNMNHNMNNNMNHNMNNNMNHNMNNNMNHNMNNNMNNINSLDSDMSPNYHA 327

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQ------NKKEYEEESSGFNNIQHD-NTMKSPVDKHMD 179
             +      + N ++N  N    +Q      N    + E++  NN  +D NT+      H++
Sbjct:   328 HVK--MSMMNYNNNESNTANPNQMNFEQTNNDNMKRENNNMNNYGYDDNTV------HVN 379

Query:   178 HNNVPINEWPGDA---HEKELNNIF-VNKIKNNNDAQ--SYKGINNKTIFLEENNDERYN 17
              NN P  ++   A   +   LNN   +N   NNN +   + K  N++   + +NND   N
Sbjct:   380 -NNTPSTDFFSRAVGYNNNYLNNNNNMNSAVNNNSSNGNNMKNENSENKNVADNNDSLNN 438

Query:    16 QEN 8
              +N
Sbjct:   439 NKN 441

 Score = 101 (35.6 bits), Expect = 0.025, P = 0.025
 Identities = 46/169 (27%), Positives = 78/169 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISN-KNVHKK-----DIQNINQNNNIVGSDQXDDIFFKNNN 341
             N+ V+E   +++ +  N NI+N  N   +     + +N N+N N       ++I FKN  
Sbjct:    57 NSNVEEHLRNNSIDMNNSNINNYTNQQTRFSSFMENENENENKNYHTGGMNNNIHFKNKY 116

Query:   340 DNFGEGQDIQNIHHNV----YNNTPTDQNKKEYEEESSGFNNI-QHDNTMKSPV-DKHMD 179
             DN      ++N  +N     YN   T  N     +     NNI ++  + K+     +M+
Sbjct:   117 DN--NNSSMKNTDNNKTDTSYNMKGTINNDNNNMDYLRNINNINEYKGSAKNKFYTNYMN 174

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIF--LEENNDERYNQENE 5
              NN+   +   D       N+ +N+  NNN+  +    NN  +F   + NN  R N  N 
Sbjct:   175 KNNLKFTQNNND-------NMNINEDNNNNNNNNN---NNNGVFSNYQNNNMNRNNSINI 224

Query:     4 K 2
             K
Sbjct:   225 K 225

 Score = 100 (35.2 bits), Expect = 0.033, P = 0.032
 Identities = 35/125 (28%), Positives = 55/125 (44%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQN-KKEYEEESSGFNNIQHDNTM---KSPVDKH 185
             KNNN+N     + QN   N + +   + N K +Y        N+ + NTM    S V++H
Sbjct:     6 KNNNNNDDGNINYQNT--NEFKDNKKNMNFKNQYNNNYKFDENMNNSNTMHSRNSNVEEH 63

Query:   184 M-----DHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIF---LEENND 29
             +     D NN  IN +     +   ++   N+ +N N      G+NN   F    + NN 
Sbjct:    64 LRNNSIDMNNSNINNYTNQ--QTRFSSFMENENENENKNYHTGGMNNNIHFKNKYDNNNS 121

Query:    28 ERYNQENEK 2
                N +N K
Sbjct:   122 SMKNTDNNK 130

 Score = 100 (35.2 bits), Expect = 0.033, P = 0.032
 Identities = 43/159 (27%), Positives = 60/159 (37%), Frame = -2

Query:   448 NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN---NNDNFGEGQDIQNIHHNVYNNTP 278
             N +NKN +  D  NIN  N     D   ++ FKN   NN  F E  +  N  H+  +N  
Sbjct:     2 NNNNKNNNNNDDGNINYQNTNEFKDNKKNMNFKNQYNNNYKFDENMNNSNTMHSRNSNVE 61

Query:   277 TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN---NVPINEWPGDAHEK---ELNNI 116
                     +  +S  NN  +  T  S   ++ + N   N        + H K   + NN 
Sbjct:    62 EHLRNNSIDMNNSNINNYTNQQTRFSSFMENENENENKNYHTGGMNNNIHFKNKYDNNNS 121

Query:   115 FVNKIKNNNDAQSY--KGI----NNKTIFLEE-NNDERY 20
              +    NN    SY  KG     NN   +L   NN   Y
Sbjct:   122 SMKNTDNNKTDTSYNMKGTINNDNNNMDYLRNINNINEY 160

 Score = 100 (35.2 bits), Expect = 0.033, P = 0.032
 Identities = 44/163 (26%), Positives = 75/163 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFK-NNN-DNFGE-GQDIQ- 311
             +S  NN N+N++N   H  +  N+N N NN +  +  +++    NNN +N      D+  
Sbjct:   265 NSMNNNMNNNMNNNMNHNMN-NNMNHNMNNNMNHNMNNNMNHNMNNNMNNINSLDSDMSP 323

Query:   310 NIHHNV------YNNTPTDQ-NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE- 155
             N H +V      YNN  ++  N  +   E +  +N++ +N   +  +   D N V +N  
Sbjct:   324 NYHAHVKMSMMNYNNNESNTANPNQMNFEQTNNDNMKRENNNMN--NYGYDDNTVHVNNN 381

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              P             N + NNN+  S   +NN +     NN +  N EN+
Sbjct:   382 TPSTDFFSRAVGYNNNYLNNNNNMNS--AVNNNSS--NGNNMKNENSENK 427

 Score = 97 (34.1 bits), Expect = 0.077, P = 0.074
 Identities = 46/169 (27%), Positives = 77/169 (45%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQX---------DD 362
             S+  NT  D    D T  N    I+N N +   ++NIN  N   GS +          ++
Sbjct:   121 SSMKNT--DNNKTD-TSYNMKGTINNDNNNMDYLRNINNINEYKGSAKNKFYTNYMNKNN 177

Query:   361 I-FFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH 185
             + F +NNNDN    +D  N ++N  NN     N   Y+      NN+  +N++   + ++
Sbjct:   178 LKFTQNNNDNMNINEDNNNNNNNNNNNNGVFSN---YQN-----NNMNRNNSIN--IKRN 227

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +++NN  IN      +  ++ +   N+  NNN   +Y   N K       N+   N  N
Sbjct:   228 LNNNN-NINN-----NMNKMGSQDKNQNSNNNFYMNYNYQNRKNSMNNNMNNNMNNNMN 280

 Score = 95 (33.4 bits), Expect = 0.14, P = 0.13
 Identities = 38/147 (25%), Positives = 69/147 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNV-HKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             D  +N+ N+   N N  ++K+  N N NNN+      ++    N N+N     +  N++H
Sbjct:   245 DKNQNSNNNFYMNYNYQNRKNSMNNNMNNNM------NNNMNHNMNNNMNHNMN-NNMNH 297

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH-----MDHNNVPINEW-PGDAH 137
             N+ NN   + N        +  N++  D+ M      H     M++NN   N   P   +
Sbjct:   298 NMNNNMNHNMNNN-----MNNINSL--DSDMSPNYHAHVKMSMMNYNNNESNTANPNQMN 350

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEEN 35
              ++ NN   N  + NN+  +Y G ++ T+ +  N
Sbjct:   351 FEQTNND--NMKRENNNMNNY-GYDDNTVHVNNN 381

 Score = 94 (33.1 bits), Expect = 0.18, P = 0.16
 Identities = 43/168 (25%), Positives = 70/168 (41%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKK--DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             ID   +N N+  + +       + +N N+N N       ++I FKN  DN      ++N 
Sbjct:    69 IDMNNSNINNYTNQQTRFSSFMENENENENKNYHTGGMNNNIHFKNKYDN--NNSSMKNT 126

Query:   304 HHNV----YNNTPTDQNKKEYEEESSGFNNI-QHDNTMKSPV-DKHMDHNNVPINEWPGD 143
              +N     YN   T  N     +     NNI ++  + K+     +M+ NN+   +   D
Sbjct:   127 DNNKTDTSYNMKGTINNDNNNMDYLRNINNINEYKGSAKNKFYTNYMNKNNLKFTQNNND 186

Query:   142 -AHEKELNNIFVNKIKNNNDAQS-YKGIN---NKTIFLEENNDERYNQEN 8
               +  E NN   N   NNN   S Y+  N   N +I ++ N +   N  N
Sbjct:   187 NMNINEDNNNNNNNNNNNNGVFSNYQNNNMNRNNSINIKRNLNNNNNINN 236

 Score = 93 (32.7 bits), Expect = 0.24, P = 0.21
 Identities = 47/174 (27%), Positives = 79/174 (45%), Frame = -2

Query:   514 SNKGN-TYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             ++ GN  Y +       K N N      N +K D +N+N +N +   +   +   +NN+ 
Sbjct:    11 NDDGNINYQNTNEFKDNKKNMNFKNQYNNNYKFD-ENMNNSNTMHSRNSNVEEHLRNNSI 69

Query:   337 NFGEGQDIQNIHHNVYNNTPTD-----QNKKEYEEES---SGFNNIQH-----DNTMKSP 197
                   D+ N + N Y N  T      +N+ E E ++    G NN  H     DN   S 
Sbjct:    70 ------DMNNSNINNYTNQQTRFSSFMENENENENKNYHTGGMNNNIHFKNKYDNNNSSM 123

Query:   196 VDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKG-INNK--TIFLEENNDE 26
               K+ D+N    +         + NN+  + ++N N+   YKG   NK  T ++ +NN  
Sbjct:   124 --KNTDNNKTDTSYNMKGTINNDNNNM--DYLRNINNINEYKGSAKNKFYTNYMNKNN-L 178

Query:    25 RYNQEN 8
             ++ Q N
Sbjct:   179 KFTQNN 184

 Score = 89 (31.3 bits), Expect = 0.72, P = 0.51
 Identities = 21/76 (27%), Positives = 36/76 (47%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +  NN N  ++N + +  +++N N  N  V  +       KNNN+N    + I N +   
Sbjct:   400 NNNNNMNSAVNNNSSNGNNMKNENSENKNVADNNDSLNNNKNNNNNINMNESINNNNTLN 459

Query:   292 YNNTPTDQNKKEYEEE 245
              NN   +QN  E E++
Sbjct:   460 NNNEYNNQNNNEDEDD 475

 Score = 89 (31.3 bits), Expect = 0.72, P = 0.51
 Identities = 38/178 (21%), Positives = 81/178 (45%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSD--QXDDIF-----FKNN 344
             +++++ E  +  KN     ++N N+H K+  + N N+++  +D  + D  +       N+
Sbjct:    87 SSFMENENENENKNYHTGGMNN-NIHFKNKYD-NNNSSMKNTDNNKTDTSYNMKGTINND 144

Query:   343 NDNFGEGQDIQNIHH------NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM 182
             N+N    ++I NI+       N +     ++N  ++ + ++   NI  DN   +  + + 
Sbjct:   145 NNNMDYLRNINNINEYKGSAKNKFYTNYMNKNNLKFTQNNNDNMNINEDNNNNN--NNNN 202

Query:   181 DHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND--ERYNQEN 8
             ++N V  N    + +     NI  N   NNN   +   + ++      NN+    YN +N
Sbjct:   203 NNNGVFSNYQNNNMNRNNSINIKRNLNNNNNINNNMNKMGSQDKNQNSNNNFYMNYNYQN 262

Query:     7 EK 2
              K
Sbjct:   263 RK 264

 Score = 87 (30.6 bits), Expect = 1.3, P = 0.72
 Identities = 38/152 (25%), Positives = 64/152 (42%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN-NNDNFGEGQDIQNIHHNVYN 287
             +N N ++ N + +K D  + N    I  +D  +  + +N NN N  +G      + N  N
Sbjct:   117 DNNNSSMKNTDNNKTDT-SYNMKGTI-NNDNNNMDYLRNINNINEYKGSAKNKFYTNYMN 174

Query:   286 --NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIF 113
               N    QN  +    +   NN  ++N   + V  +  +NN+  N       ++ LNN  
Sbjct:   175 KNNLKFTQNNNDNMNINEDNNNNNNNNNNNNGVFSNYQNNNMNRNN--SINIKRNLNNN- 231

Query:   112 VNKIKNNNDAQSYKGIN---NKTIFLEENNDERYNQEN 8
              N I NN +    +  N   N   ++  N   R N  N
Sbjct:   232 -NNINNNMNKMGSQDKNQNSNNNFYMNYNYQNRKNSMN 268

 Score = 87 (30.6 bits), Expect = 1.3, P = 0.72
 Identities = 42/157 (26%), Positives = 64/157 (40%), Frame = -2

Query:   502 NTYVDEEP-IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDD--IFFKNNNDNF 332
             N Y +++    S   N N+N  NKN H   +     NNNI   ++ D+     KN ++N 
Sbjct:    77 NNYTNQQTRFSSFMENENEN-ENKNYHTGGM-----NNNIHFKNKYDNNNSSMKNTDNNK 130

Query:   331 GE-GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN--VPI 161
              +   +++   +N  NN    +N     E      N  + N M     K   +NN  + I
Sbjct:   131 TDTSYNMKGTINNDNNNMDYLRNINNINEYKGSAKNKFYTNYMNKNNLKFTQNNNDNMNI 190

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
             NE   + +    NN  V     NN+      IN K      NN
Sbjct:   191 NEDNNNNNNNNNNNNGVFSNYQNNNMNRNNSINIKRNLNNNNN 233

 Score = 86 (30.3 bits), Expect = 1.6, P = 0.81
 Identities = 35/135 (25%), Positives = 61/135 (45%), Frame = -2

Query:   463 NNRNDNISNKN-VHKKDIQNIN---QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             NN   N +N N ++ +   N N   +NNN+      D+    NNN    +       ++N
Sbjct:   337 NNNESNTANPNQMNFEQTNNDNMKRENNNMNNYGYDDNTVHVNNNTPSTDFFSRAVGYNN 396

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD--------HNNVPINEWPGDA 140
              Y N   + N       S+G NN++++N+    V  + D        +NN+ +NE   + 
Sbjct:   397 NYLNNNNNMNSAVNNNSSNG-NNMKNENSENKNVADNNDSLNNNKNNNNNINMNESINNN 455

Query:   139 HEKELNNIFVNKIKNNND 86
             +    NN + N+  NNN+
Sbjct:   456 NTLNNNNEYNNQ--NNNE 471

 Score = 86 (30.3 bits), Expect = 1.6, P = 0.81
 Identities = 37/143 (25%), Positives = 71/143 (49%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNI----SNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN 347
             +N+ NT  +   ++  + N NDN+    +N N +  D   ++ NNN   +D        N
Sbjct:   338 NNESNT-ANPNQMNFEQTN-NDNMKRENNNMNNYGYDDNTVHVNNNTPSTDFFSRAVGYN 395

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             NN  +    +  N++  V NN+    N K   E S   N   +++++ +  +K+ ++NN+
Sbjct:   396 NN--YLNNNN--NMNSAVNNNSSNGNNMKN--ENSENKNVADNNDSLNN--NKN-NNNNI 446

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNND 86
              +NE   + +    NN + N+  NNN+
Sbjct:   447 NMNESINNNNTLNNNNEYNNQ--NNNE 471

 Score = 83 (29.2 bits), Expect = 3.7, P = 0.98
 Identities = 40/174 (22%), Positives = 70/174 (40%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  N +       + KN+ N+N++N N++     N N NNN+  +   +     NNN N 
Sbjct:   249 NSNNNFYMNYNYQNRKNSMNNNMNN-NMNNN--MNHNMNNNMNHNMNNNMNHNMNNNMNH 305

Query:   331 GEGQDIQNIHHNVYNNTPT-----DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
                 ++ NI+    + +P        +   Y    S   N    N  ++  D +M   N 
Sbjct:   306 NMNNNMNNINSLDSDMSPNYHAHVKMSMMNYNNNESNTANPNQMNFEQTNND-NMKRENN 364

Query:   166 PINEWPGDAHEKELNN------IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              +N +  D +   +NN       F   +  NN+  +    NN    +  N+    N +NE
Sbjct:   365 NMNNYGYDDNTVHVNNNTPSTDFFSRAVGYNNNYLNNN--NNMNSAVNNNSSNGNNMKNE 422

 Score = 82 (28.9 bits), Expect = 4.8, P = 0.99
 Identities = 30/133 (22%), Positives = 65/133 (48%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN-IHHNV-YNNT 281
             N+ ++N N     + N + N N + ++  ++    +NND+    ++  N I+ N   NN 
Sbjct:   396 NNYLNNNNNMNSAVNNNSSNGNNMKNENSENKNVADNNDSLNNNKNNNNNINMNESINNN 455

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKI 101
              T  N  EY  +++  +    D+  +   DK++D N++          +K+  N+ +N++
Sbjct:   456 NTLNNNNEYNNQNNNEDE-DDDDWGELGEDKYIDINSIM---------KKK--NVILNQL 503

Query:   100 KNNNDAQSYKGINNK 56
             + + +  S KG + K
Sbjct:   504 EADLNDLSKKGNDGK 518


>bbs|170479 (S79359) arabinogalactan-protein, AGP [Nicotiana alata,
            cell-suspension culture filtrate, Peptide, 461 aa] [Nicotiana
            alata]
            Length = 461

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 1.0e-07, P = 1.0e-07
 Identities = 46/156 (29%), Positives = 76/156 (48%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             +S  NN  D+ +N N +  D  N N NNN       DD F +N N+N G  ++  N ++N
Sbjct:   173 ESYNNNGYDSNNNDNNNGYDSNN-NNNNN-------DDGFSENYNNN-GYSENANNKNNN 223

Query:   295 VYNNTPTDQNKKEYEEE-SSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
              Y+    + N   Y +  ++G++   ++N      + + ++NNV       + + K++NN
Sbjct:   224 GYSENYNNNNNNGYAKNYNNGYSQSYNNNNNFYSENYNNNNNNVFSENSNNNGYSKKINN 283

Query:   118 --IFVNKIKNNND-AQSYKGINNKTIFLEENN--DERYNQEN 8
                  N + NNN  ++SY   NN       NN   E YN  N
Sbjct:   284 NGYSQNYMNNNNGFSESYNNNNNNN---NNNNVFSENYNNNN 322

 Score = 132 (46.5 bits), Expect = 2.8e-07, P = 2.8e-07
 Identities = 43/171 (25%), Positives = 85/171 (49%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNR-NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFK--NN 344
             SN  N   D+   ++  NN  ++N +NKN +    +N N NNN   +   ++ + +  NN
Sbjct:   193 SNNNNNNNDDGFSENYNNNGYSENANNKNNNGYS-ENYNNNNNNGYAKNYNNGYSQSYNN 251

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFN-NIQHDNTMKSPVDKHMDHNNV 167
             N+NF   ++  N ++NV++   ++ N    +  ++G++ N  ++N   S    + ++NN 
Sbjct:   252 NNNF-YSENYNNNNNNVFSEN-SNNNGYSKKINNNGYSQNYMNNNNGFSESYNNNNNNNN 309

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQS-YKGINNKTIFLEENNDERYNQEN 8
               N +  + +    NN+F     NNN+  + Y+  NN      EN ++  +  N
Sbjct:   310 NNNVFSENYNNNNNNNVFSENYNNNNNNNAFYENYNNNNNGYSENYNQASSYNN 363

 Score = 124 (43.7 bits), Expect = 2.0e-06, P = 2.0e-06
 Identities = 43/168 (25%), Positives = 74/168 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNI-SNKNVHKKD---IQNINQNNNIVGSDQXDDIFFK-- 350
             N   +Y +    DS  N+ N+   SN N +  D    +N N N     ++  ++  +   
Sbjct:   170 NTDESY-NNNGYDSNNNDNNNGYDSNNNNNNNDDGFSENYNNNGYSENANNKNNNGYSEN 228

Query:   349 -NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEE-SSGFNNIQHDNTMKSPVDKHMDH 176
              NNN+N G  ++  N +   YNN     N   Y E  ++  NN+  +N+  +   K +++
Sbjct:   229 YNNNNNNGYAKNYNNGYSQSYNN-----NNNFYSENYNNNNNNVFSENSNNNGYSKKINN 283

Query:   175 NNVPINEWPGD-AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N    N    +    +  NN   N   NN  +++Y   NN  +F E  N+   N
Sbjct:   284 NGYSQNYMNNNNGFSESYNNNNNNNNNNNVFSENYNNNNNNNVFSENYNNNNNN 337

 Score = 119 (41.9 bits), Expect = 5.6e-05, P = 5.6e-05
 Identities = 40/151 (26%), Positives = 65/151 (43%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN-FGEGQDIQNIHHNVYN 287
             NN N+N   KN +    Q+ N NNN    +      + NNN+N F E  +  N +    N
Sbjct:   230 NNNNNNGYAKNYNNGYSQSYNNNNNFYSEN------YNNNNNNVFSENSN-NNGYSKKIN 282

Query:   286 NTPTDQNKKEYEEE-SSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFV 110
             N    QN        S  +NN  ++N   +   ++ ++NN   N +  + +    NN F 
Sbjct:   283 NNGYSQNYMNNNNGFSESYNNNNNNNNNNNVFSENYNNNNNN-NVFSENYNNNNNNNAFY 341

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
                 NNN+  S +  N  + +   NND    ++
Sbjct:   342 ENYNNNNNGYS-ENYNQASSY--NNNDNTVERQ 371

 Score = 111 (39.1 bits), Expect = 0.00097, P = 0.00097
 Identities = 40/154 (25%), Positives = 72/154 (46%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N+N +N NV  ++  N N NNN+   +  ++    NNN+ F E  +  N  ++   N
Sbjct:   302 NNNNNNNNNNNVFSENYNN-NNNNNVFSENYNNN----NNNNAFYENYNNNNNGYSENYN 356

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVD-KHMDHNNVPINEWPGDAHEKELNNIFVN 107
               +  N  +   E  G ++ +     K   D K+ + NN        + + +  N+  V+
Sbjct:   357 QASSYNNNDNTVERQGLSDTRFLENGKYYYDIKNENTNN--------NGYSENYNH--VS 406

Query:   106 KIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                NNN+    +G+++ T FL+ N +  Y+   EK
Sbjct:   407 SYNNNNNMVERQGLSD-TRFLD-NGNYFYSNNGEK 439

 Score = 106 (37.3 bits), Expect = 0.0046, P = 0.0046
 Identities = 37/154 (24%), Positives = 66/154 (42%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N+N +N NV  ++  N N NNN+   +  ++    NNN+ F E  +  N  ++   N
Sbjct:   302 NNNNNNNNNNNVFSENYNN-NNNNNVFSENYNNN----NNNNAFYENYNNNNNGYSENYN 356

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVD-KHMDHNNVPINEWPGDAHEKELNNIFVN 107
               +  N  +   E  G ++ +     K   D K+ + NN   +E     H    NN   N
Sbjct:   357 QASSYNNNDNTVERQGLSDTRFLENGKYYYDIKNENTNNNGYSE--NYNHVSSYNNN--N 412

Query:   106 KIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              +         + ++N   F   N ++   +E+E+
Sbjct:   413 NMVERQGLSDTRFLDNGNYFYSNNGEKMSVEESER 447

 Score = 104 (36.6 bits), Expect = 0.0085, P = 0.0084
 Identities = 41/156 (26%), Positives = 75/156 (48%), Frame = -2

Query:   463 NNRNDN-ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN-FGEGQDIQNIHHNVY 290
             N  + N ++N N   +   N N NNN   ++   + +  NNN+N F E  +  N ++  Y
Sbjct:   284 NGYSQNYMNNNNGFSESYNNNNNNNN--NNNVFSENYNNNNNNNVFSENYNNNNNNNAFY 341

Query:   289 NNTPTDQNK-KEYEEESSGFNNIQHDNTMKSP--VDKHMDHN-----NVPINEWPGDAHE 134
              N   + N   E   ++S +NN  +DNT++     D     N     ++       + + 
Sbjct:   342 ENYNNNNNGYSENYNQASSYNN--NDNTVERQGLSDTRFLENGKYYYDIKNENTNNNGYS 399

Query:   133 KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             +  N+  V+   NNN+    +G+++ T FL+ N +  Y+   EK
Sbjct:   400 ENYNH--VSSYNNNNNMVERQGLSD-TRFLD-NGNYFYSNNGEK 439

 Score = 104 (36.6 bits), Expect = 0.0085, P = 0.0084
 Identities = 41/174 (23%), Positives = 77/174 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKN----NRNDNISNKNVHKKDI--QNINQNNNIVGSDQXDDIFF 353
             +NK N    E   ++  N    N N+  S    +  +   +N N NNN V S+  ++  +
Sbjct:   218 NNKNNNGYSENYNNNNNNGYAKNYNNGYSQSYNNNNNFYSENYNNNNNNVFSENSNNNGY 277

Query:   352 KNNNDNFGEGQDIQNIHHNV---YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM 182
                 +N G  Q+  N ++     YNN   + N      E+  +NN  ++N      + + 
Sbjct:   278 SKKINNNGYSQNYMNNNNGFSESYNNNNNNNNNNNVFSEN--YNNNNNNNVFSENYNNN- 334

Query:   181 DHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             ++NN     +  + +    N    +   NN++    +G+++ T FLE N    Y+ +NE
Sbjct:   335 NNNNAFYENYNNNNNGYSENYNQASSYNNNDNTVERQGLSD-TRFLE-NGKYYYDIKNE 391

 Score = 103 (36.3 bits), Expect = 0.011, P = 0.011
 Identities = 37/135 (27%), Positives = 69/135 (51%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVG----SDQXDDIFFKN-NNDNFGEGQDI-QNIH 302
             NN N+N +N NV  ++  N N NNN+      ++  ++ F++N NN+N G  ++  Q   
Sbjct:   302 NNNNNNNNNNNVFSENYNN-NNNNNVFSENYNNNNNNNAFYENYNNNNNGYSENYNQASS 360

Query:   301 HNVYNNTPTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKHMDH-----NNVPINEWPGD 143
             +N  +NT   Q   +  + E    + +I+++NT  +   ++ +H     NN  + E  G 
Sbjct:   361 YNNNDNTVERQGLSDTRFLENGKYYYDIKNENTNNNGYSENYNHVSSYNNNNNMVERQGL 420

Query:   142 AHEKELNNIFVNKIKNNN 89
             +  + L+N   N   +NN
Sbjct:   421 SDTRFLDN--GNYFYSNN 436

 Score = 98 (34.5 bits), Expect = 0.048, P = 0.047
 Identities = 37/164 (22%), Positives = 68/164 (41%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  N +  E   ++  N  ++N SN N + K I N   + N + ++      + NNN+N 
Sbjct:   250 NNNNNFYSENYNNNNNNVFSEN-SNNNGYSKKINNNGYSQNYMNNNNGFSESYNNNNNNN 308

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSP-VDKHMDHNNVPIN- 158
                      ++N  NN    +N       ++ + N  ++N   S   ++   +NN     
Sbjct:   309 NNNNVFSENYNNNNNNNVFSENYNNNNNNNAFYENYNNNNNGYSENYNQASSYNNNDNTV 368

Query:   157 EWPGDAHEKELNN-IFVNKIKNNN-DAQSY-KGINNKTIFLEENN 32
             E  G +  + L N  +   IKN N +   Y +  N+ + +   NN
Sbjct:   369 ERQGLSDTRFLENGKYYYDIKNENTNNNGYSENYNHVSSYNNNNN 413

 Score = 91 (32.0 bits), Expect = 0.34, P = 0.29
 Identities = 35/146 (23%), Positives = 60/146 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNR--NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             +N  N  V  E  ++  NN   ++N +N N +    +N N NNN   S+  +     NNN
Sbjct:   306 NNNNNNNVFSENYNNNNNNNVFSENYNNNNNNNAFYENYNNNNNGY-SENYNQASSYNNN 364

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             DN  E Q + +           +  K  Y+ ++   NN  +       V  + ++NN+  
Sbjct:   365 DNTVERQGLSDTRF-------LENGKYYYDIKNENTNNNGYSENYNH-VSSYNNNNNMVE 416

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQS 77
              +   D    +  N F +   NN +  S
Sbjct:   417 RQGLSDTRFLDNGNYFYS---NNGEKMS 441

 Score = 80 (28.2 bits), Expect = 6.8, P = 1.0
 Identities = 21/98 (21%), Positives = 44/98 (44%), Frame = -2

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN 122
             +N  NN   D N      +     N  ++   ++  +K+ +  +   N    + + K  N
Sbjct:   183 NNNDNNNGYDSNNNNNNNDDGFSENYNNNGYSENANNKNNNGYSENYNNNNNNGYAKNYN 242

Query:   121 NIFVNKIKNNND--AQSYKGINNKTIFLEENNDERYNQE 11
             N +     NNN+  +++Y   NN  +F E +N+  Y+++
Sbjct:   243 NGYSQSYNNNNNFYSENYNN-NNNNVFSENSNNNGYSKK 280


>gnl|PID|d1007032 (D30801) TED3 [Zinnia elegans]
            Length = 319

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 51/168 (30%), Positives = 82/168 (48%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N GN Y  +   ++ +N  NDN +  N      +N N  NN  G +Q  D   +N N+ +
Sbjct:   114 NNGNGY-SQNGYNNNENGYNDNGNTNN------ENENGYNNQNGYNQNGDTNNENGNNQY 166

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVPI-- 161
             G   +I   + N YNN     NK  Y    +G++N  ++ N  K+  + + ++NN     
Sbjct:   167 GYNNEI-GYNQNGYNNNENGYNKNMYSNNYNGYSNSMYESNGYKT--ENNGENNNYMTFT 223

Query:   160 NE---WPGDAHE--KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             NE   + G+ +   KE NN + N   NN      +G+++ T FLE N    Y+  N
Sbjct:   224 NENSGYNGNRYTSPKEENNGYNN---NNGYMAEQQGMSD-TRFLE-NGKYSYDANN 274

 Score = 116 (40.8 bits), Expect = 9.4e-05, P = 9.4e-05
 Identities = 52/187 (27%), Positives = 101/187 (54%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDN--ISNKNVHKKDIQN-INQN---NNIVGSDQX---DDI 359
             N GN Y  +   ++ +N  NDN   +N+N +  + QN  NQN   NN  G++Q    ++I
Sbjct:   114 NNGNGY-SQNGYNNNENGYNDNGNTNNENENGYNNQNGYNQNGDTNNENGNNQYGYNNEI 172

Query:   358 FFK----NNNDNFGEGQDIQNIHHNVYNNTPTDQN--KKEYEEESSGFNNIQHDNT---- 209
              +     NNN+N G  +++ + ++N Y+N+  + N  K E   E++ +    ++N+    
Sbjct:   173 GYNQNGYNNNEN-GYNKNMYSNNYNGYSNSMYESNGYKTENNGENNNYMTFTNENSGYNG 231

Query:   208 --MKSPVDKHMDHNNVPINEWPGDAHEKELNNI-FVNKIKNNNDAQSYKGINNKTIFLEE 38
                 SP +++  +NN   N +   A ++ +++  F+   K + DA +  G N+++ + EE
Sbjct:   232 NRYTSPKEENNGYNNN--NGYM--AEQQGMSDTRFLENGKYSYDANN-NGNNHESSYEEE 286

Query:    37 --NNDERYNQENEK 2
               +N E Y + NE+
Sbjct:   287 VSDNGEGYYRNNEE 300

 Score = 97 (34.1 bits), Expect = 0.036, P = 0.035
 Identities = 46/164 (28%), Positives = 73/164 (44%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQN-INQN--NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             S   N   N  N+N    + +N  NQN  NN  G  Q     + NN + + +  +  N +
Sbjct:    85 SNNGNGYSNSLNENHGYSNNENGYNQNGYNNGNGYSQNG---YNNNENGYNDNGNTNNEN 141

Query:   301 HNVYNN-TPTDQNKKEYEEESS---GFNN-IQHD----NTMKSPVDKHM---DHNNVPIN 158
              N YNN    +QN     E  +   G+NN I ++    N  ++  +K+M   ++N    +
Sbjct:   142 ENGYNNQNGYNQNGDTNNENGNNQYGYNNEIGYNQNGYNNNENGYNKNMYSNNYNGYSNS 201

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              +  + ++ E N    N +   N+   Y G N  T   EENN   YN  N
Sbjct:   202 MYESNGYKTENNGENNNYMTFTNENSGYNG-NRYTSPKEENNG--YNNNN 248

 Score = 86 (30.3 bits), Expect = 0.79, P = 0.55
 Identities = 44/155 (28%), Positives = 72/155 (46%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDI-QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             ST NN   N  N N +   + +N   +NN  G +Q     + N N   G  Q+  N + N
Sbjct:    78 STNNNGYSN--NGNGYSNSLNENHGYSNNENGYNQNG---YNNGN---GYSQNGYNNNEN 129

Query:   295 VYNNTPTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKHMDHNN-VPINEWPGDAHEKEL 125
              YN+     N+ E  Y  ++ G+N  Q+ +T     +    +NN +  N+   + +E   
Sbjct:   130 GYNDNGNTNNENENGYNNQN-GYN--QNGDTNNENGNNQYGYNNEIGYNQNGYNNNENGY 186

Query:   124 N-NIFVNKIK--NNN--DAQSYKGINNKTIFLEENNDERYNQEN 8
             N N++ N     +N+  ++  YK  NN     E NN   +  EN
Sbjct:   187 NKNMYSNNYNGYSNSMYESNGYKTENNG----ENNNYMTFTNEN 226

 Score = 79 (27.8 bits), Expect = 5.3, P = 1.0
 Identities = 38/164 (23%), Positives = 67/164 (40%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDI---QNINQNNNIVGSDQXDDIFFKNNND 338
             +  T  DEE  +   N+ ++  S K    + +   Q+ + NNN  G     + +  + N+
Sbjct:    42 ENETLEDEE--EEETNDGDEFSSQKETPFEKLLSSQSYSTNNN--GYSNNGNGYSNSLNE 97

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             N G   +    + N YNN     ++  Y    +G+N+  + NT     + + + N    N
Sbjct:    98 NHGYSNNENGYNQNGYNNG-NGYSQNGYNNNENGYND--NGNTNNENENGYNNQNGYNQN 154

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN-DERYN 17
                GD + +  NN +     NN    +  G NN      +N     YN
Sbjct:   155 ---GDTNNENGNNQYGY---NNEIGYNQNGYNNNENGYNKNMYSNNYN 196


>gi|1513238 (U66369) ORFveg132; similar to Caenorhabditis elegans ORF F59B10.1
            encoded by EMBL Accession Number Z49132 [Dictyostelium discoideum]
            Length = 608

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 1.6e-07, P = 1.6e-07
 Identities = 36/146 (24%), Positives = 67/146 (45%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             ++  NN N+N +N N +  +  NIN NNN   ++   +I   NNN N      + N   N
Sbjct:   338 NNNNNNNNNNNNNNNNNNNNNNNINNNNNS-NNNSLGNI--NNNNSNMLTSSSLLNGRIN 394

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
              +NN   + N  ++   +   NN  H N      +++ ++NN   N+   ++ + E + +
Sbjct:   395 CFNNNINNNNNNQHNNNNQHNNNNNHHNINNQHNNQNNNNNNNNNNKCHWNSGDTEKSIV 454

Query:   115 FVNKIKNNNDAQSYKGINNKTIFLEE 38
             +  K+  N +  +Y      TI+  E
Sbjct:   455 YNGKVGINVENPAYALSVQGTIYASE 480

 Score = 104 (36.6 bits), Expect = 0.012, P = 0.012
 Identities = 46/182 (25%), Positives = 79/182 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKN-VHKKDIQNINQNNN--IVGSDQXDDIF--FK 350
             +N  N   +    ++  NN N+NI+N N  +   + NIN NN+  +  S   +     F 
Sbjct:   338 NNNNNNNNNNNNNNNNNNNNNNNINNNNNSNNNSLGNINNNNSNMLTSSSLLNGRINCFN 397

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NN +N    Q   N  HN  NN     N+   +  ++  NN    +      +K + +N 
Sbjct:   398 NNINNNNNNQHNNNNQHNNNNNHHNINNQHNNQNNNNNNNNNNKCHWNSGDTEKSIVYNG 457

Query:   169 -VPIN-EWPGDAHEKELNNIFVNK-IKNNNDAQ-SY--KGINNKTIFLEENN----DERY 20
              V IN E P  A   +   I+ ++ + + +D +  Y  K I++K+     N     D +Y
Sbjct:   458 KVGINVENPAYALSVQ-GTIYASEGVYHPSDLRIKYDLKSIDSKSNLDNVNRMKLYDYKY 516

Query:    19 NQE 11
             N +
Sbjct:   517 NPQ 519

 Score = 92 (32.4 bits), Expect = 0.37, P = 0.31
 Identities = 36/144 (25%), Positives = 62/144 (43%), Frame = -2

Query:   439 NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKK 260
             N N +  +  N N NNN   ++  ++I   NN++N   G +I N + N+  ++     + 
Sbjct:   335 NNNNNNNNNNNNNNNNNNNNNNNNNNINNNNNSNNNSLG-NINNNNSNMLTSSSLLNGRI 393

Query:   259 E-YEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDA 83
               +    +  NN QH+N  +   + + +H+N+       + H  + NN   N   NNN  
Sbjct:   394 NCFNNNINNNNNNQHNNNNQH--NNNNNHHNI------NNQHNNQNNN---NNNNNNNKC 442

Query:    82 QSYKGINNKTIFLEENNDERYNQEN 8
                 G   K+I    N     N EN
Sbjct:   443 HWNSGDTEKSIVY--NGKVGINVEN 465

 Score = 84 (29.6 bits), Expect = 3.3, P = 0.96
 Identities = 40/155 (25%), Positives = 65/155 (41%), Frame = -2

Query:   469 TKNNRNDNISNKNVHKKDIQNINQNN-NIVGSDQXDDIFFKNNNDNFGEGQD-----IQN 308
             T +N     +N N     I NI+ +  NIV S        +  +    +GQ       QN
Sbjct:   275 TSSNNGGGSNNMNCFGPTISNIDFSTMNIV-SPGHSPTSPRPLSQLTSQGQTNILRLTQN 333

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKE 128
              ++N  NN   + N       ++  NNI ++N   +    ++++NN   N     +    
Sbjct:   334 HNNNNNNNNNNNNNNNNNNNNNNNNNNINNNNNSNNNSLGNINNNNS--NMLTSSSLLNG 391

Query:   127 LNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
               N F N I NNN+ Q     NN+      NN+  +N  N+
Sbjct:   392 RINCFNNNINNNNNNQHNN--NNQ----HNNNNNHHNINNQ 426


>sp|P13824|ARP2_PLAFA CLUSTERED-ASPARAGINE-RICH PROTEIN >pir||A23535
            clustered-asparagine-rich protein - Plasmodium falciparum
            (fragment) >gi|552179 (M13021) antigen [Plasmodium falciparum]
            Length = 451

  Minus Strand HSPs:

 Score = 134 (47.2 bits), Expect = 1.6e-07, P = 1.6e-07
 Identities = 49/167 (29%), Positives = 82/167 (49%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRN--DNISN-KNVHKK-DIQNINQNNNIVGSDQXDDIFFKNN--N 341
             NT+  EE ++  KN +N  D     +N+  K  + N++ NNN   ++  +  F KNN  N
Sbjct:    82 NTH--EEALNVLKNIKNLIDTSGEERNIDAKFAVPNVSINNNN-NNNNSNTFFQKNNMNN 138

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQ--NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
              NF +G      ++N  N    +   N   Y   SS  NN    NT  + ++++M + N+
Sbjct:   139 TNFSQGSTNYGSNYNSENFQGNNNMNNYNFYNNNSSNNNNNNQTNTQNNFMNRNMKNKNM 198

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
               N    +++    NN+ +N   NNN   +   + N+  F+  NN+  YN  N K
Sbjct:   199 NNNNNNNNSN----NNMMMNMNFNNNQQMNNNPMLNQNNFMLNNNNN-YNN-NAK 247

 Score = 129 (45.4 bits), Expect = 5.6e-07, P = 5.6e-07
 Identities = 45/169 (26%), Positives = 75/169 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N Y       S  NN N   +  N   ++++N N NNN   ++  +++     N N
Sbjct:   160 NNNMNNYNFYNNNSSNNNNNNQTNTQNNFMNRNMKNKNMNNNNNNNNSNNNMMM---NMN 216

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             F   Q + N      NN   + N   Y   +   N++  D  M SP   H+++NN  IN 
Sbjct:   217 FNNNQQMNNNPMLNQNNFMLNNNNN-YNNNAKNVNDMYRDGEM-SP--NHLNNNNNNINN 272

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND-----ERYNQEN 8
                + +    NN  + +  N++ AQ Y+  N+ ++   EN D     E Y  +N
Sbjct:   273 NNNNNNNNNNNNNVMFRQNNSHLAQMYQA-NDNSLEDVENVDGLSLWEMYKDKN 325

 Score = 129 (45.4 bits), Expect = 5.6e-07, P = 5.6e-07
 Identities = 46/169 (27%), Positives = 71/169 (42%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNVHKKDIQNIN--QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             P  S  NN N+N SN    K ++ N N  Q +   GS+   + F  NNN N     +  +
Sbjct:   114 PNVSINNNNNNNNSNTFFQKNNMNNTNFSQGSTNYGSNYNSENFQGNNNMNNYNFYNNNS 173

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNNVPINEWPGDAHEK 131
              ++N  N T T  N      ++   NN  ++N   + +  +M+ +NN  +N  P      
Sbjct:   174 SNNNNNNQTNTQNNFMNRNMKNKNMNNNNNNNNSNNNMMMNMNFNNNQQMNNNPMLNQNN 233

Query:   130 EL---NNIFVNKIKNNNDA-----QSYKGINNKTIFLEENNDERYNQEN 8
              +   NN + N  KN ND       S   +NN    +  NN+   N  N
Sbjct:   234 FMLNNNNNYNNNAKNVNDMYRDGEMSPNHLNNNNNNINNNNNNNNNNNN 282

 Score = 126 (44.4 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 39/152 (25%), Positives = 66/152 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N Y       S  NN N   +  N   ++++N N NNN   ++  +++     N N
Sbjct:   160 NNNMNNYNFYNNNSSNNNNNNQTNTQNNFMNRNMKNKNMNNNNNNNNSNNNMMM---NMN 216

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             F   Q + N      NN   + N   Y   +   N++  D  M SP   H+++NN  IN 
Sbjct:   217 FNNNQQMNNNPMLNQNNFMLNNNNN-YNNNAKNVNDMYRDGEM-SP--NHLNNNNNNINN 272

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
                + +    NN  + +  N++ AQ Y+  +N
Sbjct:   273 NNNNNNNNNNNNNVMFRQNNSHLAQMYQANDN 304

 Score = 124 (43.7 bits), Expect = 2.0e-06, P = 2.0e-06
 Identities = 44/162 (27%), Positives = 70/162 (43%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNVHKKDIQNIN--QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             P  S  NN N+N SN    K ++ N N  Q +   GS+   + F  NNN N     +  +
Sbjct:   114 PNVSINNNNNNNNSNTFFQKNNMNNTNFSQGSTNYGSNYNSENFQGNNNMNNYNFYNNNS 173

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKE 128
              ++N  N T T  N      ++   NN  ++N   + +  +M+ NN   N+   +     
Sbjct:   174 SNNNNNNQTNTQNNFMNRNMKNKNMNNNNNNNNSNNNMMMNMNFNN---NQQMNNNPMLN 230

Query:   127 LNNIFVNKIKN-NNDAQS----YKGINNKTIFLEENNDERYNQEN 8
              NN  +N   N NN+A++    Y+        L  NN+   N  N
Sbjct:   231 QNNFMLNNNNNYNNNAKNVNDMYRDGEMSPNHLNNNNNNINNNNN 275

 Score = 116 (40.8 bits), Expect = 0.00017, P = 0.00017
 Identities = 38/157 (24%), Positives = 66/157 (42%), Frame = -2

Query:   478 IDSTKNNRN-D-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             ID++   RN D   +  NV   +  N N +N     +  ++  F   + N+G   + +N 
Sbjct:    98 IDTSGEERNIDAKFAVPNVSINNNNNNNNSNTFFQKNNMNNTNFSQGSTNYGSNYNSENF 157

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
               N  NN     N   Y   SS  NN    NT  + ++++M + N+  N    +++   +
Sbjct:   158 QGN--NNM---NNYNFYNNNSSNNNNNNQTNTQNNFMNRNMKNKNMNNNNNNNNSNNNMM 212

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              N+  N   NN    +   +N     L  NN+   N +N
Sbjct:   213 MNMNFN---NNQQMNNNPMLNQNNFMLNNNNNYNNNAKN 248

 Score = 108 (38.0 bits), Expect = 0.0024, P = 0.0024
 Identities = 40/170 (23%), Positives = 77/170 (45%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQ-NINQNN-NIVGSDQXDDIFFKNNN 341
             +N  NT+  +  +++T  ++       N + ++ Q N N NN N   ++  ++    NNN
Sbjct:   124 NNNSNTFFQKNNMNNTNFSQGSTNYGSNYNSENFQGNNNMNNYNFYNNNSSNN---NNNN 180

Query:   340 DNFGEGQDI-QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQ--HDNTMKSPVDKHMDHNN 170
                 +   + +N+ +   NN   + N       +  FNN Q  ++N M +  +  +++NN
Sbjct:   181 QTNTQNNFMNRNMKNKNMNNNNNNNNSNNNMMMNMNFNNNQQMNNNPMLNQNNFMLNNNN 240

Query:   169 ------VPINEW--PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
                     +N+    G+     LNN   N I NNN+  +    NN  +F + N+
Sbjct:   241 NYNNNAKNVNDMYRDGEMSPNHLNNNN-NNINNNNNNNNNNNNNNNVMFRQNNS 293

 Score = 107 (37.7 bits), Expect = 0.0032, P = 0.0032
 Identities = 36/151 (23%), Positives = 78/151 (51%), Frame = -2

Query:   472 STKNN-RNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             +T+NN  N N+ NKN++  +  N N NNN++ +   ++    NNN    +   + N ++N
Sbjct:   183 NTQNNFMNRNMKNKNMNNNNNNN-NSNNNMMMNMNFNNNQQMNNNPMLNQNNFMLNNNNN 241

Query:   295 VYNNTPTDQNK--KEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
              YNN   + N   ++ E   +  NN  ++ N   +  + + ++NNV   +   ++H  ++
Sbjct:   242 -YNNNAKNVNDMYRDGEMSPNHLNNNNNNINNNNNNNNNNNNNNNVMFRQ--NNSHLAQM 298

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERY 20
                  N ++   D ++  G++   ++ ++NN+  Y
Sbjct:   299 YQANDNSLE---DVENVDGLSLWEMYKDKNNNIFY 330

 Score = 96 (33.8 bits), Expect = 0.080, P = 0.077
 Identities = 40/159 (25%), Positives = 72/159 (45%), Frame = -2

Query:   475 DSTKNNRNDNIS-NKNVHKKDIQN----INQNNNIVGSDQXDDIFFKNNNDNFGEGQ--- 320
             ++  NN N+N+  N N +     N    +NQNN ++ ++   +   KN ND + +G+   
Sbjct:   201 NNNNNNSNNNMMMNMNFNNNQQMNNNPMLNQNNFMLNNNNNYNNNAKNVNDMYRDGEMSP 260

Query:   319 -DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM-DHNNVP-INEWP 149
               + N ++N+ NN   + N           NN  H   M    D  + D  NV  ++ W 
Sbjct:   261 NHLNNNNNNINNNNNNNNNNNNNNNVMFRQNN-SHLAQMYQANDNSLEDVENVDGLSLW- 318

Query:   148 GDAHEKELNNIFV--NKIKNNNDAQSYKGINNKTI-FLEENN 32
              + ++ + NNIF   N  K+ N    +   N  +I  +++ N
Sbjct:   319 -EMYKDKNNNIFYYNNLTKHANGINLFTQTNYSSITIMKKQN 359

 Score = 96 (33.8 bits), Expect = 0.080, P = 0.077
 Identities = 39/160 (24%), Positives = 72/160 (45%), Frame = -2

Query:   475 DSTKNNRNDNIS-NKNVHKKDIQN----INQNNNIVGSDQXDDIFFKNNNDNFGEGQ--- 320
             ++  NN N+N+  N N +     N    +NQNN ++ ++   +   KN ND + +G+   
Sbjct:   201 NNNNNNSNNNMMMNMNFNNNQQMNNNPMLNQNNFMLNNNNNYNNNAKNVNDMYRDGEMSP 260

Query:   319 -DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM-DHNNVP-INEWP 149
               + N ++N+ NN   + N           NN  H   M    D  + D  NV  ++ W 
Sbjct:   261 NHLNNNNNNINNNNNNNNNNNNNNNVMFRQNN-SHLAQMYQANDNSLEDVENVDGLSLW- 318

Query:   148 GDAHEKELNNIFV--NKIKNNNDAQSYKGINNKTIFLEENNDE 26
              + ++ + NNIF   N  K+ N    +   N  +I + +  ++
Sbjct:   319 -EMYKDKNNNIFYYNNLTKHANGINLFTQTNYSSITIMKKQNK 360

 Score = 85 (29.9 bits), Expect = 1.7, P = 0.82
 Identities = 37/146 (25%), Positives = 66/146 (45%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ----DIQNIHHNVYN 287
             N N +N N    +   +NQNN ++ ++   +   KN ND + +G+     + N ++N+ N
Sbjct:   214 NMNFNN-NQQMNNNPMLNQNNFMLNNNNNYNNNAKNVNDMYRDGEMSPNHLNNNNNNINN 272

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM-DHNNVP-INEWPGDAHEKELNNIF 113
             N   + N           NN  H   M    D  + D  NV  ++ W  + ++ + NNIF
Sbjct:   273 NNNNNNNNNNNNNVMFRQNN-SHLAQMYQANDNSLEDVENVDGLSLW--EMYKDKNNNIF 329

Query:   112 V--NKIKNNNDAQSYKGINNKTI-FLEENN 32
                N  K+ N    +   N  +I  +++ N
Sbjct:   330 YYNNLTKHANGINLFTQTNYSSITIMKKQN 359


>pir||S14535 asparagine-rich protein (clone 25C4) - Plasmodium falciparum
            >gi|9849 (X17486) Plasmodium falciparum mRNA for asparagine-rich
            antigen (clone 25C4) [Plasmodium falciparum]
            Length = 669

  Minus Strand HSPs:

 Score = 135 (47.5 bits), Expect = 2.3e-07, P = 2.3e-07
 Identities = 41/148 (27%), Positives = 72/148 (48%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI-----QNIHHN 296
             N NDN++N +        I+ N+    ++        NNN+N     ++      NI+HN
Sbjct:    92 NNNDNMNNVHCDNSTFMKIHYNDQF--NNHYPITINNNNNNNDSNNNNMYNNMSNNIYHN 149

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN-NVPINEWPGDAHEKELNN 119
             +Y+N   + N       ++  NNI ++N M + ++ +M++N N  +N    +     +NN
Sbjct:   150 IYHNISNNNNNISNNNMNNNMNNISNNN-MNNNMNNNMNNNMNNNMNNNMNNNMNNNMNN 208

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
                N I NNN   ++   NN  I   + ND+ YN
Sbjct:   209 NTTN-INNNNQF-NHTHFNNNLI--NQYNDQ-YN 237

 Score = 129 (45.4 bits), Expect = 1.0e-06, P = 1.0e-06
 Identities = 42/167 (25%), Positives = 82/167 (49%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQN--INQNNNIVGSDQXDDIFFK-NNNDNF 332
             ++++D++  +++  ++  NI+N+N + +D  N  +N N+N+      +  F K + ND F
Sbjct:    59 SSFMDKKMKENS--SKETNITNENQNGEDYSNDILNNNDNMNNVHCDNSTFMKIHYNDQF 116

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSG-FNNIQHD--NTMKSPVDKHMDHN--NV 167
                  I  I++N  NN     N   Y   S+  ++NI H+  N   +  + +M++N  N+
Sbjct:   117 NNHYPI-TINNN--NNNNDSNNNNMYNNMSNNIYHNIYHNISNNNNNISNNNMNNNMNNI 173

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               N    + +   +NN   N + NN +      +NN T  +  NN   +   N
Sbjct:   174 SNNNMNNNMNNN-MNNNMNNNMNNNMNNNMNNNMNNNTTNINNNNQFNHTHFN 225

 Score = 126 (44.4 bits), Expect = 2.1e-06, P = 2.1e-06
 Identities = 36/148 (24%), Positives = 68/148 (45%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             DS  NN  +N+SN N++     NI+ NNN + ++  ++     +N+N     +  N+++N
Sbjct:   132 DSNNNNMYNNMSN-NIYHNIYHNISNNNNNISNNNMNNNMNNISNNNMNNNMN-NNMNNN 189

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
             + NN   + N       ++   NI ++N        H   NN  IN++  D +   LNN 
Sbjct:   190 MNNNMNNNMNNNMNNNMNNNTTNINNNNQFN-----HTHFNNNLINQY-NDQYNIPLNNH 243

Query:   115 FVNKIKNNNDAQSYKGINNKTIFLEENN 32
               N++    +      ++ K +  + NN
Sbjct:   244 LNNQLTTQGNCNMNNELS-KQLSNQFNN 270

 Score = 113 (39.8 bits), Expect = 7.9e-05, Sum P(2) = 7.9e-05
 Identities = 37/124 (29%), Positives = 61/124 (49%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNN-NIVGSDQXDDIFFKNNND 338
             +N  N  ++    ++  NN N+N++N N++     N+N N  NI  ++Q +   F NN  
Sbjct:   171 NNISNNNMNNNMNNNMNNNMNNNMNN-NMNNNMNNNMNNNTTNINNNNQFNHTHFNNNLI 229

Query:   337 NFGEGQDIQNIH-HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             N  +  D  NI  +N  NN  T Q       E S   + Q +N +KSP++  +   N  +
Sbjct:   230 N--QYNDQYNIPLNNHLNNQLTTQGNCNMNNELSKQLSNQFNNQVKSPLNNIVGSANNLV 287

Query:   160 NEWPGD 143
             NE+  D
Sbjct:   288 NEYFSD 293

 Score = 108 (38.0 bits), Expect = 0.0041, P = 0.0041
 Identities = 47/162 (29%), Positives = 80/162 (49%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNIN---QNNNIVGSDQXDDIFFKNNNDNFGEGQ 320
             D+  + + KN  N NI ++N    +I NIN   +NNNI+  D+       NNN+N     
Sbjct:   481 DKNSLSNMKN-ANINIHDENYPNNNINNINNNNKNNNIILLDEHHH--HHNNNNNNNSNN 537

Query:   319 DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSP-VDKH--MDHNN-VPINEW 152
             +  N ++N  NN   + N        S    +   N+  +P V+ H  +  NN V +N  
Sbjct:   538 NNSNNNNNSNNNNSNNNNNAIVNNSLS--IPVAGINSYYAPGVNVHGFLGSNNAVMMNNT 595

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSY-KGINNKTIFLE---ENNDERYNQEN 8
               +    +LNN+      ++  A++Y K INN+ +F+    +NN    N ++
Sbjct:   596 ITNKTNNDLNNL----CSSSTGAKNYMKDINNR-LFVGTKIDNNTLNINTDH 642

 Score = 106 (37.3 bits), Expect = 0.0076, P = 0.0076
 Identities = 37/136 (27%), Positives = 68/136 (50%), Frame = -2

Query:   463 NNRNDNISNKNVHKK--DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             +N N+NISN N++    +I N N NNN+  +   +     NNN N     ++ N   N+ 
Sbjct:   155 SNNNNNISNNNMNNNMNNISNNNMNNNMNNNMNNNMNNNMNNNMNNNMNNNMNNNTTNIN 214

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN-NVPINEWPGDAHEKELNNIF 113
             NN     N+  +   ++   N Q+++    P++ H+++      N    +   K+L+N F
Sbjct:   215 NN-----NQFNHTHFNNNLIN-QYNDQYNIPLNNHLNNQLTTQGNCNMNNELSKQLSNQF 268

Query:   112 VNKIKN--NNDAQSYKGINNK 56
              N++K+  NN   S   + N+
Sbjct:   269 NNQVKSPLNNIVGSANNLVNE 289

 Score = 104 (36.6 bits), Expect = 0.0022, Sum P(2) = 0.0022
 Identities = 34/127 (26%), Positives = 57/127 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNK-NVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +N  N   +    ++  NN N+N++N  N +  +  N N NNN    +  +     + N+
Sbjct:   167 NNNMNNISNNNMNNNMNNNMNNNMNNNMNNNMNNNMNNNMNNNTTNINNNNQFNHTHFNN 226

Query:   337 NF-GEGQDIQNIH-HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             N   +  D  NI  +N  NN  T Q       E S   + Q +N +KSP++  +   N  
Sbjct:   227 NLINQYNDQYNIPLNNHLNNQLTTQGNCNMNNELSKQLSNQFNNQVKSPLNNIVGSANNL 286

Query:   163 INEWPGD 143
             +NE+  D
Sbjct:   287 VNEYFSD 293

 Score = 95 (33.4 bits), Expect = 0.18, P = 0.17
 Identities = 38/149 (25%), Positives = 60/149 (40%), Frame = -2

Query:   460 NRNDNISNK--NVHKKDIQNI-NQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             N+ND   NK  N  K  + N+ N N NI   +  ++     NN+N      + + HH+ +
Sbjct:   468 NKNDITMNKLLNEDKNSLSNMKNANINIHDENYPNNNINNINNNNKNNNIILLDEHHHHH 527

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW--PG-DAH------ 137
             NN   + +       ++  NN   +N   + V+  +      IN +  PG + H      
Sbjct:   528 NNNNNNNSNNNNSNNNNNSNNNNSNNNNNAIVNNSLSIPVAGINSYYAPGVNVHGFLGSN 587

Query:   136 -EKELNNIFVNKIKN--NNDAQSYKGINN 59
                 +NN   NK  N  NN   S  G  N
Sbjct:   588 NAVMMNNTITNKTNNDLNNLCSSSTGAKN 616

 Score = 89 (31.3 bits), Expect = 0.95, P = 0.61
 Identities = 35/152 (23%), Positives = 70/152 (46%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ++S  +N+ + I+  N++K+ I N    +N   ++    +       +F + +  +N   
Sbjct:    14 LESNASNKTNQINKLNLNKQ-ISNCFSKDNNNNNETQFSLSTCLTESSFMDKKMKENSSK 72

Query:   298 NVYNNTPTDQNKKEYEEE----SSGFNNIQHDNT--MKSPV-DKHMDHNNVPINEWPGDA 140
                N T  +QN ++Y  +    +   NN+  DN+  MK    D+  +H  + IN    + 
Sbjct:    73 ET-NITNENQNGEDYSNDILNNNDNMNNVHCDNSTFMKIHYNDQFNNHYPITINN-NNNN 130

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
             ++   NN++ N + NN     Y  I+N    +  NN
Sbjct:   131 NDSNNNNMY-NNMSNNIYHNIYHNISNNNNNISNNN 165

 Score = 89 (31.3 bits), Expect = 0.95, P = 0.61
 Identities = 44/154 (28%), Positives = 70/154 (45%), Frame = -2

Query:   490 DEEPIDSTKN-NRN---DNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             D+  + + KN N N   +N  N N++  +I N N+NNNI+  D+       NNN+N    
Sbjct:   481 DKNSLSNMKNANINIHDENYPNNNIN--NINNNNKNNNIILLDEHHH--HHNNNNNNNSN 536

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESS-----------------GF---NN-IQHDNTM 206
              +  N ++N  NN   + N        S                 GF   NN +  +NT+
Sbjct:   537 NNNSNNNNNSNNNNSNNNNNAIVNNSLSIPVAGINSYYAPGVNVHGFLGSNNAVMMNNTI 596

Query:   205 KSPVDKHMDHNNVPINEWPGDAHEKELNN-IFVN-KIKNN 92
              +  +   D NN+  +      + K++NN +FV  KI NN
Sbjct:   597 TNKTNN--DLNNLCSSSTGAKNYMKDINNRLFVGTKIDNN 634

 Score = 86 (30.3 bits), Expect = 2.2, P = 0.88
 Identities = 34/129 (26%), Positives = 57/129 (44%), Frame = -2

Query:   514 SNKGNTYV--DEEPI---DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFK 350
             +NK N  +  DE      ++  NN N+N SN N +  +  N N NNN + ++    I   
Sbjct:   511 NNKNNNIILLDEHHHHHNNNNNNNSNNNNSNNNNNSNN-NNSNNNNNAIVNNSLS-IPVA 568

Query:   349 NNNDNFGEGQDIQNI--HHN--VYNNTPTDQNKKEYEE---ESSGFNNIQHDNTMKSPVD 191
               N  +  G ++      +N  + NNT T++   +       S+G  N   D   +  V 
Sbjct:   569 GINSYYAPGVNVHGFLGSNNAVMMNNTITNKTNNDLNNLCSSSTGAKNYMKDINNRLFVG 628

Query:   190 KHMDHNNVPIN 158
               +D+N + IN
Sbjct:   629 TKIDNNTLNIN 639

 Score = 84 (29.6 bits), Expect = 3.7, P = 0.98
 Identities = 29/111 (26%), Positives = 50/111 (45%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI--H 302
             ++  NN N+N SN N +  +  N N NNN + ++    I     N  +  G ++      
Sbjct:   529 NNNNNNSNNNNSNNNNNSNN-NNSNNNNNAIVNNSLS-IPVAGINSYYAPGVNVHGFLGS 586

Query:   301 HN--VYNNTPTDQNKKEYEE---ESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             +N  + NNT T++   +       S+G  N   D   +  V   +D+N + IN
Sbjct:   587 NNAVMMNNTITNKTNNDLNNLCSSSTGAKNYMKDINNRLFVGTKIDNNTLNIN 639

 Score = 43 (15.1 bits), Expect = 7.9e-05, Sum P(2) = 7.9e-05
 Identities = 12/32 (37%), Positives = 19/32 (59%), Frame = -3

Query:   117 YLLIK*K-IIMMHNHIKA*ITKPFFWKKIMMK 25
             ++ IK K +I M+N +KA    P  WK+ M +
Sbjct:   357 HIKIKFKSMICMNNFLKAYKNTPDKWKEDMFR 388


>gi|452428 (X65740) ATPase 3 [Plasmodium falciparum]
           Length = 493

  Minus Strand HSPs:

 Score = 131 (46.1 bits), Expect = 3.9e-07, P = 3.9e-07
 Identities = 47/168 (27%), Positives = 81/168 (48%), Frame = -2

Query:   514 SNKGNTY-----VDEEPIDSTKN-NRNDNISNKNVHKKDIQNINQNNNIVGS-DQXDDIF 356
             +N  N Y     +++  +DS  N N ND I+++     +I    QNN+++ + ++ + + 
Sbjct:   230 NNNDNNYNYIYAIEDIRMDSMDNTNANDTINDEK--DNEIYEEKQNNDVLYNLNEKEQLI 287

Query:   355 FKNNNDNFGEG---QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH 185
               NN +   +    +  +N + N   NT    N   YEE ++  NN  H+N   +  D +
Sbjct:   288 DDNNMNEIKKTVYKEHFENYNTNDEPNTEEKINMDNYEELNNDHNN-DHNNDHSN--DHN 344

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
              DHNN   N+   D H  + NN   N   N+++       NN     + NN+  YN E
Sbjct:   345 NDHNNDHNNDHNND-HNNDHNNDHNNDHNNDHNNDHNNDHNN-----DHNNNNNYNNE 396

 Score = 127 (44.7 bits), Expect = 1.1e-06, P = 1.1e-06
 Identities = 48/160 (30%), Positives = 79/160 (49%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD-DIFFKNNND-NFGEGQDI 314
             E+ ID   NN N+    K V+K+  +N N N+     ++ + D + + NND N     D 
Sbjct:   284 EQLIDD--NNMNE--IKKTVYKEHFENYNTNDEPNTEEKINMDNYEELNNDHNNDHNNDH 339

Query:   313 QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
              N H+N +NN   D N     + ++  NN  H+N      D + DHNN   N+   D H 
Sbjct:   340 SNDHNNDHNN---DHNNDHNNDHNNDHNN-DHNN------DHNNDHNNDHNNDHNND-HN 388

Query:   133 KELNNIFVNKIK-NNNDAQSYKGINN---KTIFLEENNDER-YNQEN 8
                NN + N+   N+N    Y GI+     +  +++ N +  Y+++N
Sbjct:   389 N--NNNYNNEFNYNDNHHLQYVGIDGVREDSFVMDQRNIQNDYDEKN 433

 Score = 119 (41.9 bits), Expect = 6.2e-05, P = 6.2e-05
 Identities = 41/168 (24%), Positives = 70/168 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFK-NNND 338
             +N  N Y     I + ++ R D++ N N +  D  N  ++N I    Q +D+ +  N  +
Sbjct:   230 NNNDNNY---NYIYAIEDIRMDSMDNTNAN--DTINDEKDNEIYEEKQNNDVLYNLNEKE 284

Query:   337 NFGEGQDIQNIHHNVY-----NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
                +  ++  I   VY     N    D+   E +     +  + +D+      D   DHN
Sbjct:   285 QLIDDNNMNEIKKTVYKEHFENYNTNDEPNTEEKINMDNYEELNNDHNNDHNNDHSNDHN 344

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
             N   N+   D H  + NN   N   NN+    +   +N     + NN+  YN E
Sbjct:   345 NDHNNDHNND-HNNDHNNDH-NNDHNNDHNNDHNNDHNNDHNNDHNNNNNYNNE 396

 Score = 113 (39.8 bits), Expect = 0.00055, P = 0.00055
 Identities = 47/164 (28%), Positives = 75/164 (45%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNND-NFGEGQDI 314
             E +++  NN ++N  + N H  D  N + N  NN   +D  +D    +NND N     D 
Sbjct:   325 EELNNDHNNDHNN-DHSNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDH 383

Query:   313 QNIHHNV--YNN--TPTDQNKKEY------EEESSGFN--NIQHDNTMKSPVDKHMDHNN 170
              N H+N   YNN     D +  +Y       E+S   +  NIQ+D   K+  D H  + +
Sbjct:   384 NNDHNNNNNYNNEFNYNDNHHLQYVGIDGVREDSFVMDQRNIQNDYDEKNGDDNHTYNTS 443

Query:   169 VPINEWPGDAHEKELNNI--FVNKIKNNNDAQSYKGINNKTIFLEENN 32
               I+    + H    NN   +VN   NN+   +Y+  N +  +  E+N
Sbjct:   444 FDISNVHNNYHNNNNNNHVDYVNYDYNNH---AYENRNTQNKYFNESN 488

 Score = 110 (38.7 bits), Expect = 0.0014, P = 0.0014
 Identities = 42/167 (25%), Positives = 74/167 (44%), Frame = -2

Query:   499 TYVDEEPIDSTKN-NRNDNISN-----KNVHKKDIQNINQNNNIVGSDQXDDIFF--KNN 344
             T+ ++   D+  N N NDN  N     +++    + N N N+ I  +D+ D+  +  K N
Sbjct:   216 THNNDNNNDNNNNDNNNDNNYNYIYAIEDIRMDSMDNTNANDTI--NDEKDNEIYEEKQN 273

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM-KSPVDKHMDHNNV 167
             ND      + + +   + +N   +  K  Y+E    +N     NT  K  +D + + NN 
Sbjct:   274 NDVLYNLNEKEQL---IDDNNMNEIKKTVYKEHFENYNTNDEPNTEEKINMDNYEELNND 330

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
               N+   D H  + NN   N   NN+    +   +N     + NND   +  N+
Sbjct:   331 HNNDHNND-HSNDHNNDH-NNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNND 382

 Score = 109 (38.4 bits), Expect = 0.0020, P = 0.0020
 Identities = 40/161 (24%), Positives = 71/161 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNN 344
             ++  N + ++   D   ++ ND N  + N H  D  N + N  NN   +D  +D    NN
Sbjct:   333 NDHNNDHSNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNND---HNN 389

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             N+N+    +  + HH  Y      +      ++     NIQ+D   K+  D H  + +  
Sbjct:   390 NNNYNNEFNYNDNHHLQYVGIDGVREDSFVMDQ----RNIQNDYDEKNGDDNHTYNTSFD 445

Query:   163 INEWPGDAHEKELNNI--FVNKIKNNNDAQSYKGINNKTIFLEENN 32
             I+    + H    NN   +VN   NN+   +Y+  N +  +  E+N
Sbjct:   446 ISNVHNNYHNNNNNNHVDYVNYDYNNH---AYENRNTQNKYFNESN 488

 Score = 109 (38.4 bits), Expect = 0.0020, P = 0.0020
 Identities = 41/164 (25%), Positives = 71/164 (43%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-NFGEGQDIQN 308
             E +++  NN ++N  + N H  D  N N +NN   +D  +D    +NND N     D  N
Sbjct:   325 EELNNDHNNDHNN-DHSNDHNND-HN-NDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNN 381

Query:   307 IHHNVYNNTPTDQNKKEYEEESS----GFNNIQHDNTMKSP--VDKHMDHNNVPINEWPG 146
              H+N +NN     N+  Y +       G + ++ D+ +     +    D  N   N    
Sbjct:   382 DHNNDHNNNNNYNNEFNYNDNHHLQYVGIDGVREDSFVMDQRNIQNDYDEKNGDDNHTYN 441

Query:   145 DAHEKELNNIFVNKIKNNNDAQ-SYKGIN-NKTIFLEENNDERY-NQEN 8
              + +  ++N+  N   NNN+    Y   + N   +   N   +Y N+ N
Sbjct:   442 TSFD--ISNVHNNYHNNNNNNHVDYVNYDYNNHAYENRNTQNKYFNESN 488

 Score = 106 (37.3 bits), Expect = 0.0051, P = 0.0051
 Identities = 44/165 (26%), Positives = 75/165 (45%), Frame = -2

Query:   499 TYVDEEPIDSTKN-NRNDNISN-----KNVHKKDIQNINQNNNIVGSDQXDDIFF--KNN 344
             T+ ++   D+  N N NDN  N     +++    + N N N+ I  +D+ D+  +  K N
Sbjct:   216 THNNDNNNDNNNNDNNNDNNYNYIYAIEDIRMDSMDNTNANDTI--NDEKDNEIYEEKQN 273

Query:   343 ND---NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM-KSPVDKHMDH 176
             ND   N  E + +      + +N   +  K  Y+E    +N     NT  K  +D + + 
Sbjct:   274 NDVLYNLNEKEQL------IDDNNMNEIKKTVYKEHFENYNTNDEPNTEEKINMDNYEEL 327

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             NN   N+   D H  + NN   N   N+++       NN     + NND   +  N+
Sbjct:   328 NNDHNNDHNND-HSNDHNNDHNNDHNNDHNNDHNNDHNN-----DHNNDHNNDHNND 378

 Score = 103 (36.3 bits), Expect = 0.012, P = 0.012
 Identities = 42/169 (24%), Positives = 73/169 (43%), Frame = -2

Query:   511 NKGNTYVD-EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSD--QXDDIFFKNNN 341
             NK N Y   +E  + T NN N+N +N N    D  N N  N I   +  + D +   N N
Sbjct:   202 NK-NEYNSLQEKREPTHNNDNNNDNNNN----DNNNDNNYNYIYAIEDIRMDSMDNTNAN 256

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             D   + +D +       N+   + N+KE   + +  N I+     K+   +H ++ N   
Sbjct:   257 DTINDEKDNEIYEEKQNNDVLYNLNEKEQLIDDNNMNEIK-----KTVYKEHFENYNT-- 309

Query:   160 NEWPGDAHEKELNNIF-VNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             N+ P    +  ++N   +N   NN+    +   +N     + NND   +  N+
Sbjct:   310 NDEPNTEEKINMDNYEELNNDHNNDHNNDHSNDHNNDHNNDHNNDHNNDHNND 362

 Score = 101 (35.6 bits), Expect = 0.022, P = 0.022
 Identities = 46/168 (27%), Positives = 77/168 (45%), Frame = -2

Query:   505 GNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             GN +VD  PI++ +NN      NK +H  D   +N +N I       D    N++DN   
Sbjct:   119 GN-HVDILPIENKENNEY----NK-IHTLDDVTLNHDNVI----HHIDSLMPNHDDNNIH 168

Query:   325 GQDIQNIHHNVYNN-----TPTD-QNKKEYEEESSG-FNNIQHDNTMKSPVDKHMDHNNV 167
                   +++N YNN     +P   Q+ K +   +   +N++Q         D + D+NN 
Sbjct:   169 AHHNHVLYNNKYNNETSLKSPNGFQSMKSHMPMNKNEYNSLQEKREPTHNNDNNNDNNNN 228

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLE-ENNDERYNQENEK 2
               N      +   + +I ++ + N N   +     +  I+ E +NND  YN  NEK
Sbjct:   229 DNNNDNNYNYIYAIEDIRMDSMDNTNANDTINDEKDNEIYEEKQNNDVLYNL-NEK 283

 Score = 98 (34.5 bits), Expect = 0.052, P = 0.051
 Identities = 36/165 (21%), Positives = 68/165 (41%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N   ++EP    K N ++     N H  D  N + N++   +D  +D    NN+ N    
Sbjct:   306 NYNTNDEPNTEEKINMDNYEELNNDHNNDHNNDHSNDH--NNDHNND---HNNDHNNDHN 360

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP-INEWPG 146
              D  N H+N +NN   + +  ++  + +  NN  ++N      + H+ +  +  + E   
Sbjct:   361 NDHNNDHNNDHNNDHNNDHNNDHNNDHNNNNN--YNNEFNYNDNHHLQYVGIDGVREDSF 418

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                ++ + N +  K  N +D  +Y    +  I    NN    N  N
Sbjct:   419 VMDQRNIQNDYDEK--NGDDNHTYN--TSFDISNVHNNYHNNNNNN 460

 Score = 91 (32.0 bits), Expect = 0.37, P = 0.31
 Identities = 32/128 (25%), Positives = 62/128 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQX-DDIFF----- 353
             ++  N + ++   D   ++ ND+ +N N + +   N N +   VG D   +D F      
Sbjct:   365 NDHNNDHNNDHNNDHNNDHNNDHNNNNNYNNEFNYNDNHHLQYVGIDGVREDSFVMDQRN 424

Query:   352 -------KNNNDN--FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKS 200
                    KN +DN  +    DI N+H+N +NN   + N  +Y      +NN  ++N  ++
Sbjct:   425 IQNDYDEKNGDDNHTYNTSFDISNVHNNYHNNN--NNNHVDYVNYD--YNNHAYEN--RN 478

Query:   199 PVDKHMDHNNVPIN 158
               +K+ + +N  +N
Sbjct:   479 TQNKYFNESNSSMN 492

 Score = 88 (31.0 bits), Expect = 0.84, P = 0.57
 Identities = 27/105 (25%), Positives = 55/105 (52%), Frame = -2

Query:   472 STKNNRNDNIS-NKNVHKK--DIQNINQNNNIVGSDQX-DDIFFKNNNDN--FGEGQDIQ 311
             +  NN N+  + N N H +   I  + +++ ++      +D   KN +DN  +    DI 
Sbjct:   388 NNNNNYNNEFNYNDNHHLQYVGIDGVREDSFVMDQRNIQNDYDEKNGDDNHTYNTSFDIS 447

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             N+H+N +NN   + N  +Y      +NN  ++N  ++  +K+ + +N  +N
Sbjct:   448 NVHNNYHNNN--NNNHVDYVNYD--YNNHAYEN--RNTQNKYFNESNSSMN 492

 Score = 83 (29.2 bits), Expect = 3.3, P = 0.96
 Identities = 35/159 (22%), Positives = 71/159 (44%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNI-NQNNNIVGSDQXDDIFFKNNNDNFGE 326
             N  ++E+   S  N+ N+   NK +   D++ I NQ + +  S     IF KN   N   
Sbjct:    32 NNILNEKK-KSISNSVNNIYPNKLLSDDDLKQIKNQTSLLNVSKTLKSIFTKNAKSN--- 87

Query:   325 GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKS-PVD--KHMDHNNVPINE 155
                    H  +  +   +   KEY+  S   NN  H N +   P++  ++ ++N +   +
Sbjct:    88 -----EKHKQLSKDMKKEAQNKEYQINSVELNNFMHGNHVDILPIENKENNEYNKIHTLD 142

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
                  H+  +++I  + +  N+D  +    +N  ++  + N+E
Sbjct:   143 DVTLNHDNVIHHI--DSLMPNHDDNNIHAHHNHVLYNNKYNNE 183

 Score = 82 (28.9 bits), Expect = 4.3, P = 0.99
 Identities = 42/149 (28%), Positives = 66/149 (44%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             IDS   N +DN  N + H   +   N+ NN        +   K+ N  F   +    ++ 
Sbjct:   155 IDSLMPNHDDN--NIHAHHNHVLYNNKYNN--------ETSLKSPN-GFQSMKSHMPMNK 203

Query:   298 NVYNNT-----PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH-NNVPINEWPGDAH 137
             N YN+      PT  N    +  ++  NN  + N + +  D  MD  +N   N+   D  
Sbjct:   204 NEYNSLQEKREPTHNNDNNNDNNNNDNNNDNNYNYIYAIEDIRMDSMDNTNANDTIND-- 261

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
             EK+ N I+  K   NND   Y  +N K   +++NN
Sbjct:   262 EKD-NEIYEEK--QNNDVL-YN-LNEKEQLIDDNN 291


>gi|171388 (M36110) DDR48 stress protein [Saccharomyces cerevisiae]
           Length = 430

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 4.0e-07, P = 4.0e-07
 Identities = 44/169 (26%), Positives = 73/169 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NNND+
Sbjct:    98 SNNNDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNNDS 154

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   +     +N  +   +++NK  Y    ++S G NN     +       +   NN  
Sbjct:   155 YGSNNNDSYGSNNDDSYGSSNKNKSSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDS 214

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                   D++    N+ + +   NN+D  SY   N K      NND+ Y   N
Sbjct:   215 YGSNNDDSYGSNNNDSYGS---NNDD--SYGSSNKKKSSYGSNNDDSYGSSN 261

 Score = 122 (42.9 bits), Expect = 1.2e-05, P = 1.2e-05
 Identities = 41/174 (23%), Positives = 75/174 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NNND+
Sbjct:    98 SNNNDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNNDS 154

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   +     +N  +   +++NK  Y    ++S G NN     +       +   NN  
Sbjct:   155 YGSNNNDSYGSNNDDSYGSSNKNKSSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDS 214

Query:   163 INEWPGDAHEKELNNIFVNK----IKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
                   D++    N+ + +       ++N  +S  G NN   +   NN++ Y   N+
Sbjct:   215 YGSNNDDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNND 271

 Score = 117 (41.2 bits), Expect = 0.00011, P = 0.00011
 Identities = 42/170 (24%), Positives = 77/170 (45%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N+  + + E+  D  ++      SN +++  D    + NN+  GS+  D  +  NNND++
Sbjct:    42 NQFKSKIGEDRFDKMESKVRQQFSNTSINDND----SNNNDSYGSNNNDS-YGSNNNDSY 96

Query:   331 GEGQ-DIQNIHHN-VYNNTPTDQNKKEYEEESS-GFNNIQHDNTMKSPVDKHMDHNNVPI 161
             G    D    ++N  Y +   D      +++SS G NN     +  +  D +  +NN   
Sbjct:    97 GSNNNDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNN-DSYGSNNNDSY 155

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                  D++    ++ + +  KN +   SY G NN   +   NND+ Y   N+K
Sbjct:   156 GSNNNDSYGSNNDDSYGSSNKNKS---SY-GSNNDDSY-GSNNDDSYGSSNKK 203

 Score = 117 (41.2 bits), Expect = 0.00011, P = 0.00011
 Identities = 49/182 (26%), Positives = 81/182 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NNND+
Sbjct:    98 SNNNDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNNDS 154

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQH---DNTMKSPV-----DK 188
             +G   +     +N  +   +++NK  Y    ++S G NN       N  KS       D 
Sbjct:   155 YGSNNNDSYGSNNDDSYGSSNKNKSSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDS 214

Query:   187 HMDHNNVPINEWPGDAHEKELNNIF--VNKIKN----NNDAQSYKGINNKTIFLEENNDE 26
             +  +N+        D++    ++ +   NK K+    NND  SY   NN   +   NND+
Sbjct:   215 YGSNNDDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNND-DSYGSSNNNDSY-GSNNDD 272

Query:    25 RYNQENE 5
              Y   N+
Sbjct:   273 SYGSSNK 279

 Score = 115 (40.5 bits), Expect = 0.00024, P = 0.00024
 Identities = 41/169 (24%), Positives = 76/169 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N ND+  + N       + N+N +  GS+  DD +  NN+D+
Sbjct:   141 SNNNDSYGSNNN-DSYGSNNNDSYGSNN--DDSYGSSNKNKSSYGSNN-DDSYGSNNDDS 196

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             +G     ++ + +  N++    N   Y   ++      +D++  S   K   + +   N+
Sbjct:   197 YGSSNKKKSSYGSSNNDSYGSNNDDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSN--ND 254

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGIN-NKTIFLEENNDERYNQEN 8
                D++    NN   +   +NND  SY   N NK+ +   +ND+ Y   N
Sbjct:   255 ---DSYGSSNNN---DSYGSNND-DSYGSSNKNKSSYGSSSNDDSYGSSN 297

 Score = 110 (38.7 bits), Expect = 0.0012, P = 0.0012
 Identities = 44/169 (26%), Positives = 77/169 (45%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NN+D+
Sbjct:   217 SNNDDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNDDS 273

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNK-KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             +G      N + + Y ++  D +      ++S G +N +  ++  S  D     NN   +
Sbjct:   274 YGSS----NKNKSSYGSSSNDDSYGSSNNDDSYGSSN-KKKSSYGSNNDDSYGSNN---D 325

Query:   157 EWPGDAHEKELNNIFVNKIK--NNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +  G +++K+ +    N     +NND  SY   N K      NND+ Y   N
Sbjct:   326 DSYGSSNKKKSSYGSSNNDSYGSNND-DSYGSSNKKKSSYGSNNDDSYGSSN 376

 Score = 109 (38.4 bits), Expect = 0.0017, P = 0.0017
 Identities = 41/169 (24%), Positives = 73/169 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N+  + + E+  D  ++      SN +++  D    + NN+  GS+  D  +  NNND++
Sbjct:    42 NQFKSKIGEDRFDKMESKVRQQFSNTSINDND----SNNNDSYGSNNNDS-YGSNNNDSY 96

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
             G      N  +   NN     N     ++S G +N +  +   +  D +   NN   N+ 
Sbjct:    97 GSNN---NDSYGSNNNDSYGSNN----DDSYGSSNKKKSSYGSNNDDSYGSSNN---NDS 146

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGIN-NKTIFLEENNDERYNQENE 5
              G  +     +   +   +NND  SY   N NK+ +   NND+ Y   N+
Sbjct:   147 YGSNNNDSYGSNNNDSYGSNND-DSYGSSNKNKSSY-GSNNDDSYGSNND 194

 Score = 109 (38.4 bits), Expect = 0.0017, P = 0.0017
 Identities = 46/171 (26%), Positives = 76/171 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N ND+  + N       + N+  +  GS+  D     NNND+
Sbjct:    90 SNNNDSYGSNNN-DSYGSNNNDSYGSNN--DDSYGSSNKKKSSYGSNNDDSYGSSNNNDS 146

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             +G      N  +   NN     N     ++S G +N ++ ++  S  D     NN   ++
Sbjct:   147 YGSNN---NDSYGSNNNDSYGSNN----DDSYGSSN-KNKSSYGSNNDDSYGSNN---DD 195

Query:   154 WPGDAHEKELNNIFVNKIK--NNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
               G +++K+ +    N     +NND  SY G NN   +   NND+ Y   N+K
Sbjct:   196 SYGSSNKKKSSYGSSNNDSYGSNND-DSY-GSNNNDSY-GSNNDDSYGSSNKK 245

 Score = 108 (38.0 bits), Expect = 0.0022, P = 0.0022
 Identities = 48/178 (26%), Positives = 75/178 (42%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SNK  +       DS  +N +D+  + N  KK     + NN+  GS+  DD +  NNND+
Sbjct:   174 SNKNKSSYGSNNDDSYGSNNDDSYGSSN--KKKSSYGSSNNDSYGSNN-DDSYGSNNNDS 230

Query:   334 FGEGQD----IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQH---DNTMKSPV------ 194
             +G   D      N   + Y +   D        +S G NN       N  KS        
Sbjct:   231 YGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNNDDSYGSSNKNKSSYGSSSND 290

Query:   193 DKHMDHNNVPINEWPGDAHEKELNNIFVN--KIKNNNDAQSYKGINNKTIFLEENNDERY 20
             D +   NN   ++  G +++K+ +    N     +NND  SY   N K      +N++ Y
Sbjct:   291 DSYGSSNN---DDSYGSSNKKKSSYGSNNDDSYGSNND-DSYGSSNKKKSSYGSSNNDSY 346

Query:    19 NQENE 5
                N+
Sbjct:   347 GSNND 351

 Score = 104 (36.6 bits), Expect = 0.0076, P = 0.0076
 Identities = 37/160 (23%), Positives = 64/160 (40%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD---- 317
             +   +T  N ND+ +N +    +  +   NNN       +D +  NNND++G   D    
Sbjct:    62 QQFSNTSINDNDSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNDDSYG 121

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
               N   + Y +   D        +S G NN  +D+   +  D +  +N+        +  
Sbjct:   122 SSNKKKSSYGSNNDDSYGSSNNNDSYGSNN--NDSYGSNNNDSYGSNNDDSYGSSNKNKS 179

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
                 NN   +   +NND  SY   N K      +N++ Y   N+
Sbjct:   180 SYGSNND--DSYGSNND-DSYGSSNKKKSSYGSSNNDSYGSNND 220

 Score = 103 (36.3 bits), Expect = 0.010, P = 0.010
 Identities = 41/170 (24%), Positives = 79/170 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NN+D+
Sbjct:   217 SNNDDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNDDS 273

Query:   334 FGEGQDIQNIHHNVYNNTP--TDQNKKEY----EEESS-GFNNIQHDNTMKSPVDKHMDH 176
             +G     ++ + +  N+    +  N   Y    +++SS G NN   D++  S  D     
Sbjct:   274 YGSSNKNKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNN---DDSYGSNNDDSYGS 330

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             +N   + + G ++     +   +   ++N  +S  G NN   +   NN++ Y   N+
Sbjct:   331 SNKKKSSY-GSSNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNND 386

 Score = 97 (34.1 bits), Expect = 0.057, P = 0.055
 Identities = 42/169 (24%), Positives = 75/169 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST-KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIF-FKNNN 341
             SNK  +       DS   +N ND+  + N       + N+N +  GS   DD +   NN+
Sbjct:   242 SNKKKSSYGSNNDDSYGSSNNNDSYGSNN--DDSYGSSNKNKSSYGSSSNDDSYGSSNND 299

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             D++G     ++ + +  NN   D +     ++S G +N +  +   S  D +  +N+   
Sbjct:   300 DSYGSSNKKKSSYGS--NN---DDSYGSNNDDSYGSSNKKKSSYGSSNNDSYGSNND--- 351

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              +  G +++K+      +   +NND  SY   NN   +   NND+ Y   N
Sbjct:   352 -DSYGSSNKKK------SSYGSNND-DSYGSSNNNDSY-GSNNDDSYGSSN 393

 Score = 95 (33.4 bits), Expect = 0.10, P = 0.096
 Identities = 41/169 (24%), Positives = 74/169 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-- 341
             SN  ++Y      DS  +N +D+  + N +K    + + N++  GS   DD +  +N   
Sbjct:   251 SNNDDSYGSSNNNDSYGSNNDDSYGSSNKNKSSYGS-SSNDDSYGSSNNDDSYGSSNKKK 309

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQH---DNTMKSPVDKHMD 179
              ++G   D     +N  +   +++ K  Y     +S G NN       N  KS    + D
Sbjct:   310 SSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDSYGSNNDDSYGSSNKKKSSYGSNND 369

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              +    N    D++    ++ + +  +N N   SY G +N   +   NND+ Y   N
Sbjct:   370 DSYGSSNN--NDSYGSNNDDSYGSSNRNKN---SY-GSSN---YGSSNNDDSYGSSN 417

 Score = 92 (32.4 bits), Expect = 0.23, P = 0.21
 Identities = 33/152 (21%), Positives = 67/152 (44%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             N+ N+N  + N ++ D   + +  N++G D+ +    K   D F +   +++     ++N
Sbjct:    12 NSNNNNNDSGNNNQGDY--VTKAENMIGQDRVNQFKSKIGEDRFDK---MESKVRQQFSN 66

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNK 104
             T  + N      +S G NN  +D+   +  D +  +NN        D++    ++ + + 
Sbjct:    67 TSINDNDSN-NNDSYGSNN--NDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNDDSYGS- 122

Query:   103 IKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               +N    SY G NN   +   NN++ Y   N
Sbjct:   123 --SNKKKSSY-GSNNDDSYGSSNNNDSYGSNN 151

 Score = 89 (31.3 bits), Expect = 0.54, P = 0.41
 Identities = 33/170 (19%), Positives = 68/170 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y       S+  + ND+    N +     + N+  +  GS   D  +  NN+D+
Sbjct:   165 SNNDDSYGSSNKNKSSYGSNNDDSYGSN-NDDSYGSSNKKKSSYGSSNNDS-YGSNNDDS 222

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY-EEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             +G   +     +N  +   +++ K  Y       + +  ++++  S  D     +N   +
Sbjct:   223 YGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNNDDSYGSSNKNKS 282

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              +   +++    +       NN+D  SY   N K      NND+ Y   N+
Sbjct:   283 SYGSSSNDDSYGS------SNNDD--SYGSSNKKKSSYGSNNDDSYGSNND 325

 Score = 88 (31.0 bits), Expect = 0.70, P = 0.50
 Identities = 36/171 (21%), Positives = 76/171 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SNK  +       DS  +N +D+  + N    D    N +++   S++    +  NN+D+
Sbjct:   200 SNKKKSSYGSSNNDSYGSNNDDSYGSNN---NDSYGSNNDDSYGSSNKKKSSYGSNNDDS 256

Query:   334 FGEGQDIQNIHHNVYNNT-PTDQNKKEYEEESS--GFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   +  +   N  ++   +++NK  Y   S+   + +  +D++  S   K   + +  
Sbjct:   257 YGSSNNNDSYGSNNDDSYGSSNKNKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSN- 315

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              N+   D++    ++ + +   +N    SY   NN +     NND+ Y   N+K
Sbjct:   316 -ND---DSYGSNNDDSYGS---SNKKKSSYGSSNNDSY--GSNNDDSYGSSNKK 360

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.70
 Identities = 37/138 (26%), Positives = 56/138 (40%), Frame = -2

Query:   421 KDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEES 242
             K   N N NNN  G++   D   K  N     GQD  N   +       D+ + +  ++ 
Sbjct:     8 KQFANSNNNNNDSGNNNQGDYVTKAENMI---GQDRVNQFKSKIGEDRFDKMESKVRQQF 64

Query:   241 SGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDA------Q 80
             S  N   +DN   +  D +  +NN        D++    N+ + +   NNND+       
Sbjct:    65 S--NTSINDNDSNNN-DSYGSNNNDSYGSNNNDSYGSNNNDSYGS---NNNDSYGSNNDD 118

Query:    79 SYKGINNKTIFLEENNDERYNQEN 8
             SY   N K      NND+ Y   N
Sbjct:   119 SYGSSNKKKSSYGSNNDDSYGSSN 142

 Score = 84 (29.6 bits), Expect = 2.1, P = 0.88
 Identities = 25/96 (26%), Positives = 43/96 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SNK  +       DS  +N +D+  + N  KK     N N++  GS   +D +  NN+D+
Sbjct:   331 SNKKKSSYGSSNNDSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNDDS 388

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNN 227
             +G     +N + +  +N  +  N   Y   + G  N
Sbjct:   389 YGSSNRNKNSYGS--SNYGSSNNDDSYGSSNRGGRN 422

 Score = 82 (28.9 bits), Expect = 3.6, P = 0.97
 Identities = 33/167 (19%), Positives = 68/167 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y          +N+N +    + +     + N +++   S++    +  NN+D+
Sbjct:   260 SNNNDSYGSNNDDSYGSSNKNKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNNDDS 319

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   D      N   ++    N   Y    ++S G +N +  +   +  D +   NN  
Sbjct:   320 YGSNNDDSYGSSNKKKSSYGSSNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNN-- 377

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
              N+  G  ++    +   N+ KN+  + +Y   NN   +   N   R NQ
Sbjct:   378 -NDSYGSNNDDSYGSS--NRNKNSYGSSNYGSSNNDDSYGSSNRGGR-NQ 423


>sp|P18899|DR48_YEAST DDR48 STRESS PROTEIN (DNA DAMAGE-RESPONSIVE PROTEIN 48)
            (DDRP 48) (YP 75) (FLOCCULENT SPECIFIC PROTEIN) >pir||HHBYD8 heat
            shock protein DDR48 - yeast (Saccharomyces cerevisiae) >bbs|155542
            (S73336) FSP=flocculent specific protein [Saccharomyces
            cerevisiae=yeast, 747-31DU, Peptide, 430 aa] [Saccharomyces
            cerevisiae] >gi|854443 (Z49808) Ddr48p [Saccharomyces cerevisiae]
            Length = 430

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 4.0e-07, P = 4.0e-07
 Identities = 44/169 (26%), Positives = 73/169 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NNND+
Sbjct:    98 SNNNDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNNDS 154

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   +     +N  +   +++NK  Y    ++S G NN     +       +   NN  
Sbjct:   155 YGSNNNDSYGSNNDDSYGSSNKNKSSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDS 214

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                   D++    N+ + +   NN+D  SY   N K      NND+ Y   N
Sbjct:   215 YGSNNDDSYGSNNNDSYGS---NNDD--SYGSSNKKKSSYGSNNDDSYGSSN 261

 Score = 122 (42.9 bits), Expect = 1.2e-05, P = 1.2e-05
 Identities = 41/174 (23%), Positives = 75/174 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NNND+
Sbjct:    98 SNNNDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNNDS 154

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   +     +N  +   +++NK  Y    ++S G NN     +       +   NN  
Sbjct:   155 YGSNNNDSYGSNNDDSYGSSNKNKSSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDS 214

Query:   163 INEWPGDAHEKELNNIFVNK----IKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
                   D++    N+ + +       ++N  +S  G NN   +   NN++ Y   N+
Sbjct:   215 YGSNNDDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNND 271

 Score = 117 (41.2 bits), Expect = 0.00011, P = 0.00011
 Identities = 42/170 (24%), Positives = 77/170 (45%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N+  + + E+  D  ++      SN +++  D    + NN+  GS+  D  +  NNND++
Sbjct:    42 NQFKSKIGEDRFDKMESKVRQQFSNTSINDND----SNNNDSYGSNNNDS-YGSNNNDSY 96

Query:   331 GEGQ-DIQNIHHN-VYNNTPTDQNKKEYEEESS-GFNNIQHDNTMKSPVDKHMDHNNVPI 161
             G    D    ++N  Y +   D      +++SS G NN     +  +  D +  +NN   
Sbjct:    97 GSNNNDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNN-DSYGSNNNDSY 155

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                  D++    ++ + +  KN +   SY G NN   +   NND+ Y   N+K
Sbjct:   156 GSNNNDSYGSNNDDSYGSSNKNKS---SY-GSNNDDSY-GSNNDDSYGSSNKK 203

 Score = 117 (41.2 bits), Expect = 0.00011, P = 0.00011
 Identities = 49/182 (26%), Positives = 81/182 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NNND+
Sbjct:    98 SNNNDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNNDS 154

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQH---DNTMKSPV-----DK 188
             +G   +     +N  +   +++NK  Y    ++S G NN       N  KS       D 
Sbjct:   155 YGSNNNDSYGSNNDDSYGSSNKNKSSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDS 214

Query:   187 HMDHNNVPINEWPGDAHEKELNNIF--VNKIKN----NNDAQSYKGINNKTIFLEENNDE 26
             +  +N+        D++    ++ +   NK K+    NND  SY   NN   +   NND+
Sbjct:   215 YGSNNDDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNND-DSYGSSNNNDSY-GSNNDD 272

Query:    25 RYNQENE 5
              Y   N+
Sbjct:   273 SYGSSNK 279

 Score = 115 (40.5 bits), Expect = 0.00024, P = 0.00024
 Identities = 41/169 (24%), Positives = 76/169 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N ND+  + N       + N+N +  GS+  DD +  NN+D+
Sbjct:   141 SNNNDSYGSNNN-DSYGSNNNDSYGSNN--DDSYGSSNKNKSSYGSNN-DDSYGSNNDDS 196

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             +G     ++ + +  N++    N   Y   ++      +D++  S   K   + +   N+
Sbjct:   197 YGSSNKKKSSYGSSNNDSYGSNNDDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSN--ND 254

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGIN-NKTIFLEENNDERYNQEN 8
                D++    NN   +   +NND  SY   N NK+ +   +ND+ Y   N
Sbjct:   255 ---DSYGSSNNN---DSYGSNND-DSYGSSNKNKSSYGSSSNDDSYGSSN 297

 Score = 110 (38.7 bits), Expect = 0.0012, P = 0.0012
 Identities = 44/169 (26%), Positives = 77/169 (45%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NN+D+
Sbjct:   217 SNNDDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNDDS 273

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNK-KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             +G      N + + Y ++  D +      ++S G +N +  ++  S  D     NN   +
Sbjct:   274 YGSS----NKNKSSYGSSSNDDSYGSSNNDDSYGSSN-KKKSSYGSNNDDSYGSNN---D 325

Query:   157 EWPGDAHEKELNNIFVNKIK--NNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +  G +++K+ +    N     +NND  SY   N K      NND+ Y   N
Sbjct:   326 DSYGSSNKKKSSYGSSNNDSYGSNND-DSYGSSNKKKSSYGSNNDDSYGSSN 376

 Score = 109 (38.4 bits), Expect = 0.0017, P = 0.0017
 Identities = 41/169 (24%), Positives = 73/169 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N+  + + E+  D  ++      SN +++  D    + NN+  GS+  D  +  NNND++
Sbjct:    42 NQFKSKIGEDRFDKMESKVRQQFSNTSINDND----SNNNDSYGSNNNDS-YGSNNNDSY 96

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
             G      N  +   NN     N     ++S G +N +  +   +  D +   NN   N+ 
Sbjct:    97 GSNN---NDSYGSNNNDSYGSNN----DDSYGSSNKKKSSYGSNNDDSYGSSNN---NDS 146

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGIN-NKTIFLEENNDERYNQENE 5
              G  +     +   +   +NND  SY   N NK+ +   NND+ Y   N+
Sbjct:   147 YGSNNNDSYGSNNNDSYGSNND-DSYGSSNKNKSSY-GSNNDDSYGSNND 194

 Score = 109 (38.4 bits), Expect = 0.0017, P = 0.0017
 Identities = 46/171 (26%), Positives = 76/171 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N ND+  + N       + N+  +  GS+  D     NNND+
Sbjct:    90 SNNNDSYGSNNN-DSYGSNNNDSYGSNN--DDSYGSSNKKKSSYGSNNDDSYGSSNNNDS 146

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             +G      N  +   NN     N     ++S G +N ++ ++  S  D     NN   ++
Sbjct:   147 YGSNN---NDSYGSNNNDSYGSNN----DDSYGSSN-KNKSSYGSNNDDSYGSNN---DD 195

Query:   154 WPGDAHEKELNNIFVNKIK--NNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
               G +++K+ +    N     +NND  SY G NN   +   NND+ Y   N+K
Sbjct:   196 SYGSSNKKKSSYGSSNNDSYGSNND-DSY-GSNNNDSY-GSNNDDSYGSSNKK 245

 Score = 108 (38.0 bits), Expect = 0.0022, P = 0.0022
 Identities = 48/178 (26%), Positives = 75/178 (42%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SNK  +       DS  +N +D+  + N  KK     + NN+  GS+  DD +  NNND+
Sbjct:   174 SNKNKSSYGSNNDDSYGSNNDDSYGSSN--KKKSSYGSSNNDSYGSNN-DDSYGSNNNDS 230

Query:   334 FGEGQD----IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQH---DNTMKSPV------ 194
             +G   D      N   + Y +   D        +S G NN       N  KS        
Sbjct:   231 YGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNNDDSYGSSNKNKSSYGSSSND 290

Query:   193 DKHMDHNNVPINEWPGDAHEKELNNIFVN--KIKNNNDAQSYKGINNKTIFLEENNDERY 20
             D +   NN   ++  G +++K+ +    N     +NND  SY   N K      +N++ Y
Sbjct:   291 DSYGSSNN---DDSYGSSNKKKSSYGSNNDDSYGSNND-DSYGSSNKKKSSYGSSNNDSY 346

Query:    19 NQENE 5
                N+
Sbjct:   347 GSNND 351

 Score = 104 (36.6 bits), Expect = 0.0076, P = 0.0076
 Identities = 37/160 (23%), Positives = 64/160 (40%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD---- 317
             +   +T  N ND+ +N +    +  +   NNN       +D +  NNND++G   D    
Sbjct:    62 QQFSNTSINDNDSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNDDSYG 121

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
               N   + Y +   D        +S G NN  +D+   +  D +  +N+        +  
Sbjct:   122 SSNKKKSSYGSNNDDSYGSSNNNDSYGSNN--NDSYGSNNNDSYGSNNDDSYGSSNKNKS 179

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
                 NN   +   +NND  SY   N K      +N++ Y   N+
Sbjct:   180 SYGSNND--DSYGSNND-DSYGSSNKKKSSYGSSNNDSYGSNND 220

 Score = 103 (36.3 bits), Expect = 0.010, P = 0.010
 Identities = 41/170 (24%), Positives = 79/170 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y      DS  +N +D+  + N  KK     N N++  GS   +D +  NN+D+
Sbjct:   217 SNNDDSYGSNNN-DSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNDDS 273

Query:   334 FGEGQDIQNIHHNVYNNTP--TDQNKKEY----EEESS-GFNNIQHDNTMKSPVDKHMDH 176
             +G     ++ + +  N+    +  N   Y    +++SS G NN   D++  S  D     
Sbjct:   274 YGSSNKNKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNN---DDSYGSNNDDSYGS 330

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             +N   + + G ++     +   +   ++N  +S  G NN   +   NN++ Y   N+
Sbjct:   331 SNKKKSSY-GSSNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNND 386

 Score = 97 (34.1 bits), Expect = 0.057, P = 0.055
 Identities = 42/169 (24%), Positives = 75/169 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST-KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIF-FKNNN 341
             SNK  +       DS   +N ND+  + N       + N+N +  GS   DD +   NN+
Sbjct:   242 SNKKKSSYGSNNDDSYGSSNNNDSYGSNN--DDSYGSSNKNKSSYGSSSNDDSYGSSNND 299

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             D++G     ++ + +  NN   D +     ++S G +N +  +   S  D +  +N+   
Sbjct:   300 DSYGSSNKKKSSYGS--NN---DDSYGSNNDDSYGSSNKKKSSYGSSNNDSYGSNND--- 351

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              +  G +++K+      +   +NND  SY   NN   +   NND+ Y   N
Sbjct:   352 -DSYGSSNKKK------SSYGSNND-DSYGSSNNNDSY-GSNNDDSYGSSN 393

 Score = 95 (33.4 bits), Expect = 0.10, P = 0.096
 Identities = 41/169 (24%), Positives = 74/169 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-- 341
             SN  ++Y      DS  +N +D+  + N +K    + + N++  GS   DD +  +N   
Sbjct:   251 SNNDDSYGSSNNNDSYGSNNDDSYGSSNKNKSSYGS-SSNDDSYGSSNNDDSYGSSNKKK 309

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQH---DNTMKSPVDKHMD 179
              ++G   D     +N  +   +++ K  Y     +S G NN       N  KS    + D
Sbjct:   310 SSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDSYGSNNDDSYGSSNKKKSSYGSNND 369

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              +    N    D++    ++ + +  +N N   SY G +N   +   NND+ Y   N
Sbjct:   370 DSYGSSNN--NDSYGSNNDDSYGSSNRNKN---SY-GSSN---YGSSNNDDSYGSSN 417

 Score = 92 (32.4 bits), Expect = 0.23, P = 0.21
 Identities = 33/152 (21%), Positives = 67/152 (44%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             N+ N+N  + N ++ D   + +  N++G D+ +    K   D F +   +++     ++N
Sbjct:    12 NSNNNNNDSGNNNQGDY--VTKAENMIGEDRVNQFKSKIGEDRFDK---MESKVRQQFSN 66

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNK 104
             T  + N      +S G NN  +D+   +  D +  +NN        D++    ++ + + 
Sbjct:    67 TSINDNDSN-NNDSYGSNN--NDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNDDSYGS- 122

Query:   103 IKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               +N    SY G NN   +   NN++ Y   N
Sbjct:   123 --SNKKKSSY-GSNNDDSYGSSNNNDSYGSNN 151

 Score = 89 (31.3 bits), Expect = 0.54, P = 0.41
 Identities = 33/170 (19%), Positives = 68/170 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y       S+  + ND+    N +     + N+  +  GS   D  +  NN+D+
Sbjct:   165 SNNDDSYGSSNKNKSSYGSNNDDSYGSN-NDDSYGSSNKKKSSYGSSNNDS-YGSNNDDS 222

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY-EEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             +G   +     +N  +   +++ K  Y       + +  ++++  S  D     +N   +
Sbjct:   223 YGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNNDDSYGSSNKNKS 282

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              +   +++    +       NN+D  SY   N K      NND+ Y   N+
Sbjct:   283 SYGSSSNDDSYGS------SNNDD--SYGSSNKKKSSYGSNNDDSYGSNND 325

 Score = 88 (31.0 bits), Expect = 0.70, P = 0.50
 Identities = 36/171 (21%), Positives = 76/171 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SNK  +       DS  +N +D+  + N    D    N +++   S++    +  NN+D+
Sbjct:   200 SNKKKSSYGSSNNDSYGSNNDDSYGSNN---NDSYGSNNDDSYGSSNKKKSSYGSNNDDS 256

Query:   334 FGEGQDIQNIHHNVYNNT-PTDQNKKEYEEESS--GFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   +  +   N  ++   +++NK  Y   S+   + +  +D++  S   K   + +  
Sbjct:   257 YGSSNNNDSYGSNNDDSYGSSNKNKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSN- 315

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              N+   D++    ++ + +   +N    SY   NN +     NND+ Y   N+K
Sbjct:   316 -ND---DSYGSNNDDSYGS---SNKKKSSYGSSNNDSY--GSNNDDSYGSSNKK 360

 Score = 84 (29.6 bits), Expect = 2.1, P = 0.88
 Identities = 25/96 (26%), Positives = 43/96 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SNK  +       DS  +N +D+  + N  KK     N N++  GS   +D +  NN+D+
Sbjct:   331 SNKKKSSYGSSNNDSYGSNNDDSYGSSN-KKKSSYGSN-NDDSYGSSNNNDSYGSNNDDS 388

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNN 227
             +G     +N + +  +N  +  N   Y   + G  N
Sbjct:   389 YGSSNRNKNSYGS--SNYGSSNNDDSYGSSNRGGRN 422

 Score = 83 (29.2 bits), Expect = 2.8, P = 0.94
 Identities = 36/138 (26%), Positives = 56/138 (40%), Frame = -2

Query:   421 KDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEES 242
             K   N N NNN  G++   D   K  N     G+D  N   +       D+ + +  ++ 
Sbjct:     8 KQFANSNNNNNDSGNNNQGDYVTKAENMI---GEDRVNQFKSKIGEDRFDKMESKVRQQF 64

Query:   241 SGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDA------Q 80
             S  N   +DN   +  D +  +NN        D++    N+ + +   NNND+       
Sbjct:    65 S--NTSINDNDSNNN-DSYGSNNNDSYGSNNNDSYGSNNNDSYGS---NNNDSYGSNNDD 118

Query:    79 SYKGINNKTIFLEENNDERYNQEN 8
             SY   N K      NND+ Y   N
Sbjct:   119 SYGSSNKKKSSYGSNNDDSYGSSN 142

 Score = 82 (28.9 bits), Expect = 3.6, P = 0.97
 Identities = 33/167 (19%), Positives = 68/167 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  ++Y          +N+N +    + +     + N +++   S++    +  NN+D+
Sbjct:   260 SNNNDSYGSNNDDSYGSSNKNKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNNDDS 319

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEY---EEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             +G   D      N   ++    N   Y    ++S G +N +  +   +  D +   NN  
Sbjct:   320 YGSNNDDSYGSSNKKKSSYGSSNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNN-- 377

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
              N+  G  ++    +   N+ KN+  + +Y   NN   +   N   R NQ
Sbjct:   378 -NDSYGSNNDDSYGSS--NRNKNSYGSSNYGSSNNDDSYGSSNRGGR-NQ 423


>sp|P54677|PI4K_DICDI PHOSPHATIDYLINOSITOL 4-KINASE (PI4-KINASE)
            (PTDINS-4-KINASE) (PI4K-ALPHA) >gi|733528 (U23479)
            phosphatidylinositol 4-kinase [Dictyostelium discoideum]
            Length = 1093

  Minus Strand HSPs:

 Score = 134 (47.2 bits), Expect = 5.5e-07, P = 5.5e-07
 Identities = 42/145 (28%), Positives = 68/145 (46%), Frame = -2

Query:   496 YVDEEPID--STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             +++ +P    ++ NN N+NI+N N +  D    N NN I+ ++  D+     NN  +G  
Sbjct:   174 HIENDPKKDINSNNNNNNNINNNNSNNDD----NNNNEILPNENSDNSINDENNQ-YGNS 228

Query:   322 QDIQNIHHNVYNNTPTD---QNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
              +  NI     NN   D   QNK +   E+   N+   + T  SP+   M++NN   N  
Sbjct:   229 NNNNNISGE-NNNIKIDINSQNKSDSNIET--LNSTLCEETKTSPIKDDMENNNNNNNNN 285

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGIN 62
               + +    NN   N   NNN+  +   IN
Sbjct:   286 NNNNNNNNNNNNINNNNINNNNINNNNNIN 315

 Score = 127 (44.7 bits), Expect = 3.1e-06, P = 3.1e-06
 Identities = 34/138 (24%), Positives = 61/138 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             D  K+  ++N +N N++  +  N + NNN +  ++  D    + N+ +G   +  NI   
Sbjct:   178 DPKKDINSNNNNNNNINNNNSNNDDNNNNEILPNENSDNSINDENNQYGNSNNNNNISGE 237

Query:   295 VYNNTPTDQNKKEYEEES-SGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
               NN   D N +   + +    N+   + T  SP+   M++NN   N    + +    NN
Sbjct:   238 -NNNIKIDINSQNKSDSNIETLNSTLCEETKTSPIKDDMENNNNNNNNNNNNNNNNNNNN 296

Query:   118 IFVNKIKNNNDAQSYKGIN 62
                N   NNN+  +   IN
Sbjct:   297 NINNNNINNNNINNNNNIN 315

 Score = 107 (37.7 bits), Expect = 0.010, P = 0.0099
 Identities = 42/156 (26%), Positives = 77/156 (49%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNI----NQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             ++ NN N+NI+N N +  D  N     N+N++   +D+ +     NNN+N   G++  NI
Sbjct:   184 NSNNNNNNNINNNNSNNDDNNNNEILPNENSDNSINDENNQYGNSNNNNNIS-GEN-NNI 241

Query:   304 HHNVYNNTPTDQNKKEYEE---ESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
               ++ +   +D N +       E +  + I+ D  M++  + + ++NN   N    + + 
Sbjct:   242 KIDINSQNKSDSNIETLNSTLCEETKTSPIKDD--MENNNNNNNNNNNNNNNN--NNNNN 297

Query:   133 KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
                NNI  N I NNN+  +Y  IN     L+       +Q N+
Sbjct:   298 INNNNINNNNINNNNNI-NYGHINGSLSTLDGIGQPYISQPND 339

 Score = 98 (34.5 bits), Expect = 0.14, P = 0.13
 Identities = 40/143 (27%), Positives = 61/143 (42%), Frame = -2

Query:   436 KNVHKKDIQ-NINQNNNIVGSDQXDDIFFKNNNDNF-GEGQDIQ-NIHHNVYNNTPTDQN 266
             +N  KKDI  N N NNNI  ++  +D    NNN+    E  D   N  +N Y N+    N
Sbjct:   176 ENDPKKDINSNNNNNNNINNNNSNNDD--NNNNEILPNENSDNSINDENNQYGNS---NN 230

Query:   265 KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNND 86
                   E+   NNI+ D   ++  D +++  N  + E   +     + +   N   NNN+
Sbjct:   231 NNNISGEN---NNIKIDINSQNKSDSNIETLNSTLCE---ETKTSPIKDDMENNNNNNNN 284

Query:    85 AQSYKGINNKTIFLEENNDERYNQEN 8
               +    NN    +  NN    N  N
Sbjct:   285 NNNNNNNNNNNNNINNNNINNNNINN 310

 Score = 91 (32.0 bits), Expect = 0.97, P = 0.62
 Identities = 27/118 (22%), Positives = 48/118 (40%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNI-VGSDQXDDIFFKNNNDN 335
             N  N  +  E  D++ N+ N+   N N +  +I   N N  I + S    D   +  N  
Sbjct:   203 NNNNEILPNENSDNSINDENNQYGNSN-NNNNISGENNNIKIDINSQNKSDSNIETLNST 261

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
               E      I  ++ NN   + N       ++  NNI ++N   + ++ + + N   IN
Sbjct:   262 LCEETKTSPIKDDMENNNNNNNNNNNNNNNNNNNNNINNNNINNNNINNNNNINYGHIN 320

 Score = 91 (32.0 bits), Expect = 0.97, P = 0.62
 Identities = 32/161 (19%), Positives = 67/161 (41%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             D++  D + ++    I  K  H  +      N++ + +D   DI   NNN+N     +  
Sbjct:   146 DDDDFDLSDDDGGFEIIKKKCHHYE------NDHHIENDPKKDINSNNNNNNNINNNNSN 199

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN---EWPGDA 140
             N  +N     P + +     +E++ + N  ++N +        ++NN+ I+   +   D+
Sbjct:   200 NDDNNNNEILPNENSDNSINDENNQYGNSNNNNNISG------ENNNIKIDINSQNKSDS 253

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             + + LN+    + K +      +  NN       NN+   N  N
Sbjct:   254 NIETLNSTLCEETKTSPIKDDMENNNNNNNNNNNNNNNNNNNNN 297


>pir||S14469 asparagine-rich protein (clone 17C1) - Plasmodium falciparum
            (fragment) >gi|1335714 (X17484) Plasmodium falciparum mRNA for
            asparagine-rich antigen (clone 17C1) [Plasmodium falciparum]
            Length = 234

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 1.8e-06, P = 1.8e-06
 Identities = 44/152 (28%), Positives = 75/152 (49%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N  ++    ++  N+ N+N S+ N H  +  N N NNN+      ++ FF +NN N
Sbjct:    79 NNNMNNIMNNYNGNNNNNSNNNNNSSNNNHMSN--NNNNNNNMYNHMNNNNPFFNDNNKN 136

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH--NNVPI 161
                   ++N+ + + NN   +QN      + S  NN    N      + HM+H  NN+  
Sbjct:   137 MKMDM-MKNVGNTINNNM--NQNFNYNNIKGSYLNN----NQQVGGSNVHMNHQQNNMLN 189

Query:   160 NEWPGDA----HEKELNNIFVNK---IKNNNDAQSYKGINN 59
             ++   +A    ++  LNN  +NK     NNN+  +   INN
Sbjct:   190 DKMNNNAFNFKNQNYLNNNHMNKQSIADNNNNNNNNNNINN 230

 Score = 111 (39.1 bits), Expect = 0.00026, P = 0.00026
 Identities = 35/141 (24%), Positives = 67/141 (47%), Frame = -2

Query:   430 VHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN-TPTDQNKKEY 254
             ++K  ++N + N      ++   +  +NNN+NF   +   N  +N+ NN    + N    
Sbjct:    43 INKDKMKNFHVNQK---QNKFKKMINRNNNNNFSNIRQGNNNMNNIMNNYNGNNNNNSNN 99

Query:   253 EEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSY 74
                SS  N++ ++N   + +  HM++NN   N+   +     + N+  N I NNN  Q++
Sbjct:   100 NNNSSNNNHMSNNNNNNNNMYNHMNNNNPFFNDNNKNMKMDMMKNVG-NTI-NNNMNQNF 157

Query:    73 KGINNKTIFLEENNDERYNQEN 8
                N K  +L  NN+++    N
Sbjct:   158 NYNNIKGSYL--NNNQQVGGSN 177

 Score = 109 (38.4 bits), Expect = 0.00051, P = 0.00051
 Identities = 44/174 (25%), Positives = 84/174 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNND 338
             + K N +  ++ I+   NN   NI   N +  +I N  N NNN   ++  +     NNN 
Sbjct:    54 NQKQNKF--KKMINRNNNNNFSNIRQGNNNMNNIMNNYNGNNNNNSNNNNNS---SNNNH 108

Query:   337 NFGEGQDIQNIHHNVYNNTPT-DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP- 164
                   +  N+++++ NN P  + N K  + +     N+   NT+ + ++++ ++NN+  
Sbjct:   109 MSNNNNNNNNMYNHMNNNNPFFNDNNKNMKMDM--MKNV--GNTINNNMNQNFNYNNIKG 164

Query:   163 ----INEWPG--DAHEKELNNIFVNKIKNNNDAQSYKG---INNKTI---FLEENNDERY 20
                  N+  G  + H     N  +N  K NN+A ++K    +NN  +    + +NN+   
Sbjct:   165 SYLNNNQQVGGSNVHMNHQQNNMLND-KMNNNAFNFKNQNYLNNNHMNKQSIADNNNNNN 223

Query:    19 NQEN 8
             N  N
Sbjct:   224 NNNN 227

 Score = 89 (31.3 bits), Expect = 0.20, P = 0.18
 Identities = 29/154 (18%), Positives = 63/154 (40%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             K N+   + N+N +  +  NI Q NN + +   +  +  NNN+N     +  N +H + N
Sbjct:    56 KQNKFKKMINRN-NNNNFSNIRQGNNNMNNIMNN--YNGNNNNNSNNNNNSSNNNH-MSN 111

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N   + N   +   ++ F N   DN     +D   +  N   N    + +   +   ++N
Sbjct:   112 NNNNNNNMYNHMNNNNPFFN---DNNKNMKMDMMKNVGNTINNNMNQNFNYNNIKGSYLN 168

Query:   106 KIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
               +    +  +       +  ++ N+  +N +N+
Sbjct:   169 NNQQVGGSNVHMNHQQNNMLNDKMNNNAFNFKNQ 202

 Score = 86 (30.3 bits), Expect = 0.46, P = 0.37
 Identities = 33/106 (31%), Positives = 49/106 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQN---NNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             D+ KN + D +  KNV      N+NQN   NNI GS       + NNN   G G ++   
Sbjct:   132 DNNKNMKMDMM--KNVGNTINNNMNQNFNYNNIKGS-------YLNNNQQVG-GSNVHMN 181

Query:   304 HHNVYNNTPTDQ-NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             H    NN   D+ N   +  ++  + N  H N      + + ++NN  IN
Sbjct:   182 HQQ--NNMLNDKMNNNAFNFKNQNYLNNNHMNKQSIADNNNNNNNNNNIN 229

 Score = 82 (28.9 bits), Expect = 1.4, P = 0.75
 Identities = 29/106 (27%), Positives = 50/106 (47%), Frame = -2

Query:   463 NNRND--NISNKNVHKKDIQNINQ--NNNIVGSDQXDDI--FFKNNNDNFGEGQDIQNIH 302
             NN N   N +NKN+    ++N+    NNN+  +   ++I   + NNN   G G ++   H
Sbjct:   124 NNNNPFFNDNNKNMKMDMMKNVGNTINNNMNQNFNYNNIKGSYLNNNQQVG-GSNVHMNH 182

Query:   301 HNVYNNTPTDQ-NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
                 NN   D+ N   +  ++  + N  H N      + + ++NN  IN
Sbjct:   183 QQ--NNMLNDKMNNNAFNFKNQNYLNNNHMNKQSIADNNNNNNNNNNIN 229

 Score = 82 (28.9 bits), Expect = 1.4, P = 0.75
 Identities = 29/129 (22%), Positives = 63/129 (48%), Frame = -2

Query:   418 DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEE--- 248
             +I+++N++  + G      + +  NN +F  G     I+ +   N   +Q + ++++   
Sbjct:    12 NIEDMNRSLELNGK-----MIYSGNN-SFEHGTISVIINKDKMKNFHVNQKQNKFKKMIN 65

Query:   247 --ESSGFNNI-QHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQS 77
                ++ F+NI Q +N M + ++ +  +NN   N     ++   ++N       NNN+   
Sbjct:    66 RNNNNNFSNIRQGNNNMNNIMNNYNGNNNNNSNNNNNSSNNNHMSN------NNNNNNNM 119

Query:    76 YKGINNKTIFLEENN 32
             Y  +NN   F  +NN
Sbjct:   120 YNHMNNNNPFFNDNN 134

 Score = 77 (27.1 bits), Expect = 5.5, P = 1.0
 Identities = 31/139 (22%), Positives = 63/139 (45%), Frame = -2

Query:   418 DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESS 239
             +I+++N++  + G      + +  NN +F  G     I+ +   N   +Q + ++++  +
Sbjct:    12 NIEDMNRSLELNGK-----MIYSGNN-SFEHGTISVIINKDKMKNFHVNQKQNKFKKMIN 65

Query:   238 GFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
               NN    N  +   + +M  NN+ +N + G+ +    NN   N   NNN   S    NN
Sbjct:    66 RNNNNNFSNIRQG--NNNM--NNI-MNNYNGNNNNNSNNN---NNSSNNNH-MSNNNNNN 116

Query:    58 KTIFLEENNDERYNQENEK 2
               ++   NN+  +  +N K
Sbjct:   117 NNMYNHMNNNNPFFNDNNK 135


>gi|2425113 (AF019981) HelE [Dictyostelium discoideum]
            Length = 947

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 4.2e-06, P = 4.2e-06
 Identities = 47/182 (25%), Positives = 85/182 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-- 341
             +N  N   +    ++  NN N+N +N N +  +  N N NNN   S+  D+ + KNNN  
Sbjct:   235 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNDNNYNKNNNNI 294

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQ--NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             D+  E  +  N     YNN   D+  N + ++  ++  NN + +N   +   + + +N +
Sbjct:   295 DDLSEDPNTDN-DKEWYNNI-NDRIVNYQHFDVHNN--NNNKRNNNFNNNNFEILPNNKI 350

Query:   166 PINEWP---GDAHEKEL-------------NNIFVNKIKNNNDAQSYKGINNKTIFLEEN 35
             P N+W    G+ +E E              +  F+ K +++N  +++   NN       N
Sbjct:   351 P-NKWLLYIGEFNECEFYLLDYQDVNVRSGDKFFIRKNEDSNILEAFTMNNNNN----NN 405

Query:    34 NDERYNQENEK 2
             N+   N  N K
Sbjct:   406 NNNNNNNNNRK 416

 Score = 121 (42.6 bits), Expect = 5.6e-05, P = 5.6e-05
 Identities = 41/159 (25%), Positives = 72/159 (45%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             S++NN N+N +N N +  +  N N NNN   ++  ++    NNN+N     +  N ++N 
Sbjct:   231 SSQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNDN-NYNK 289

Query:   292 YNNTPTDQNKK-EYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
              NN   D ++    + +   +NNI          D H ++NN   N +  +  E   NN 
Sbjct:   290 NNNNIDDLSEDPNTDNDKEWYNNINDRIVNYQHFDVHNNNNNKRNNNFNNNNFEILPNNK 349

Query:   115 FVNK----IKNNNDAQ----SYKGINNKT---IFLEENND 29
               NK    I   N+ +     Y+ +N ++    F+ +N D
Sbjct:   350 IPNKWLLYIGEFNECEFYLLDYQDVNVRSGDKFFIRKNED 389

 Score = 111 (39.1 bits), Expect = 0.0025, P = 0.0025
 Identities = 38/148 (25%), Positives = 67/148 (45%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             S++NN N+N +N N +  +  N N NNN             NNN+N     +  N ++N 
Sbjct:   231 SSQNNNNNNNNNNNNNNNNNNNNNNNNN-------------NNNNN---NNNNNNNNNNN 274

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIF 113
              NN  ++ N   Y + ++  +++  D    +  + + + N+  +N    D H    NN  
Sbjct:   275 NNNNNSNNNDNNYNKNNNNIDDLSEDPNTDNDKEWYNNINDRIVNYQHFDVHNNN-NNKR 333

Query:   112 VNKIKNNN-DAQSYKGINNK-TIFLEENND 29
              N   NNN +      I NK  +++ E N+
Sbjct:   334 NNNFNNNNFEILPNNKIPNKWLLYIGEFNE 363

 Score = 104 (36.6 bits), Expect = 2.6e-06, Sum P(2) = 2.6e-06
 Identities = 30/116 (25%), Positives = 55/116 (47%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             +NNN+N     +  N ++N  NN   + N       ++  NN  ++N+  +  + + ++N
Sbjct:   233 QNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNDNNYNKNNN 292

Query:   172 NVP-INEWPGDAHEKE-LNNI---FVN----KIKNNNDAQSYKGINNKTIFLEENN 32
             N+  ++E P   ++KE  NNI    VN     + NNN+ +     NN    +  NN
Sbjct:   293 NIDDLSEDPNTDNDKEWYNNINDRIVNYQHFDVHNNNNNKRNNNFNNNNFEILPNN 348

 Score = 82 (28.9 bits), Expect = 9.5, P = 1.0
 Identities = 35/162 (21%), Positives = 60/162 (37%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             +D+ P   ++N R     +K+  + D    N+ N I+           +   +       
Sbjct:   136 IDDIPFVDSENCRITIDFSKDEREDDYYEDNEINRIIKRQTTST----STTTSISTTSTP 191

Query:   313 QNIHHNVYNNTPT-DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
             Q    N  N++P+  Q  K    + +     Q      SP  ++ ++NN   N    + +
Sbjct:   192 QKQQQNTPNHSPSPSQRSKTTRLQQTPLTTPQ-TTPQTSPSSQNNNNNNNNNNNNNNNNN 250

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                 NN   N   NNN+  +    NN       NND  YN+ N
Sbjct:   251 NNNNNNNNNNNNNNNNNNNNNNNNNNNNN--SNNNDNNYNKNN 291

 Score = 75 (26.4 bits), Expect = 2.6e-06, Sum P(2) = 2.6e-06
 Identities = 17/59 (28%), Positives = 31/59 (52%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +  N  ++    ++T NN N+  +NKN +K   +N N+NNN    D+     F+ + D+
Sbjct:    60 SNNNNILNNNNTNNTNNNNNNKNNNKNNNKN--KNKNKNNNKNNFDEDSSFEFEEDFDH 116

 Score = 68 (23.9 bits), Expect = 1.4e-05, Sum P(2) = 1.4e-05
 Identities = 15/46 (32%), Positives = 27/46 (58%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             ++  NN N+N +NKN +K + +N N+N N   ++  +D  F+   D
Sbjct:    68 NNNTNNTNNNNNNKNNNKNNNKNKNKNKNNNKNNFDEDSSFEFEED 113

 Score = 64 (22.5 bits), Expect = 3.5e-05, Sum P(2) = 3.5e-05
 Identities = 14/51 (27%), Positives = 27/51 (52%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             +N N+ ++N N +  +  N N+NNN   +++  +    NN +NF E    +
Sbjct:    60 SNNNNILNNNNTNNTNNNNNNKNNN-KNNNKNKNKNKNNNKNNFDEDSSFE 109

 Score = 53 (18.7 bits), Expect = 2.2, Sum P(2) = 0.89
 Identities = 25/123 (20%), Positives = 42/123 (34%), Frame = -2

Query:   376 DQXDDIFFKNNNDN-FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKS 200
             D+ +D ++++N  N   + Q          + T T Q +++     S   + Q   T + 
Sbjct:   156 DEREDDYYEDNEINRIIKRQTTSTSTTTSISTTSTPQKQQQNTPNHSPSPS-QRSKTTRL 214

Query:   199 PVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERY 20
                        P    P   +    NN   N   NNN+  +    NN       NN+   
Sbjct:   215 QQTPLTTPQTTPQTS-PSSQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 273

Query:    19 NQEN 8
             N  N
Sbjct:   274 NNNN 277

 Score = 51 (18.0 bits), Expect = 3.5, Sum P(2) = 0.97
 Identities = 15/48 (31%), Positives = 21/48 (43%), Frame = -2

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDK 188
             G G DI     ++ NN   D N    E+  S   N   DN ++  +DK
Sbjct:   518 GSG-DINFGFASINNNESLDSNNNNNEDNESYIRN-DCDNLVRKKLDK 563


>pir||A42239 adenylate cyclase (EC 4.6.1.1) germination stage - slime mold
            (Dictyostelium discoideum)
            Length = 858

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 3.7e-06, P = 3.7e-06
 Identities = 42/143 (29%), Positives = 67/143 (46%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             E I    NN N+NI++ N++     N+N NNN +  +  D++    NN+NF +   I+N 
Sbjct:   732 EAIKILNNNNNNNINDNNINNT---NLNNNNNDININNSDNVNNYENNNNFSD--KIEN- 785

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
              ++  NN   D N K   E     NNI+     K   D     N++ + +   D ++   
Sbjct:   786 -NDGDNNNINDNNYKSTNE-----NNIKSKTLFK---DSKSLINDIKMAKENCDNNDDNN 836

Query:   124 NNIFVNKIKNNNDAQSYKGINNK 56
             NN   N   NNND ++ +   NK
Sbjct:   837 NNNNNNNNNNNND-ENVESKKNK 858

 Score = 123 (43.3 bits), Expect = 1.8e-05, P = 1.8e-05
 Identities = 48/169 (28%), Positives = 80/169 (47%), Frame = -2

Query:   514 SNKGNTYVD-EEPIDSTKNNRNDNI--SNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN 344
             SN G  Y D  + I   +N +N+ +  + + + KK I+NI ++ ++  +D  + I   NN
Sbjct:   684 SNVG--YHDTSKDIKEDENEQNETLLFNQEQLKKKQIENIQRDLSL--NDSIEAIKILNN 739

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYE-EESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             N+N        NI+ N  NNT  + N  +     S   NN +++N     ++ + D +N 
Sbjct:   740 NNN-------NNINDNNINNTNLNNNNNDININNSDNVNNYENNNNFSDKIENN-DGDNN 791

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEEN---NDERYNQEN 8
              IN    D + K  N    N IK+    +  K + N     +EN   ND+  N  N
Sbjct:   792 NIN----DNNYKSTNE---NNIKSKTLFKDSKSLINDIKMAKENCDNNDDNNNNNN 840

 Score = 111 (39.1 bits), Expect = 0.0022, P = 0.0022
 Identities = 32/106 (30%), Positives = 54/106 (50%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN-NDNFGEGQ-DIQ 311
             E I    NN N+NI++ N++  ++ N N + NI  SD  ++    NN +D       D  
Sbjct:   732 EAIKILNNNNNNNINDNNINNTNLNNNNNDININNSDNVNNYENNNNFSDKIENNDGDNN 791

Query:   310 NIHHNVYNNTPTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NI+ N Y +T  +  K +  +++  S  N+I+     K   D + D+NN
Sbjct:   792 NINDNNYKSTNENNIKSKTLFKDSKSLINDIK---MAKENCDNNDDNNN 837

 Score = 106 (37.3 bits), Expect = 0.010, P = 0.010
 Identities = 44/155 (28%), Positives = 68/155 (43%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             +N + D   N ++    I N N NNNI   +  ++    NNN++     +I N   NV N
Sbjct:   719 ENIQRDLSLNDSIEAIKILNNNNNNNI-NDNNINNTNLNNNNNDI----NINN-SDNV-N 771

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N   + N  +  E + G NN  +DN  KS      + NN+       D+ +  +N+I + 
Sbjct:   772 NYENNNNFSDKIENNDGDNNNINDNNYKST-----NENNIKSKTLFKDS-KSLINDIKMA 825

Query:   106 KIK-NNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             K   +NND  +    NN       NNDE    +  K
Sbjct:   826 KENCDNNDDNNNNNNNNNN---NNNNDENVESKKNK 858

 Score = 97 (34.1 bits), Expect = 0.14, P = 0.13
 Identities = 38/135 (28%), Positives = 72/135 (53%), Frame = -2

Query:   409 NINQNNNIVGSDQXDDIFFKNNNDNFGE-GQDIQNIHHNVYNNTPTDQNKKEYEEESSGF 233
             ++N N+ I GS+  DD F  ++N  + +  +DI+    N  N T    N+++ +++    
Sbjct:   663 SLNSNDLIDGSEYHDDPFPSDSNVGYHDTSKDIKE-DENEQNETLLF-NQEQLKKKQ--I 718

Query:   232 NNIQHDNTMKSPVD--KHMDHNNVP-INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGIN 62
              NIQ D ++   ++  K +++NN   IN+   +      NN  +N I N+++  +Y+  N
Sbjct:   719 ENIQRDLSLNDSIEAIKILNNNNNNNINDNNINNTNLNNNNNDIN-INNSDNVNNYENNN 777

Query:    61 NKTIFLEENNDERYNQENE 5
             N +  +E NND   N  N+
Sbjct:   778 NFSDKIE-NNDGDNNNIND 795

 Score = 84 (29.6 bits), Expect = 5.0, P = 0.99
 Identities = 34/134 (25%), Positives = 67/134 (50%), Frame = -2

Query:   409 NINQNNNIVGSDQXDDIFFKNNNDNFGE-GQDIQNIHHNVYNNTPTDQNKKEYEEESSGF 233
             ++N N+ I GS+  DD F  ++N  + +  +DI+    N  N T    N+++ +++    
Sbjct:   663 SLNSNDLIDGSEYHDDPFPSDSNVGYHDTSKDIKE-DENEQNETLLF-NQEQLKKKQ--I 718

Query:   232 NNIQHDNTMKSPVD--KHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
              NIQ D ++   ++  K +++NN   N    + ++  +NN  +N   N+ +  +   +NN
Sbjct:   719 ENIQRDLSLNDSIEAIKILNNNN---NN---NINDNNINNTNLNNNNNDININNSDNVNN 772

Query:    58 KTIFLEENNDERYNQEN 8
                  E NN+     EN
Sbjct:   773 ----YENNNNFSDKIEN 785

 Score = 82 (28.9 bits), Expect = 8.4, P = 1.0
 Identities = 37/153 (24%), Positives = 69/153 (45%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN----FGEGQDIQNIHHNV 293
             N ND I     H     +   ++N+   D   DI    N  N    F + Q  +    N+
Sbjct:   665 NSNDLIDGSEYHDDPFPS---DSNVGYHDTSKDIKEDENEQNETLLFNQEQLKKKQIENI 721

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIF 113
               +   + + +  +  ++  NN  +DN + +  + + ++N++ IN    + +  E NN F
Sbjct:   722 QRDLSLNDSIEAIKILNNNNNNNINDNNINN-TNLNNNNNDININN-SDNVNNYENNNNF 779

Query:   112 VNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              +KI+NN+      G NN    + +NN +  N+ N K
Sbjct:   780 SDKIENND------GDNNN---INDNNYKSTNENNIK 807


>sp|P18160|KYK1_DICDI NON-RECEPTOR TYROSINE KINASE SPORE LYSIS A
            (TYROSINE-PROTEIN KINASE 1) >gi|974334 (U32174) non-receptor
            tyrosine kinase [Dictyostelium discoideum]
            Length = 1584

  Minus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 6.0e-06, P = 6.0e-06
 Identities = 34/148 (22%), Positives = 68/148 (45%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N++IS+ N +  +  N N NNN   ++  ++    NNN++     +  NI++   NN 
Sbjct:   441 NNNEDISSNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNSNSSNTNNNNINNTTNNNN 497

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP--GDAHEKELNNIFVN 107
                 N       +S  N+  ++N + +  + + ++NN+ + + P  G   E    ++  N
Sbjct:   498 SNSNNNNNNNNSNSNSNS--NNNNINNNNNNNNNNNNIYLTKKPSIGSTDESSTGSLGGN 555

Query:   106 KIKNNNDAQSYKGINNKTIFLEENNDERYN 17
                 NN++ S    NN +I  + +     N
Sbjct:   556 NSSGNNNSSSGSIGNNSSIIKQRSPPHSIN 585

 Score = 114 (40.1 bits), Expect = 0.0017, P = 0.0017
 Identities = 37/140 (26%), Positives = 61/140 (43%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQ---NIHHN 296
             N  N+N SN N       N N NNNI+G+ +       + +  +    +DI    N ++N
Sbjct:   403 NGNNNNNSNNN-------NNNNNNNIIGNGKITTTTTTSTSPSSINNNEDISSNNNNNNN 455

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
               NN   + N       ++  NN    NT  + ++   ++NN   N    + +    +N 
Sbjct:   456 NNNNNNNNNNNNNNNNNNNNNNNSNSSNTNNNNINNTTNNNNSNSNNNNNNNNSNSNSNS 515

Query:   115 FVNKIKNNNDAQSYKGINNKTIFL 44
               N I NNN+  +    NN  I+L
Sbjct:   516 NNNNINNNNNNNN----NNNNIYL 535

 Score = 103 (36.3 bits), Expect = 0.050, P = 0.049
 Identities = 32/129 (24%), Positives = 54/129 (41%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGS-DQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ++  NN N+N +N  +    I      +    S +  +DI   NNN+N     +  N ++
Sbjct:   407 NNNSNNNNNNNNNNIIGNGKITTTTTTSTSPSSINNNEDISSNNNNNN----NNNNNNNN 462

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             N  NN   + N       SS  NN   +NT  +      ++NN   +    +++   +NN
Sbjct:   463 NNNNNNNNNNNNNNNNSNSSNTNNNNINNTTNNNNSNSNNNNNNNNSNSNSNSNNNNINN 522

Query:   118 IFVNKIKNNN 89
                N   NNN
Sbjct:   523 NNNNNNNNNN 532

 Score = 103 (36.3 bits), Expect = 0.050, P = 0.049
 Identities = 35/145 (24%), Positives = 62/145 (42%), Frame = -2

Query:   442 SNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQN 266
             +  N +  +  N N NNNI+G+ +       + +  +    +DI + ++N  NN   + N
Sbjct:   403 NGNNNNNSNNNNNNNNNNIIGNGKITTTTTTSTSPSSINNNEDISSNNNN--NNNNNNNN 460

Query:   265 KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNND 86
                    ++  NN  ++N+  S    + ++NN  IN    + +    NN       NNN+
Sbjct:   461 NNNNNNNNNNNNNNNNNNSNSS----NTNNNN--INNTTNNNNSNSNNN------NNNNN 508

Query:    85 AQSYKGINNKTIFLEENNDERYNQEN 8
             + S    NN  I    NN+   N  N
Sbjct:   509 SNSNSNSNNNNI--NNNNNNNNNNNN 532

 Score = 102 (35.9 bits), Expect = 0.066, P = 0.064
 Identities = 27/115 (23%), Positives = 49/115 (42%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  N   +    ++  NN N+N +N N +  +  N N NNNI  +   ++    NNN+N
Sbjct:   448 SNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSSNTN-NNNINNTTNNNNSNSNNNNNN 506

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKE-YEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
                  +  + ++N+ NN   + N    Y  +     +    +T     +    +NN
Sbjct:   507 NNSNSNSNSNNNNINNNNNNNNNNNNIYLTKKPSIGSTDESSTGSLGGNNSSGNNN 562

 Score = 101 (35.6 bits), Expect = 0.090, P = 0.086
 Identities = 26/95 (27%), Positives = 42/95 (44%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             + E I S  NN N+N +N N +  +  N N NNN   S+  +     NNN N     +  
Sbjct:   442 NNEDISSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSSNT---NNNNINNTTNNNNS 498

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM 206
             N ++N  NN     +       ++  NN  ++N +
Sbjct:   499 NSNNNNNNNNSNSNSNSNNNNINNNNNNNNNNNNI 533

 Score = 101 (35.6 bits), Expect = 0.090, P = 0.086
 Identities = 37/143 (25%), Positives = 62/143 (43%), Frame = -2

Query:   436 KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKE 257
             KNV+   I   N NNN   ++  ++    NNN+  G G+          + +P+  N  E
Sbjct:   392 KNVNSTSILVPNGNNNNNSNNNNNN----NNNNIIGNGKITTT---TTTSTSPSSINNNE 444

Query:   256 YEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQS 77
               + SS  NN  ++N   +  + + ++NN   N    +++    NN  +N   NNN++ S
Sbjct:   445 --DISSNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNSNSSNTNNNNINNTTNNNNSNS 500

Query:    76 YKGINNKTIFLEEN-NDERYNQEN 8
                 NN       N N+   N  N
Sbjct:   501 NNNNNNNNSNSNSNSNNNNINNNN 524

 Score = 98 (34.5 bits), Expect = 0.21, P = 0.19
 Identities = 36/154 (23%), Positives = 64/154 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDD----IFFKN 347
             +N  N   +    ++  NN N+N ++ N +  +I N   NNN   ++  ++        +
Sbjct:   456 NNNNNNNNNNNNNNNNNNNNNNNSNSSNTNNNNINNTTNNNNSNSNNNNNNNNSNSNSNS 515

Query:   346 NNDNFGEGQDIQNIHHNVY-NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NN+N     +  N ++N+Y    P+  +  E    S G NN   +N   S        NN
Sbjct:   516 NNNNINNNNNNNNNNNNIYLTKKPSIGSTDESSTGSLGGNNSSGNNNSSSG----SIGNN 571

Query:   169 VPINEWPGDAHEKELNN-IFVNKIKNNNDAQSYKGINNKT 53
               I +     H   +N  + +     NN+   Y   N+ T
Sbjct:   572 SSIIKQRSPPHS--INGPLMLPPSSTNNNNNIYSSYNSTT 609


>gi|1526991 (U41289) K7 kinesin-like protein [Dictyostelium discoideum]
            Length = 1254

  Minus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 7.5e-06, P = 7.5e-06
 Identities = 40/170 (23%), Positives = 79/170 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N+       + ++   +  + N S  N  K +I+N  +N+ I+  D  D I   NNN+N
Sbjct:   402 NNQKMVVESNQKLELLNSQISSNHSFDNTFK-EIENTCENSKIIFDDLNDHI---NNNNN 457

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
               E  +  N  +N  NN   + N  +Y+EES   N  Q +N  K     +   +++ + +
Sbjct:   458 VDENNNTNNNDNN--NND--NNNNNQYQEES---NQYQQENNQKDGDQNNSSFDSIKVED 510

Query:   154 WPGDAHEKELNNIFVNK----IKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
                   E ++ +I +N     I +++D       NN  +  ++NN+   N +++
Sbjct:   511 LRDLDDEPDIEDIILNSTLGNISDDDDDDDDHHSNNNNV--DDNNNGEINNDSD 562

 Score = 108 (38.0 bits), Expect = 0.0087, P = 0.0087
 Identities = 42/162 (25%), Positives = 72/162 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             D+T     +   N  +   D+ + IN NNN+   D+ ++    NNNDN     +  N + 
Sbjct:   428 DNTFKEIENTCENSKIIFDDLNDHINNNNNV---DENNNT---NNNDNNNNDNNNNNQYQ 481

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPG--------- 146
                N    + N+K+ ++ +S F++I+ ++     +D   D  ++ +N   G         
Sbjct:   482 EESNQYQQENNQKDGDQNNSSFDSIKVEDLRD--LDDEPDIEDIILNSTLGNISDDDDDD 539

Query:   145 DAHEKELNNIFVNKIKN-NNDAQSYKGINNKTIFLEEN---NDERYNQEN 8
             D H    NN+  N     NND+  Y   + K I + E    ND   N  N
Sbjct:   540 DDHHSNNNNVDDNNNGEINNDSDGYLNRSLKDIKIPEISDLNDHNINNNN 589

 Score = 106 (37.3 bits), Expect = 0.016, P = 0.016
 Identities = 37/150 (24%), Positives = 68/150 (45%), Frame = -2

Query:   502 NTYVDEEP-IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             N  VDE    ++  NN NDN +N N ++++     Q NN    DQ +  F     ++  +
Sbjct:   455 NNNVDENNNTNNNDNNNNDN-NNNNQYQEESNQYQQENNQKDGDQNNSSFDSIKVEDLRD 513

Query:   325 GQDIQNIHHNVYNNT--PTDQNKKEYEEESSGFNNIQHDNT--MKSPVDKHMDHN--NVP 164
               D  +I   + N+T      +  + ++  S  NN+  +N   + +  D +++ +  ++ 
Sbjct:   514 LDDEPDIEDIILNSTLGNISDDDDDDDDHHSNNNNVDDNNNGEINNDSDGYLNRSLKDIK 573

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKG 68
             I E   D ++  +NN   N    NND  S  G
Sbjct:   574 IPEI-SDLNDHNINNNNNNNNNINNDNNSNSG 604

 Score = 101 (35.6 bits), Expect = 0.070, P = 0.067
 Identities = 44/165 (26%), Positives = 74/165 (44%), Frame = -2

Query:   502 NTYVDEEP-IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             N  VDE    ++  NN NDN +N N ++++     Q NN    DQ +  F     ++  +
Sbjct:   455 NNNVDENNNTNNNDNNNNDN-NNNNQYQEESNQYQQENNQKDGDQNNSSFDSIKVEDLRD 513

Query:   325 GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPG 146
               D  +I   + N+T  + +  + +++    NN   +N     VD   D+NN  IN    
Sbjct:   514 LDDEPDIEDIILNSTLGNISDDDDDDDDHHSNN---NN-----VD---DNNNGEINN-DS 561

Query:   145 DAH-EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             D +  + L +I + +I + ND      INN       NN+   N +N
Sbjct:   562 DGYLNRSLKDIKIPEISDLND----HNINNNN-----NNNNNINNDN 599

 Score = 98 (34.5 bits), Expect = 0.16, P = 0.15
 Identities = 41/165 (24%), Positives = 73/165 (44%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N  VDE    +  +N N++ +N N ++++     Q NN    DQ +  F     ++  + 
Sbjct:   455 NNNVDENNNTNNNDNNNNDNNNNNQYQEESNQYQQENNQKDGDQNNSSFDSIKVEDLRDL 514

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
              D  +I   + N+T  + +  + +++    NN   +N     VD   D+NN  IN    D
Sbjct:   515 DDEPDIEDIILNSTLGNISDDDDDDDDHHSNN---NN-----VD---DNNNGEINN-DSD 562

Query:   142 AH-EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              +  + L +I + +I + ND      INN       NN+   N +N
Sbjct:   563 GYLNRSLKDIKIPEISDLND----HNINNNN-----NNNNNINNDN 599

 Score = 96 (33.8 bits), Expect = 0.28, P = 0.24
 Identities = 29/134 (21%), Positives = 60/134 (44%), Frame = -2

Query:   403 NQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ--NIHHNVYNNTPTDQNKKEYEEESSGFN 230
             N    I  + +   I F + ND+     ++   N  +N  NN   + N  +Y+EES   N
Sbjct:   429 NTFKEIENTCENSKIIFDDLNDHINNNNNVDENNNTNNNDNNNNDNNNNNQYQEES---N 485

Query:   229 NIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNK----IKNNNDAQSYKGIN 62
               Q +N  K     +   +++ + +      E ++ +I +N     I +++D       N
Sbjct:   486 QYQQENNQKDGDQNNSSFDSIKVEDLRDLDDEPDIEDIILNSTLGNISDDDDDDDDHHSN 545

Query:    61 NKTIFLEENNDERYNQENE 5
             N  +  ++NN+   N +++
Sbjct:   546 NNNV--DDNNNGEINNDSD 562

 Score = 96 (33.8 bits), Expect = 0.28, P = 0.24
 Identities = 39/157 (24%), Positives = 63/157 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N Y +E      +NN+ D   N +    D   +    ++      +DI   +   N
Sbjct:   474 NNNNNQYQEESNQYQQENNQKDGDQNNSSF--DSIKVEDLRDLDDEPDIEDIILNSTLGN 531

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSP-VDKHMDHNNVPIN 158
               +  D  + HH+  NN   D N  E   +S G+ N +    +K P +    DHN   IN
Sbjct:   532 ISDDDDDDDDHHS-NNNNVDDNNNGEINNDSDGYLN-RSLKDIKIPEISDLNDHN---IN 586

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFL 44
                        NN   N I N+N++ S  G+   T ++
Sbjct:   587 N----------NNNNNNNINNDNNSNS-GGLRVSTSYI 613

 Score = 86 (30.3 bits), Expect = 4.4, P = 0.99
 Identities = 37/165 (22%), Positives = 71/165 (43%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N+ +  + ++   NN N+   N N +  D  N + NNN    ++ +  + + NN   G+ 
Sbjct:   440 NSKIIFDDLNDHINNNNNVDENNNTNNNDNNNNDNNNNNQYQEESNQ-YQQENNQKDGDQ 498

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEE--SSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
              +       V +    D ++ + E+   +S   NI  D+      D H ++NNV      
Sbjct:   499 NNSSFDSIKVEDLRDLD-DEPDIEDIILNSTLGNISDDDDDDD--DHHSNNNNVD----- 550

Query:   148 GDAHEKELNNI---FVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              D +  E+NN    ++N+   +        +N+  I    NN+   N +N
Sbjct:   551 -DNNNGEINNDSDGYLNRSLKDIKIPEISDLNDHNINNNNNNNNNINNDN 599

 Score = 85 (29.9 bits), Expect = 5.8, P = 1.0
 Identities = 37/159 (23%), Positives = 70/159 (44%), Frame = -2

Query:   493 VDEEP------IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-N 335
             +D+EP      ++ST  N +D+  + + H  +  N++ NNN   ++  D    ++  D  
Sbjct:   514 LDDEPDIEDIILNSTLGNISDDDDDDDDHHSNNNNVDDNNNGEINNDSDGYLNRSLKDIK 573

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSP---VDKHMDHNNVP 164
               E  D+ +  HN+ NN   + N       +SG   +       SP   + ++  H+N P
Sbjct:   574 IPEISDLND--HNINNNNNNNNNINNDNNSNSGGLRVSTSYITSSPNLSIKEYGCHHNSP 631

Query:   163 -------INEWPGDAHEKELNNIFVNKI--KNNNDAQSYKGINN 59
                      ++P  + E   N+ F N +  K  N+ Q  +  +N
Sbjct:   632 PLFSYFKTKDFPPSSDE---NDKFFNDLIAKGENEQQQQQQQHN 672

 Score = 84 (29.6 bits), Expect = 7.7, P = 1.0
 Identities = 29/106 (27%), Positives = 50/106 (47%), Frame = -2

Query:   319 DIQNIHHNVYNNTP--TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPG 146
             +I N+   + NN     + N+K     S   +N   DNT K  ++   +++ +  ++   
Sbjct:   392 EINNLLIQLENNQKMVVESNQKLELLNSQISSNHSFDNTFKE-IENTCENSKIIFDDL-- 448

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             + H    NN+  N   NNND  +    NN   + EE+N  +Y QEN +
Sbjct:   449 NDHINNNNNVDENNNTNNNDNNNNDN-NNNNQYQEESN--QYQQENNQ 493


>pir||C44863 R45 antigen - Plasmodium falciparum (fragment)
            Length = 144

  Minus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 9.0e-06, P = 9.0e-06
 Identities = 35/136 (25%), Positives = 66/136 (48%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             K++ N   S+ N HK D  +++ +N++   +   D   K++N++  +     + +H   +
Sbjct:     1 KSDSNHK-SDHN-HKSDSNHMSDHNHMSDHNHKSDHNHKSDNNHKSDSNHKSDSNHKSDS 58

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N  +D N K   +  S  NN + DN  KS  +   DHN+   N    D + K  +N   +
Sbjct:    59 NHKSDHNHKSDHKHMSD-NNHKSDNNHKSDNNHKSDHNHKSDNNHKSDHNHKSDSN---H 114

Query:   106 KIKNNNDAQS-YKGINN 59
             K  +N+ + S +K  +N
Sbjct:   115 KSDSNHKSDSNHKSDSN 131

 Score = 100 (35.2 bits), Expect = 0.00066, P = 0.00066
 Identities = 37/153 (24%), Positives = 70/153 (45%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             K++ N   S+ N HK D  +++ +N++   +   D   K++N++  +     + +H   +
Sbjct:     1 KSDSNHK-SDHN-HKSDSNHMSDHNHMSDHNHKSDHNHKSDNNHKSDSNHKSDSNHKSDS 58

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N  +D N K   +  S  NN + DN  KS  +   DHN+   N    D + K  +N   +
Sbjct:    59 NHKSDHNHKSDHKHMSD-NNHKSDNNHKSDNNHKSDHNHKSDNNHKSDHNHKSDSN---H 114

Query:   106 KIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             K  +N+ + S    N+K+       D  +  +N
Sbjct:   115 KSDSNHKSDS----NHKS-------DSNHKSDN 136

 Score = 97 (34.1 bits), Expect = 0.0023, P = 0.0023
 Identities = 32/129 (24%), Positives = 60/129 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             DS   + ++++S+ N HK D  + + NN+   S+   D   K+++++  +     +  H 
Sbjct:    15 DSNHMSDHNHMSDHN-HKSDHNHKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHM 73

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
               NN  +D N K      S  N+ + DN  KS  +   D N+   +    D++ K  +N 
Sbjct:    74 SDNNHKSDNNHKSDNNHKSDHNH-KSDNNHKSDHNHKSDSNHKSDSNHKSDSNHKSDSN- 131

Query:   115 FVNKIKNNN 89
               +K  NN+
Sbjct:   132 --HKSDNNH 138

 Score = 95 (33.4 bits), Expect = 0.0050, P = 0.0050
 Identities = 33/133 (24%), Positives = 64/133 (48%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             DS   + ++++S+ N HK D  + + NN+   S+   D   K+++++  +     +  H 
Sbjct:    15 DSNHMSDHNHMSDHN-HKSDHNHKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHM 73

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA-HEKELNN 119
               NN  +D N K      S  N+ + DN  KS      DHN+   +    D+ H+ + N+
Sbjct:    74 SDNNHKSDNNHKSDNNHKSDHNH-KSDNNHKS------DHNHKSDSNHKSDSNHKSDSNH 126

Query:   118 IFVNKIKNNNDAQS 77
                +  K++N+ +S
Sbjct:   127 KSDSNHKSDNNHKS 140

 Score = 93 (32.7 bits), Expect = 0.0097, P = 0.0097
 Identities = 28/118 (23%), Positives = 53/118 (44%), Frame = -2

Query:   472 STKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             S  N+++D N  + N HK D  + + +N+   S+   D   K+++ +  +     + +H 
Sbjct:    26 SDHNHKSDHNHKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHK 85

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
               NN  +D N K      S  N+ + D+  KS  +   D N+   +    D + K  +N
Sbjct:    86 SDNNHKSDHNHKSDNNHKSDHNH-KSDSNHKSDSNHKSDSNHKSDSNHKSDNNHKSDHN 143


>pir||S14508 asparagine-rich protein (clone 52C11) - Plasmodium falciparum
            (fragment) >gi|9855 (X17489) Plasmodium falciparum mRNA for
            asparagine-rich antigen (clone 52C11) [Plasmodium falciparum]
            Length = 419

  Minus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 50/186 (26%), Positives = 84/186 (45%), Frame = -2

Query:   514 SNKGNTYVDE--EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD----DIFF 353
             SNK +T ++   E I+ T NN N+N +N N +  +  N N N N V  +  +    D + 
Sbjct:     8 SNKYDTCMNANMENINGTNNNNNNNNNNNNNNNNNNNNNNINRNNVSDNSTNIVDNDSYD 67

Query:   352 KNNNDNFGE--GQDIQNIHHNVYNNTPT----------DQNKKEYEEESSGFNNIQHDN- 212
             K NN + G     ++QN+ +N  N   T          D N  +    S+  NN  +++ 
Sbjct:    68 KTNNSSNGSMYKTNVQNMVNN-NNGAATLNKCDSLLNHDMNVSKLNYNSNNNNNSNNNSC 126

Query:   211 -TMKSPVDKHMDHNNVPINEWPGDAHE--KELNNIFVNKIKNNNDAQSYKGINNKTIFLE 41
                   +D H +  N  +N +  + +E   +LNN+  N   NNN+  S    +N +    
Sbjct:   127 GVAGGSMDSHYNTANSLMN-YNKNHYEDGNDLNNMDTNNNNNNNNNGSNSNNSNNSNSSN 185

Query:    40 ENNDERYN 17
              NN++  N
Sbjct:   186 NNNNKNKN 193

 Score = 114 (40.1 bits), Expect = 0.00031, P = 0.00031
 Identities = 47/168 (27%), Positives = 77/168 (45%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNN------NIVGSDQXDDIFFKNNNDNFGE--GQD 317
             +  NN N+N +N N +  +  NIN+NN      NIV +D  D    K NN + G     +
Sbjct:    26 NNNNNNNNNNNNNNNNNNNNNNINRNNVSDNSTNIVDNDSYD----KTNNSSNGSMYKTN 81

Query:   316 IQNIHHNVYNNTPT----------DQNKKEYEEESSGFNNIQHDN--TMKSPVDKHMDHN 173
             +QN+ +N  N   T          D N  +    S+  NN  +++       +D H +  
Sbjct:    82 VQNMVNN-NNGAATLNKCDSLLNHDMNVSKLNYNSNNNNNSNNNSCGVAGGSMDSHYNTA 140

Query:   172 NVPINEWPGDAHE--KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N  +N +  + +E   +LNN+  N   NNN+  S    +N +     NN++  N
Sbjct:   141 NSLMN-YNKNHYEDGNDLNNMDTNNNNNNNNNGSNSNNSNNSNSSNNNNNKNKN 193

 Score = 110 (38.7 bits), Expect = 0.0011, P = 0.0011
 Identities = 42/161 (26%), Positives = 77/161 (47%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE--GQDIQNIH 302
             ++  NN N+N +N N+++ ++ +   + NIV +D  D    K NN + G     ++QN+ 
Sbjct:    33 NNNNNNNNNNNNNNNINRNNVSD--NSTNIVDNDSYD----KTNNSSNGSMYKTNVQNMV 86

Query:   301 HNVYNNTPT----------DQNKKEYEEESSGFNNIQHDN--TMKSPVDKHMDHNNVPIN 158
             +N  N   T          D N  +    S+  NN  +++       +D H +  N  +N
Sbjct:    87 NN-NNGAATLNKCDSLLNHDMNVSKLNYNSNNNNNSNNNSCGVAGGSMDSHYNTANSLMN 145

Query:   157 EWPGDAHE--KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
              +  + +E   +LNN+  N   NNN+  S    +N +     NN++  N
Sbjct:   146 -YNKNHYEDGNDLNNMDTNNNNNNNNNGSNSNNSNNSNSSNNNNNKNKN 193

 Score = 108 (38.0 bits), Expect = 0.0021, P = 0.0021
 Identities = 51/183 (27%), Positives = 79/183 (43%), Frame = -2

Query:   514 SNKGNTYVDE--EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD----DIFF 353
             SNK +T ++   E I+ T NN N+N +N N +  +  N N N N V  +  +    D + 
Sbjct:     8 SNKYDTCMNANMENINGTNNNNNNNNNNNNNNNNNNNNNNINRNNVSDNSTNIVDNDSYD 67

Query:   352 KNNNDNFGE--GQDIQNIHHNVYNNTPTDQNKKE----YEEESSGFN-NIQHDNTMKSP- 197
             K NN + G     ++QN+ +N  NN     NK +    ++   S  N N  ++N   +  
Sbjct:    68 KTNNSSNGSMYKTNVQNMVNN--NNGAATLNKCDSLLNHDMNVSKLNYNSNNNNNSNNNS 125

Query:   196 ---VDKHMD-HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
                    MD H N   +    + +  E  N   N   NNN+  +  G N+       NN 
Sbjct:   126 CGVAGGSMDSHYNTANSLMNYNKNHYEDGNDLNNMDTNNNNNNNNNGSNSNN----SNNS 181

Query:    28 ERYNQENEK 2
                N  N K
Sbjct:   182 NSSNNNNNK 190

 Score = 106 (37.3 bits), Expect = 0.0040, P = 0.0040
 Identities = 50/172 (29%), Positives = 81/172 (47%), Frame = -2

Query:   514 SNKGNTYVDE--EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD----DIFF 353
             SNK +T ++   E I+ T NN N+N +N N +  +  N N N N V  +  +    D + 
Sbjct:     8 SNKYDTCMNANMENINGTNNNNNNNNNNNNNNNNNNNNNNINRNNVSDNSTNIVDNDSYD 67

Query:   352 KNNNDNFGE--GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             K NN + G     ++QN+ +N  NN     NK +        + + HD  + S ++ + +
Sbjct:    68 KTNNSSNGSMYKTNVQNMVNN--NNGAATLNKCD--------SLLNHDMNV-SKLNYNSN 116

Query:   178 HNNVPINEWPG------DAHEKELNNIF-VNK--IKNNNDAQSYKGINNKTIFLEENNDE 26
             +NN   N   G      D+H    N++   NK   ++ ND  +    NN       NN  
Sbjct:   117 NNNNSNNNSCGVAGGSMDSHYNTANSLMNYNKNHYEDGNDLNNMDTNNNNN---NNNNGS 173

Query:    25 RYNQEN 8
               N  N
Sbjct:   174 NSNNSN 179

 Score = 100 (35.2 bits), Expect = 0.023, P = 0.023
 Identities = 45/172 (26%), Positives = 74/172 (43%), Frame = -2

Query:   514 SNKGNTYVDE--EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD----DIFF 353
             SNK +T ++   E I+ T NN N+N +N N +  +  N N N N V  +  +    D + 
Sbjct:     8 SNKYDTCMNANMENINGTNNNNNNNNNNNNNNNNNNNNNNINRNNVSDNSTNIVDNDSYD 67

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             K NN + G      N+ + V NN       K  +   +   N+   N   S  + + ++N
Sbjct:    68 KTNNSSNGSMYKT-NVQNMVNNNNGAATLNK-CDSLLNHDMNVSKLN-YNSNNNNNSNNN 124

Query:   172 NVPINEWPGDAHEKELNNIF-VNK--IKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +  +     D+H    N++   NK   ++ ND  +    NN       NN    N  N
Sbjct:   125 SCGVAGGSMDSHYNTANSLMNYNKNHYEDGNDLNNMDTNNNNN---NNNNGSNSNNSN 179

 Score = 97 (34.1 bits), Expect = 0.055, P = 0.053
 Identities = 45/163 (27%), Positives = 76/163 (46%), Frame = -2

Query:   505 GNTYVDEEPIDSTKNNRN-DNISNKNVHKKDIQNINQNNNIVGSDQXDD-IFFKNNNDNF 332
             GN   + +  ++  NN N  N +N N       N N+N N++G D   D I +   ND  
Sbjct:   154 GNDLNNMDTNNNNNNNNNGSNSNNSNNSNSSNNNNNKNKNLMGRDSLQDKIMYNPMND-- 211

Query:   331 GEGQDIQNIHHNVY-NNTP--TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
                      ++ +Y +N P     N K Y   +  +N     N M +P +++ D+NN  +
Sbjct:   212 ---------YNCIYPSNNPYGIQNNDKGYMYPN--YNTAL--NIM-NP-NENGDNNNSMV 256

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSY-KGINNKTIFLE---ENNDERYN 17
                  D +    NN+++N   NNN+  +Y     N T  ++   +NN+  YN
Sbjct:   257 GASVMDNYNN--NNLYMNNNNNNNNNNNYLNNYMNPTDNMKNMSKNNNGSYN 306

 Score = 96 (33.8 bits), Expect = 0.072, P = 0.070
 Identities = 33/141 (23%), Positives = 68/141 (48%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             +D+   ++ +N SN +++K ++QN +N NN     ++ D +    N+D      ++  ++
Sbjct:    61 VDNDSYDKTNNSSNGSMYKTNVQNMVNNNNGAATLNKCDSLL---NHD-----MNVSKLN 112

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH--NNVPINEWPGDAHEKE 128
             +N  NN  ++ N        +G +   H NT  S ++ + +H  +   +N    D +   
Sbjct:   113 YNSNNNNNSNNNSCGV----AGGSMDSHYNTANSLMNYNKNHYEDGNDLNNM--DTNNNN 166

Query:   127 LNNIFVNKIKNNNDAQSYKGINNK 56
              NN   +   N+N++ S    NNK
Sbjct:   167 NNNNNGSNSNNSNNSNSSNNNNNK 190

 Score = 93 (32.7 bits), Expect = 0.17, P = 0.15
 Identities = 35/156 (22%), Positives = 67/156 (42%), Frame = -2

Query:   451 DNISNKNVHKKDIQNINQNNNIVGS--DQXDDIFFKNNNDNFGEGQDIQNIH--HNVYNN 284
             DN +N N++  +  N N NNN + +  +  D++   + N+N      +QN++      NN
Sbjct:   262 DNYNNNNLYMNNNNNNNNNNNYLNNYMNPTDNMKNMSKNNNGSYNTSLQNLNGLEGTTNN 321

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTM-KSPVDKHMDHNNVPI---NEWPGDAHEKELNNI 116
                 Q        S+  NN  ++ TM    +  +   N++     N    +++   +NN 
Sbjct:   322 AAVTQPANNLNNYSNLNNNNNNNLTMFNCDLASNPYKNDLTCSYNNNGTANSNYYYMNNG 381

Query:   115 FVNKIKNNNDAQSYK--GINNKTIFLEENNDERYNQ 14
             + N     N A       +NN+++    N ++ YNQ
Sbjct:   382 YDNSSYQYNLANGNMMYDMNNRSMDASNNQNDYYNQ 417

 Score = 89 (31.3 bits), Expect = 0.52, P = 0.40
 Identities = 37/153 (24%), Positives = 66/153 (43%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH-HNVY 290
             K+N+ D   N N+   +  N N NNN             NNN+N     +  NI+ +NV 
Sbjct:     7 KSNKYDTCMNANMENINGTNNNNNNN------------NNNNNNNNNNNNNNNINRNNVS 54

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN--VPINEWPGDA-HEKELNN 119
             +N+    +   Y++     NN  + +  K+ V   +++NN    +N+      H+  ++ 
Sbjct:    55 DNSTNIVDNDSYDKT----NNSSNGSMYKTNVQNMVNNNNGAATLNKCDSLLNHDMNVSK 110

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +  N   NNN   +  G+   ++      D  YN  N
Sbjct:   111 LNYNSNNNNNSNNNSCGVAGGSM------DSHYNTAN 141

 Score = 87 (30.6 bits), Expect = 0.90, P = 0.59
 Identities = 33/134 (24%), Positives = 60/134 (44%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH-HNVY 290
             K+N+ D   N N+   +  N N NNN             NNN+N     +  NI+ +NV 
Sbjct:     7 KSNKYDTCMNANMENINGTNNNNNNN------------NNNNNNNNNNNNNNNINRNNVS 54

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN--VPINEWPGDA-HEKELNN 119
             +N+    +   Y++     NN  + +  K+ V   +++NN    +N+      H+  ++ 
Sbjct:    55 DNSTNIVDNDSYDKT----NNSSNGSMYKTNVQNMVNNNNGAATLNKCDSLLNHDMNVSK 110

Query:   118 IFVNKIKNNNDAQSYKGI 65
             +  N   NNN   +  G+
Sbjct:   111 LNYNSNNNNNSNNNSCGV 128

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.69
 Identities = 37/137 (27%), Positives = 63/137 (45%), Frame = -2

Query:   496 YVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQN----NNIVGSDQXDDIFFKNNNDNFG 329
             Y    P     N++     N N    +I N N+N    N++VG+   D+    NNN+ + 
Sbjct:   216 YPSNNPYGIQNNDKGYMYPNYNT-ALNIMNPNENGDNNNSMVGASVMDNY---NNNNLYM 271

Query:   328 EGQDIQNIHHNVYNN--TPTDQNKKEYEEESSGFN-NIQHDNTMKSPVDKHMDHNNVPIN 158
                +  N ++N  NN   PTD  K   +  +  +N ++Q+ N ++         NN  + 
Sbjct:   272 NNNNNNNNNNNYLNNYMNPTDNMKNMSKNNNGSYNTSLQNLNGLEGTT------NNAAVT 325

Query:   157 EWPGDAHEKELNNIFVNKIKNNND 86
             + P +     LNN + N   NNN+
Sbjct:   326 Q-PAN----NLNN-YSNLNNNNNN 343

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.69
 Identities = 44/149 (29%), Positives = 66/149 (44%), Frame = -2

Query:   505 GNTYVDEEPIDSTKNNRN-DNISNKNVHKKDIQNINQNNNIVGSDQXDD-IFFKNNND-N 335
             GN   + +  ++  NN N  N +N N       N N+N N++G D   D I +   ND N
Sbjct:   154 GNDLNNMDTNNNNNNNNNGSNSNNSNNSNSSNNNNNKNKNLMGRDSLQDKIMYNPMNDYN 213

Query:   334 F----GEGQDIQNIHHN-VYNNTPTDQNKKEYEEESSGFNNIQHDNTM--KSPVDKHMDH 176
                       IQN     +Y N  T  N     E  +G NN    N+M   S +D + ++
Sbjct:   214 CIYPSNNPYGIQNNDKGYMYPNYNTALNIMNPNE--NGDNN----NSMVGASVMDNY-NN 266

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
             NN+ +N    + +    NN ++N   N  D       NN
Sbjct:   267 NNLYMN----NNNNNNNNNNYLNNYMNPTDNMKNMSKNN 301

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.69
 Identities = 46/167 (27%), Positives = 73/167 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIF-----FKN 347
             N  N        DS  N+ + N+S  N +  +  N N N+  V     D  +       N
Sbjct:    87 NNNNGAATLNKCDSLLNH-DMNVSKLNYNSNNNNNSNNNSCGVAGGSMDSHYNTANSLMN 145

Query:   346 NNDN-FGEGQDIQNI---HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM--KSPVDKH 185
              N N + +G D+ N+   ++N  NN  ++ N       SS  NN ++ N M   S  DK 
Sbjct:   146 YNKNHYEDGNDLNNMDTNNNNNNNNNGSNSNNSN-NSNSSNNNNNKNKNLMGRDSLQDKI 204

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEEN-NDERYN 17
             M +N  P+N++    +    NN +   I+NN+    Y   N     +  N N +  N
Sbjct:   205 M-YN--PMNDY-NCIYPS--NNPY--GIQNNDKGYMYPNYNTALNIMNPNENGDNNN 253

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.69
 Identities = 52/185 (28%), Positives = 75/185 (40%), Frame = -2

Query:   505 GNTYVDEEPIDSTKNNRN-DNISNKNVHKKDIQNINQNNNIVGSDQXDD-IFFKNNND-N 335
             GN   + +  ++  NN N  N +N N       N N+N N++G D   D I +   ND N
Sbjct:   154 GNDLNNMDTNNNNNNNNNGSNSNNSNNSNSSNNNNNKNKNLMGRDSLQDKIMYNPMNDYN 213

Query:   334 F----GEGQDIQNIHHN-VYNNTPTDQNKKEYEEESSGFNNIQHDNTM--KSPVDKHMDH 176
                       IQN     +Y N  T  N     E  +G NN    N+M   S +D + ++
Sbjct:   214 CIYPSNNPYGIQNNDKGYMYPNYNTALNIMNPNE--NGDNN----NSMVGASVMDNYNNN 267

Query:   175 NNVPINEWPGDAHEKELNNIF------VNKIKNNNDA-----QSYKGI----NNKTIFLE 41
             N    N    + +   LNN         N  KNNN +     Q+  G+    NN  +   
Sbjct:   268 NLYMNNNNNNNNNNNYLNNYMNPTDNMKNMSKNNNGSYNTSLQNLNGLEGTTNNAAVTQP 327

Query:    40 ENNDERYNQEN 8
              NN   Y+  N
Sbjct:   328 ANNLNNYSNLN 338

 Score = 82 (28.9 bits), Expect = 3.5, P = 0.97
 Identities = 40/166 (24%), Positives = 74/166 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNIS-NKNVHK--KDIQNINQNNNIVGSDQXDDIFFKNN 344
             SN  +  V    +DS  N  N  ++ NKN ++   D+ N++ NNN             NN
Sbjct:   121 SNNNSCGVAGGSMDSHYNTANSLMNYNKNHYEDGNDLNNMDTNNN-------------NN 167

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNK--KEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             N+N G   +  N  ++  NN   ++N   ++  ++   +N +   N +    + +   NN
Sbjct:   168 NNNNGSNSNNSNNSNSSNNNNNKNKNLMGRDSLQDKIMYNPMNDYNCIYPSNNPYGIQNN 227

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNND----AQSYKGINNKTIFLEENNDERYN 17
                  +P   +   LN +  N+  +NN+    A      NN  +++  NN+   N
Sbjct:   228 DKGYMYPN--YNTALNIMNPNENGDNNNSMVGASVMDNYNNNNLYMNNNNNNNNN 280


>sp|Q03101|CYAG_DICDI ADENYLATE CYCLASE, GERMINATION SPECIFIC (ATP
            PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >gi|167662 (M87278)
            adenylyl cyclase aggregation protein [Dictyostelium discoideum]
            Length = 858

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 1.8e-05, P = 1.8e-05
 Identities = 42/143 (29%), Positives = 66/143 (46%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             E I    NN N+NI++ N++     N N NNN +  +  D++    NN+NF +   I+N 
Sbjct:   732 EAIKILNNNNNNNINDNNINNT---NFNNNNNDININNSDNVNNYENNNNFSD--KIEN- 785

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
              ++  NN   D N K   E     NNI+     K   D     N++ + +   D ++   
Sbjct:   786 -NDGDNNNINDNNYKSTNE-----NNIKSKTLFK---DSKSLINDIKMAKENCDNNDDNN 836

Query:   124 NNIFVNKIKNNNDAQSYKGINNK 56
             NN   N   NNND ++ +   NK
Sbjct:   837 NNNNNNNNNNNND-ENVESKKNK 858

 Score = 122 (42.9 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 48/169 (28%), Positives = 80/169 (47%), Frame = -2

Query:   514 SNKGNTYVD-EEPIDSTKNNRNDNI--SNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN 344
             SN G  Y D  + I   +N +N+ +  + + + KK I+NI ++ ++  +D  + I   NN
Sbjct:   684 SNVG--YHDTSKDIKEDENEQNETLLFNQEQLKKKQIENIQRDLSL--NDSIEAIKILNN 739

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYE-EESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             N+N        NI+ N  NNT  + N  +     S   NN +++N     ++ + D +N 
Sbjct:   740 NNN-------NNINDNNINNTNFNNNNNDININNSDNVNNYENNNNFSDKIENN-DGDNN 791

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEEN---NDERYNQEN 8
              IN    D + K  N    N IK+    +  K + N     +EN   ND+  N  N
Sbjct:   792 NIN----DNNYKSTNE---NNIKSKTLFKDSKSLINDIKMAKENCDNNDDNNNNNN 840

 Score = 116 (40.8 bits), Expect = 0.00041, P = 0.00041
 Identities = 33/106 (31%), Positives = 55/106 (51%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE-----GQ 320
             E I    NN N+NI++ N++     N N NNN +  +  D++    NN+NF +       
Sbjct:   732 EAIKILNNNNNNNINDNNINNT---NFNNNNNDININNSDNVNNYENNNNFSDKIENNDG 788

Query:   319 DIQNIHHNVYNNTPTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             D  NI+ N Y +T  +  K +  +++  S  N+I+     K   D + D+NN
Sbjct:   789 DNNNINDNNYKSTNENNIKSKTLFKDSKSLINDIK---MAKENCDNNDDNNN 837

 Score = 112 (39.4 bits), Expect = 0.0016, P = 0.0016
 Identities = 45/155 (29%), Positives = 69/155 (44%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             +N + D   N ++    I N N NNNI   +  ++  F NNN++     +I N   NV N
Sbjct:   719 ENIQRDLSLNDSIEAIKILNNNNNNNI-NDNNINNTNFNNNNNDI----NINN-SDNV-N 771

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N   + N  +  E + G NN  +DN  KS      + NN+       D+ +  +N+I + 
Sbjct:   772 NYENNNNFSDKIENNDGDNNNINDNNYKST-----NENNIKSKTLFKDS-KSLINDIKMA 825

Query:   106 KIK-NNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             K   +NND  +    NN       NNDE    +  K
Sbjct:   826 KENCDNNDDNNNNNNNNNN---NNNNDENVESKKNK 858

 Score = 109 (38.4 bits), Expect = 0.0042, P = 0.0042
 Identities = 32/106 (30%), Positives = 53/106 (50%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN-NDNFGEGQ-DIQ 311
             E I    NN N+NI++ N++  +  N N + NI  SD  ++    NN +D       D  
Sbjct:   732 EAIKILNNNNNNNINDNNINNTNFNNNNNDININNSDNVNNYENNNNFSDKIENNDGDNN 791

Query:   310 NIHHNVYNNTPTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NI+ N Y +T  +  K +  +++  S  N+I+     K   D + D+NN
Sbjct:   792 NINDNNYKSTNENNIKSKTLFKDSKSLINDIK---MAKENCDNNDDNNN 837

 Score = 96 (33.8 bits), Expect = 0.18, P = 0.17
 Identities = 38/135 (28%), Positives = 72/135 (53%), Frame = -2

Query:   409 NINQNNNIVGSDQXDDIFFKNNNDNFGE-GQDIQNIHHNVYNNTPTDQNKKEYEEESSGF 233
             ++N N+ I GS+  DD F  ++N  + +  +DI+    N  N T    N+++ +++    
Sbjct:   663 SLNSNDLIDGSEYHDDPFPSDSNVGYHDTSKDIKE-DENEQNETLLF-NQEQLKKKQ--I 718

Query:   232 NNIQHDNTMKSPVD--KHMDHNNVP-INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGIN 62
              NIQ D ++   ++  K +++NN   IN+   +      NN  +N I N+++  +Y+  N
Sbjct:   719 ENIQRDLSLNDSIEAIKILNNNNNNNINDNNINNTNFNNNNNDIN-INNSDNVNNYENNN 777

Query:    61 NKTIFLEENNDERYNQENE 5
             N +  +E NND   N  N+
Sbjct:   778 NFSDKIE-NNDGDNNNIND 795

 Score = 82 (28.9 bits), Expect = 8.4, P = 1.0
 Identities = 34/134 (25%), Positives = 66/134 (49%), Frame = -2

Query:   409 NINQNNNIVGSDQXDDIFFKNNNDNFGE-GQDIQNIHHNVYNNTPTDQNKKEYEEESSGF 233
             ++N N+ I GS+  DD F  ++N  + +  +DI+    N  N T    N+++ +++    
Sbjct:   663 SLNSNDLIDGSEYHDDPFPSDSNVGYHDTSKDIKE-DENEQNETLLF-NQEQLKKKQ--I 718

Query:   232 NNIQHDNTMKSPVD--KHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
              NIQ D ++   ++  K +++NN   N    + ++  +NN   N   N+ +  +   +NN
Sbjct:   719 ENIQRDLSLNDSIEAIKILNNNN---NN---NINDNNINNTNFNNNNNDININNSDNVNN 772

Query:    58 KTIFLEENNDERYNQEN 8
                  E NN+     EN
Sbjct:   773 ----YENNNNFSDKIEN 785


>pir||S51910 cryptogene protein G4 - Sauroleishmania tarentolae (strain LEM125)
            Length = 169

  Plus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 4.0e-05, P = 4.0e-05
 Identities = 32/114 (28%), Positives = 59/114 (51%), Frame = +2

Query:    11 FLIIPFIIIFFQKNGFVIYAFI*L-CIIIIFYFINKYII*FLFMCISRPFIYRDII-MIH 184
             F+ I F+ +F      V Y  I L C   I +F+   II F F+ I   FI+  +   + 
Sbjct:    39 FIYIAFVCLFV----LVCYVVILLLCFDCIVFFLFTVIIIFFFLFIFWVFIFLLLFWFVF 94

Query:   185 MFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIF 352
              F+   F+  ++++  E   F F+ FF+    C  +  +M+IL+ +SF  +++++F
Sbjct:    95 GFLFFFFYVCVLIFYFE---FLFMLFFVF---CGFLLFVMFILFFISFFVLIVLVF 144

 Score = 105 (37.0 bits), Expect = 0.00050, P = 0.00050
 Identities = 40/156 (25%), Positives = 71/156 (45%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             FF  L    ++++F    FV   F+ +C ++I       I+ FLF  I        II  
Sbjct:    26 FFFCLFDLCVMVYFIYIAFVCL-FVLVCYVVILLLCFDCIVFFLFTVI--------IIFF 76

Query:   182 HMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKD 361
              +F+   F  +++ + +    F F+FFF  +  C++I+   + L++L F     ++F   
Sbjct:    77 FLFIFWVFIFLLLFWFV----FGFLFFFFYV--CVLIFYFEF-LFMLFFVFCGFLLFVMF 129

Query:   362 IIXLI*SHNIIILVN--ILNILFMNIFIANVVISIIFG 469
             I+  I    +I+LV   +L I     F     I I+ G
Sbjct:   130 ILFFISFFVLIVLVFCWLLFIFVFRFFCMTFCILILIG 167

 Score = 101 (35.6 bits), Expect = 0.0020, P = 0.0020
 Identities = 31/101 (30%), Positives = 55/101 (54%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIH 184
             FIF +  F+++F+   GF+ + F  +C++I FYF       FLFM     F++   ++  
Sbjct:    79 FIFWVFIFLLLFWFVFGFLFFFFY-VCVLI-FYFE------FLFMLF---FVFCGFLLFV 127

Query:   185 MFVDRTFHSIIMLYIIEAT*--FFFIFFFILISRCIIIYIMMY 307
             MF+   F S  +L ++      F F+F F  ++ CI+I I ++
Sbjct:   128 MFI-LFFISFFVLIVLVFCWLLFIFVFRFFCMTFCILILIGLF 169

 Score = 97 (34.1 bits), Expect = 0.0071, P = 0.0070
 Identities = 34/116 (29%), Positives = 59/116 (50%), Frame = +2

Query:    11 FLIIPFIIIFFQKNGFVIYAFI*L-CIIIIFYFINKYII*FLFMCISRPFIYRDII-MIH 184
             F+ I F+ +F      V Y  I L C   I +F+   II F F+ I   FI+  +   + 
Sbjct:    39 FIYIAFVCLFV----LVCYVVILLLCFDCIVFFLFTVIIIFFFLFIFWVFIFLLLFWFVF 94

Query:   185 MFVDRTFHSIIMLYIIEAT*F-FFIFF-FILISRCIIIYIMMYILYVLSFTKIVII-IFK 355
              F+   F+  ++++  E     FF+F  F+L    I+ +I  ++L VL F  ++ I +F+
Sbjct:    95 GFLFFFFYVCVLIFYFEFLFMLFFVFCGFLLFVMFILFFISFFVLIVLVFCWLLFIFVFR 154

 Score = 95 (33.4 bits), Expect = 0.013, P = 0.013
 Identities = 27/94 (28%), Positives = 49/94 (52%), Frame = +2

Query:   221 LYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKI---VIIIFKKDIIXLI*SHNI 391
             +Y      F+F FFF L   C+++Y + YI +V  F  +   VI++   D I       +
Sbjct:    14 MYYFVCCIFYFCFFFCLFDLCVMVYFI-YIAFVCLFVLVCYVVILLLCFDCIVFF-LFTV 71

Query:   392 IILVNILNILFMNIFIANVVISIIFG*INWFLIYISI 502
             II+   L I ++ IF+  ++   +FG + +F  Y+ +
Sbjct:    72 IIIFFFLFIFWVFIFL--LLFWFVFGFL-FFFFYVCV 105


>gi|437641 (L04160) [Plasmodium falciparum 5' end.], gene product [Plasmodium
           falciparum]
           Length = 308

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 6.3e-05, P = 6.3e-05
 Identities = 48/161 (29%), Positives = 77/161 (47%), Frame = -2

Query:   487 EEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             E+ +   K+ +ND N SN N +  +  N N NNN    D  + ++  NNN        + 
Sbjct:    95 EKLVVDDKDEKNDKNSSNNNNNNNNNNNNNNNNNNANVDNYN-VYVDNNNSG---NYSLM 150

Query:   310 NIHHNVYN-NTPTDQNKKEYEEESSGF---NNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
              +   V N N    ++K E + ++S     N+ +  N +KSP    M+     IN+   D
Sbjct:   151 TLQGEVLNENEKKGKSKNEDKNKTSNLATKNSNKGCNKLKSPPKDDMND----INKDAKD 206

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLE-ENNDERYNQENE 5
                K  N++ + +  N+ + QS    NN    LE ENND+   +ENE
Sbjct:   207 IIIKNTNDMILTECVNDKNMQSIFVDNN----LESENNDQL--KENE 247

 Score = 84 (29.6 bits), Expect = 1.3, P = 0.73
 Identities = 44/181 (24%), Positives = 79/181 (43%), Frame = -2

Query:   487 EEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             E+ +   K+ +ND N SN N +  +  N N NNN    D  + ++  NNN        +Q
Sbjct:    95 EKLVVDDKDEKNDKNSSNNNNNNNNNNNNNNNNNNANVDNYN-VYVDNNNSGNYSLMTLQ 153

Query:   310 N--IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPV-----DKHMDHNNVPINEW 152
                ++ N       +++K +    ++  +N +  N +KSP      D + D  ++ I   
Sbjct:   154 GEVLNENEKKGKSKNEDKNKTSNLATKNSN-KGCNKLKSPPKDDMNDINKDAKDIIIKN- 211

Query:   151 PGD------AHEKELNNIFV-NKIKN-NNDAQSYKGINNKTIFLEEN--NDERYN----Q 14
               D       ++K + +IFV N +++ NND      +    + L E   N+   N     
Sbjct:   212 TNDMILTECVNDKNMQSIFVDNNLESENNDQLKENEVKGDELNLTEKELNEHILNTVVVD 271

Query:    13 ENEK 2
             EN+K
Sbjct:   272 ENDK 275


>pir||S14556 asparagine-rich protein (clone 18C1) - Plasmodium falciparum
            >gi|1335715 (X17485) Plasmodium falciparum mRNA for asparagine-rich
            antigen (clone 18C1) [Plasmodium falciparum]
            Length = 1256

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00046, P = 0.00046
 Identities = 46/155 (29%), Positives = 70/155 (45%), Frame = -2

Query:   472 STKNNRNDNISN--KNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             +T NN N+NI N   +V   +   I++ N  N + +D  DD+   NNN N     +  N 
Sbjct:  1029 NTYNNNNNNILNDGNSVVGNNESMIHKKNVVNCINNDVEDDLGNMNNNHNNNNNNNNNNN 1088

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             ++N  NN     N        + F N +H+N   +   + +  +N  IN   G   E  L
Sbjct:  1089 NNNNNNNNNNSNNNNNNNNNLNVFMN-EHNNPTNN---RGIYGSNESINN-NGLMDEGRL 1143

Query:   124 NNIFV-NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             N I    K  + N+ QS     + T+    NNDE Y + N
Sbjct:  1144 NFIHTAGKHVDKNNMQS----GSTTVVNVLNNDENYIKSN 1179

 Score = 113 (39.8 bits), Expect = 0.0018, P = 0.0018
 Identities = 35/147 (23%), Positives = 64/147 (43%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH-N 296
             +  NN N+NISN   + KD    +     +      D     N +     +   N HH N
Sbjct:    59 NNNNNNNNNISNNISNNKDCDEYDYQEEYLKDKALYDSDMDENTNQLHNNEHHTNQHHAN 118

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHD--NTMKSPVDKHMDHNNVPINEWPGDAHEKELN 122
             V+++   +Q+ K+  + ++  NN  ++  N   + +  +MD+NN+       DA+    N
Sbjct:   119 VHHHKHQNQHLKQLIDHNNMINNNDNNIINNNNNYLINNMDNNNI-------DANNNNNN 171

Query:   121 NIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
             N   N   NN     +  +NN +  +  N+
Sbjct:   172 NNNNNNNINNLSHLIHNNMNNNSTLINRNH 201

 Score = 106 (37.3 bits), Expect = 0.016, P = 0.016
 Identities = 39/158 (24%), Positives = 74/158 (46%), Frame = -2

Query:   478 IDSTKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ--DIQ 311
             I+S  NN N+  ++ N+ V      N N   NI+ +   ++    NNN + G G   +I 
Sbjct:   966 INSCNNNSNNANSLLNRLVMSNG-SNGNTKLNIINNYNNNN----NNNSSSGGGVMVNIN 1020

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQ---HDNTMKSPVDKHMDHNNVPINEWPGDA 140
             N+H+N   NT  + N     + +S   N +   H   + + ++  ++ +   +N    + 
Sbjct:  1021 NVHNNDNMNTYNNNNNNILNDGNSVVGNNESMIHKKNVVNCINNDVEDDLGNMNNNHNNN 1080

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNK-TIFLEENNDERYNQ 14
             +    NN   N   NNN++ +    NN   +F+ E+N+   N+
Sbjct:  1081 NNNNNNNNNNNNNNNNNNSNNNNNNNNNLNVFMNEHNNPTNNR 1123

 Score = 105 (37.0 bits), Expect = 0.021, P = 0.021
 Identities = 43/162 (26%), Positives = 69/162 (42%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNVHKKD--IQNINQNNNIVGSDQXDDI--FFKNNNDNFGE 326
             ++ + I +T    N N  N N +  +  +  +  +N   G+ + + I  +  NNN+N   
Sbjct:   952 INNDSIITTTTATNINSCNNNSNNANSLLNRLVMSNGSNGNTKLNIINNYNNNNNNNSSS 1011

Query:   325 GQDIQ-NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             G  +  NI+ NV+NN     N   Y   +   NNI +D       ++ M H    +N   
Sbjct:  1012 GGGVMVNIN-NVHNN----DNMNTYNNNN---NNILNDGNSVVGNNESMIHKKNVVNCIN 1063

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              D  E +L N+  N   NNN+  +    NN       NN    N  N
Sbjct:  1064 NDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNN---NNNNSNNNNNNN 1106

 Score = 103 (36.3 bits), Expect = 0.039, P = 0.038
 Identities = 39/153 (25%), Positives = 70/153 (45%), Frame = -2

Query:   436 KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN---IHHNVYNNTPTDQN 266
             K    K  + +N+N+     D    + + NNN+N     +  N   I +N+ NN   D+ 
Sbjct:    25 KKYEMKSSKGMNKNHL---EDDNGMVKYNNNNNNNNSNNNNNNNNNISNNISNNKDCDEY 81

Query:   265 --KKEYEEESSGFNNIQHDNTMKSPVDKH---MDHNNVPINEWPGDAHEKEL---NNIFV 110
               ++EY ++ + +++   +NT +   ++H     H NV  ++     H K+L   NN+  
Sbjct:    82 DYQEEYLKDKALYDSDMDENTNQLHNNEHHTNQHHANVHHHKHQNQ-HLKQLIDHNNMIN 140

Query:   109 NK---IKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             N    I NNN+      ++N  I    NN+   N  N
Sbjct:   141 NNDNNIINNNNNYLINNMDNNNIDANNNNNNNNNNNN 177

 Score = 102 (35.9 bits), Expect = 0.051, P = 0.050
 Identities = 31/125 (24%), Positives = 56/125 (44%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIF--FKNNNDNFGEGQDIQNIHHNVYN 287
             N N NI + N H  ++ N+N N N +G +   ++   + NNN+N     +I N ++N  N
Sbjct:   342 NNNSNIHHNNHHMHNM-NLNINPNHLGHNMSHNMNHNYNNNNNNMYINNNINNNNNNNNN 400

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N  ++ N       + G + I    T+K  +         P      +  +  L+++   
Sbjct:   401 NNNSNSNNNN-NNNNIGNDVIHRKETVKVEIKGVKRGRGRPPKRKLSEESQMSLDDMEQT 459

Query:   106 KIKNNND 86
               +NNND
Sbjct:   460 LCRNNND 466

 Score = 101 (35.6 bits), Expect = 0.070, P = 0.068
 Identities = 38/151 (25%), Positives = 60/151 (39%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             NK +   D   +    NN N+N +N N +  +I N   NN         + + K+     
Sbjct:    36 NKNHLEDDNGMVKYNNNNNNNNSNNNNNNNNNISNNISNNKDCDEYDYQEEYLKDKALYD 95

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
              +  +  N  HN  N   T+Q+            N+ H       + + +DHNN+ IN  
Sbjct:    96 SDMDENTNQLHN--NEHHTNQHHA----------NVHHHKHQNQHLKQLIDHNNM-INNN 142

Query:   151 PGDAHEKELNNIFVNKIKNNN-DAQSYKGINN 59
               +      NN  +N + NNN DA +    NN
Sbjct:   143 DNNIINNN-NNYLINNMDNNNIDANNNNNNNN 173

 Score = 101 (35.6 bits), Expect = 0.070, P = 0.068
 Identities = 51/189 (26%), Positives = 84/189 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNND 338
             N GN+ V     +S  + +N  N  N +V + D+ N+N N NN   ++  ++    NNN+
Sbjct:  1040 NDGNSVVGNN--ESMIHKKNVVNCINNDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNNNN 1096

Query:   337 NFGEGQDIQNIHHNVY---NNTPTDQNKKEY-EEESSGFNNIQHDNTMK--SPVDKHMDH 176
             N     +  N + NV+   +N PT+ N+  Y   ES   N +  +  +       KH+D 
Sbjct:  1097 NNSNNNNNNNNNLNVFMNEHNNPTN-NRGIYGSNESINNNGLMDEGRLNFIHTAGKHVDK 1155

Query:   175 NNVP------INEWPGDAH--EKELNNIFVNKIKNNNDAQSYKGINN---------KTIF 47
             NN+       +N    D +  +  +N   ++ +KNN++       NN         K I 
Sbjct:  1156 NNMQSGSTTVVNVLNNDENYIKSNINYTNMDNMKNNDNPIDDDNPNNIVEMNLRVEKNI- 1214

Query:    46 LEENNDERYNQENE 5
             L  NNDE      E
Sbjct:  1215 LNNNNDEHIINNTE 1228

 Score = 100 (35.2 bits), Expect = 0.092, P = 0.088
 Identities = 37/157 (23%), Positives = 73/157 (46%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             + GNT ++   I++  NN N+N S+      +I N++ N+N+       + +  NNN+  
Sbjct:   989 SNGNTKLNI--INNYNNNNNNNSSSGGGVMVNINNVHNNDNM-------NTYNNNNNNIL 1039

Query:   331 GEGQDIQ-NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
              +G  +  N    ++     +    + E++    NN  H+N   +  + + ++NN   N 
Sbjct:  1040 NDGNSVVGNNESMIHKKNVVNCINNDVEDDLGNMNN-NHNNNNNNNNNNNNNNNNNNNNN 1098

Query:   154 WPGDAHEKELNNIFVNKIKN--NNDA--QSYKGINNKTIFLE 41
                + +     N+F+N+  N  NN     S + INN  +  E
Sbjct:  1099 SNNNNNNNNNLNVFMNEHNNPTNNRGIYGSNESINNNGLMDE 1140

 Score = 100 (35.2 bits), Expect = 0.092, P = 0.088
 Identities = 44/168 (26%), Positives = 78/168 (46%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNND 338
             N GN+ V     +S  + +N  N  N +V + D+ N+N N NN   ++  ++    NNN+
Sbjct:  1040 NDGNSVVGNN--ESMIHKKNVVNCINNDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNNNN 1096

Query:   337 NFGEGQDIQNIHHNVY---NNTPTDQNKKEY-EEESSGFNNIQHDNTMK--SPVDKHMDH 176
             N     +  N + NV+   +N PT+ N+  Y   ES   N +  +  +       KH+D 
Sbjct:  1097 NNSNNNNNNNNNLNVFMNEHNNPTN-NRGIYGSNESINNNGLMDEGRLNFIHTAGKHVDK 1155

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             NN+      G      + N   N IK+N +  +   + N    ++++N     + N
Sbjct:  1156 NNMQ----SGSTTVVNVLNNDENYIKSNINYTNMDNMKNNDNPIDDDNPNNIVEMN 1207

 Score = 99 (34.8 bits), Expect = 0.12, P = 0.11
 Identities = 47/168 (27%), Positives = 79/168 (47%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNND 338
             N GN+ V     +S  + +N  N  N +V + D+ N+N N NN   ++  ++    NNN+
Sbjct:  1040 NDGNSVVGNN--ESMIHKKNVVNCINNDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNNNN 1096

Query:   337 NFGEGQDIQNIHHNVY---NNTPTDQNKKEY-EEESSGFNNIQHDNTMK--SPVDKHMDH 176
             N     +  N + NV+   +N PT+ N+  Y   ES   N +  +  +       KH+D 
Sbjct:  1097 NNSNNNNNNNNNLNVFMNEHNNPTN-NRGIYGSNESINNNGLMDEGRLNFIHTAGKHVDK 1155

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             NN+      G      + N   N IK+N +   Y  ++N      +NND   + +N
Sbjct:  1156 NNMQ----SGSTTVVNVLNNDENYIKSNIN---YTNMDNM-----KNNDNPIDDDN 1199

 Score = 99 (34.8 bits), Expect = 0.12, P = 0.11
 Identities = 39/171 (22%), Positives = 76/171 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N+    +  +  +   N  N+ ++N+  ++ + Q  NQ  N V +   + +  + NN  
Sbjct:   787 TNQMTNQMTNQMTNQMTNQVNNQMTNQMTNQVNNQMTNQMTNQVNNQMTNQMTNQMNN-- 844

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYE-EESSGFNNIQHDNTMKSPVDKHMDHN--NVP 164
                 Q    ++ ++ +      N   +    S+G N + + N + + V+ +MD+N  N  
Sbjct:   845 ----QMKNQVNSHINSQVAGHMNANMFNGNNSNGTNMLGNMNMLNNMVNSNMDNNVNNNY 900

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              N +PG  +   LNN+  + + NNN A+     N+      ENND       EK
Sbjct:   901 SNNYPGSGNNG-LNNM-TSCVMNNNGAEIDMDDNDNI----ENNDHENMMTLEK 948

 Score = 98 (34.5 bits), Expect = 8.4e-05, Sum P(2) = 8.4e-05
 Identities = 32/128 (25%), Positives = 53/128 (41%), Frame = -2

Query:   391 NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
             ++ GS +  D    N+       ++  N+H N  NN   + N  ++  +++  +NI H+N
Sbjct:   293 HVHGSRKAVDAAITNDLLRSEMEENFNNMHMNHNNNNNNNNNNNQHHHQNNN-SNIHHNN 351

Query:   211 TMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
                     HM + N+ IN  P        +N+  N   NNN+      INN       NN
Sbjct:   352 -------HHMHNMNLNIN--PNHLGHNMSHNMNHNYNNNNNNMYINNNINNNNNNNNNNN 402

Query:    31 DERYNQEN 8
             +   N  N
Sbjct:   403 NSNSNNNN 410

 Score = 98 (34.5 bits), Expect = 0.16, P = 0.15
 Identities = 39/152 (25%), Positives = 67/152 (44%), Frame = -2

Query:   514 SNKG-NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN-- 344
             S+KG N    E+     K N N+N +N N +  +  NI+  NNI  +   D+  ++    
Sbjct:    31 SSKGMNKNHLEDDNGMVKYNNNNNNNNSNNNNNNNNNIS--NNISNNKDCDEYDYQEEYL 88

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
              D      D+    + ++NN   + +  ++        N+ H       + + +DHNN+ 
Sbjct:    89 KDKALYDSDMDENTNQLHNN---EHHTNQHHA------NVHHHKHQNQHLKQLIDHNNM- 138

Query:   163 INEWPGDAHEKELNNIFVNKIKNNN-DAQSYKGINN 59
             IN    +      NN  +N + NNN DA +    NN
Sbjct:   139 INNNDNNIINNN-NNYLINNMDNNNIDANNNNNNNN 173

 Score = 95 (33.4 bits), Expect = 0.38, P = 0.31
 Identities = 42/171 (24%), Positives = 83/171 (48%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDI-FFKNNNDNFGEGQDIQ 311
             E+ + +  NN N+N +N N +  +  N N NN+   ++  +++  F N ++N    + I 
Sbjct:  1067 EDDLGNMNNNHNNNNNNNNNNNNNNNNNNNNNSNNNNNNNNNLNVFMNEHNNPTNNRGIY 1126

Query:   310 NIHHNVYNNTPTDQNK--------KEYEEES--SG----FNNIQHD-NTMKSPVDKHMDH 176
               + ++ NN   D+ +        K  ++ +  SG     N + +D N +KS ++ + + 
Sbjct:  1127 GSNESINNNGLMDEGRLNFIHTAGKHVDKNNMQSGSTTVVNVLNNDENYIKSNIN-YTNM 1185

Query:   175 NNVPINEWPGDAHEKELNNIF-VN-KIKNN--NDAQSYKGINNKTIFLEENNDE 26
             +N+  N+ P D  +   NNI  +N +++ N  N+      INN    +  NN E
Sbjct:  1186 DNMKNNDNPID--DDNPNNIVEMNLRVEKNILNNNNDEHIINNTEDMMSTNNKE 1237

 Score = 90 (31.7 bits), Expect = 0.00093, Sum P(2) = 0.00093
 Identities = 29/129 (22%), Positives = 58/129 (44%), Frame = -2

Query:   391 NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
             ++ GS +  D    N+       ++  N+H N  NN   + N  ++  +++  +NI H+N
Sbjct:   293 HVHGSRKAVDAAITNDLLRSEMEENFNNMHMNHNNNNNNNNNNNQHHHQNNN-SNIHHNN 351

Query:   211 TMKSPVDKHMDHNNVPINEWPGDAHE--KELNNIFVNKIKNNNDAQSYKGINNKTIFLEE 38
                  ++ +++ N++  N      H      NN+++N   NNN+  +    NN       
Sbjct:   352 HHMHNMNLNINPNHLGHNMSHNMNHNYNNNNNNMYINNNINNNNNNN----NNNNNSNSN 407

Query:    37 NNDERYNQENE 5
             NN+   N  N+
Sbjct:   408 NNNNNNNIGND 418

 Score = 85 (29.9 bits), Expect = 5.8, P = 1.0
 Identities = 44/172 (25%), Positives = 77/172 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N     +D +  D+ +NN ++N+    + K+D  +IN N++I+ +    +I   NNN N 
Sbjct:   921 NNNGAEIDMDDNDNIENNDHENMMT--LEKED--SIN-NDSIITTTTATNINSCNNNSNN 975

Query:   331 GEGQDIQNIHHNVYN-NTP----TDQNKKEYEEESSG------FNNIQHDNTMKSPVDKH 185
                   + +  N  N NT      + N       SSG       NN+ +++ M +    +
Sbjct:   976 ANSLLNRLVMSNGSNGNTKLNIINNYNNNNNNNSSSGGGVMVNINNVHNNDNMNT----Y 1031

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKN--NNDAQSYKG-INNKTIFLEENNDERYNQ 14
              ++NN  +N+        E + I    + N  NND +   G +NN       NN+   N 
Sbjct:  1032 NNNNNNILNDGNSVVGNNE-SMIHKKNVVNCINNDVEDDLGNMNNNHNNNNNNNNNNNNN 1090

Query:    13 EN 8
              N
Sbjct:  1091 NN 1092

 Score = 72 (25.3 bits), Expect = 0.14, Sum P(2) = 0.13
 Identities = 28/119 (23%), Positives = 53/119 (44%), Frame = -2

Query:   394 NNIVGSDQXDDIFFKN---NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFN-- 230
             N+++ S+  ++  F N   N++N     +  N HH+  NN+    N       +   N  
Sbjct:   307 NDLLRSEMEEN--FNNMHMNHNNNNNNNNNNNQHHHQNNNSNIHHNNHHMHNMNLNINPN 364

Query:   229 NIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTI 50
             ++ H+ +     + + ++NN+ IN    + +    NN   N   NNN+      I N  I
Sbjct:   365 HLGHNMSHNMNHNYNNNNNNMYINNNINNNNNNNNNNNNSNSNNNNNN----NNIGNDVI 420

Query:    49 FLEE 38
               +E
Sbjct:   421 HRKE 424

 Score = 71 (25.0 bits), Expect = 8.4e-05, Sum P(2) = 8.4e-05
 Identities = 18/46 (39%), Positives = 24/46 (52%), Frame = -2

Query:   511 NKGNTYV----DEEPIDSTKNNRNDNISNKNVHKKD--IQNINQNNN 389
             N  N Y+    D   ID+  NN N+N +N N++     I N N NNN
Sbjct:   148 NNNNNYLINNMDNNNIDANNNNNNNNNNNNNINNLSHLIHN-NMNNN 193

 Score = 71 (25.0 bits), Expect = 0.18, Sum P(2) = 0.17
 Identities = 28/127 (22%), Positives = 50/127 (39%), Frame = -2

Query:   433 NVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKE 257
             N+   D+ N IN  NN++     D  F  N   N      ++   +N   N  T+Q   +
Sbjct:   719 NIFNVDVNNLINNQNNMINLGFHDG-FGTNGLMNNQMINQMKTQLNNQMTNQMTNQMTNQ 777

Query:   256 YEEESSGFNNIQHDNTMKSPVDKHMDH--NNVPINEWPGDAHEKELNNIFVNKIKNNNDA 83
                + +     Q  N M + +   M +  NN   N+     +  ++ N   N++ N    
Sbjct:   778 MTNQMTNQMTNQMTNQMTNQMTNQMTNQVNNQMTNQMTNQVNN-QMTNQMTNQVNNQMTN 836

Query:    82 QSYKGINNK 56
             Q    +NN+
Sbjct:   837 QMTNQMNNQ 845

 Score = 68 (23.9 bits), Expect = 4.0, Sum P(2) = 0.98
 Identities = 39/156 (25%), Positives = 62/156 (39%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQN--NNIVGSDQXD----DIFFKNNNDNFGEGQDIQNIHHNV 293
             N N+ N  V+     N+N N  NN  GS             NNN    +  D  NI +N 
Sbjct:   880 NMNMLNNMVNSNMDNNVNNNYSNNYPGSGNNGLNNMTSCVMNNNGAEIDMDDNDNIENND 939

Query:   292 YNNTPTDQNKKEYEEES----SGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             + N  T + +     +S    +   NI   N   +  +  +  N + ++   G     +L
Sbjct:   940 HENMMTLEKEDSINNDSIITTTTATNINSCNNNSNNANSLL--NRLVMSN--GSNGNTKL 995

Query:   124 NNIFVNKIKNNNDAQSYKG----INNKTIFLEENNDERYNQEN 8
             N   +N   NNN+  S  G    +N   +   +N +  YN  N
Sbjct:   996 N--IINNYNNNNNNNSSSGGGVMVNINNVHNNDNMNT-YNNNN 1035

 Score = 61 (21.5 bits), Expect = 1.8, Sum P(2) = 0.84
 Identities = 11/33 (33%), Positives = 18/33 (54%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKD 416
             +N  N   +    +S  NN N+NI N  +H+K+
Sbjct:   392 NNNNNNNNNNNNSNSNNNNNNNNIGNDVIHRKE 424

 Score = 54 (19.0 bits), Expect = 0.0045, Sum P(2) = 0.0045
 Identities = 14/57 (24%), Positives = 28/57 (49%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             N  N Y+    I++  NN  D  +N N +  +  NIN  ++++ ++  ++    N N
Sbjct:   148 NNNNNYL----INNMDNNNIDANNNNNNNNNNNNNINNLSHLIHNNMNNNSTLINRN 200

 Score = 38 (13.4 bits), Expect = 0.19, Sum P(2) = 0.17
 Identities = 8/21 (38%), Positives = 13/21 (61%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDI 413
             +ST  NRN  I ++ + K D+
Sbjct:   193 NSTLINRNHLIKSERIKKGDV 213


>gi|552163 (J03986) 10b antigen [Plasmodium falciparum] >prf||1510296A Asn rich
           protein 10b [Plasmodium falciparum]
           Length = 374

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 9.0e-05, P = 9.0e-05
 Identities = 33/131 (25%), Positives = 60/131 (45%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNI--VGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             + KNN N N +NKN + K+  N N NNN+  +  ++ +  +   N +N    ++ Q    
Sbjct:   214 NNKNNNNKNNNNKNNNNKNNNNNNNNNNLESITKNKNNSQYISTNVENENLNKNEQKGKM 273

Query:   298 NVYNNTPTDQNKKEYEEESSGF--NNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             N    T T +  KE + E++ F  NN +  N  +        ++N+  N W  +    + 
Sbjct:   274 NKMK-TKTQRFNKEEQNETNNFTNNNKKGSNRYQQNKKGQFKNSNMNYNSWINNQQGNDQ 332

Query:   124 NNIFVNKIKNNN 89
              ++  N  K+ N
Sbjct:   333 QHLNTNVDKDKN 344

 Score = 104 (36.6 bits), Expect = 0.0062, P = 0.0061
 Identities = 41/156 (26%), Positives = 68/156 (43%), Frame = -2

Query:   469 TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             TKN+ N N +NKN + K+  N N NNN   ++  + I  KN N++     +++N + N  
Sbjct:   210 TKNSNNKNNNNKNNNNKNNNNKNNNNNN-NNNNLESIT-KNKNNSQYISTNVENENLNK- 266

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN-NIF 113
             N      NK + + +   FN  + + T     +     N    N+  G      +N N +
Sbjct:   267 NEQKGKMNKMKTKTQR--FNKEEQNETNNFTNNNKKGSNRYQQNK-KGQFKNSNMNYNSW 323

Query:   112 VNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             +N  +  ND Q      N  +  ++N D   N E  K
Sbjct:   324 INN-QQGNDQQHL----NTNVDKDKNKDFEVNHEIHK 355

 Score = 92 (32.4 bits), Expect = 0.19, P = 0.17
 Identities = 31/161 (19%), Positives = 72/161 (44%), Frame = -2

Query:   484 EPI-DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             +P+ ++ ++N+ +N+     H  ++ N  ++ N+        +  +  N   G+ ++  N
Sbjct:   156 QPLKNNVEHNKANNLLTSKKHNTNVNNKKKSKNVQQETPIKHLPNEEENMKQGKTKNSNN 215

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFN--NIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
              ++N  NN   + N K     ++  N  +I  +      +  ++++ N+  NE  G  ++
Sbjct:   216 KNNNNKNNNNKNNNNKNNNNNNNNNNLESITKNKNNSQYISTNVENENLNKNEQKGKMNK 275

Query:   133 KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              +      NK +  N+  ++   NNK          RY Q+N+K
Sbjct:   276 MKTKTQRFNK-EEQNETNNFTN-NNK------KGSNRY-QQNKK 310

 Score = 87 (30.6 bits), Expect = 0.77, P = 0.54
 Identities = 38/157 (24%), Positives = 63/157 (40%), Frame = -2

Query:   475 DSTKNNRNDNISN-KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             D+     N NI N  NV+    +   Q+  I+ + +   I    NN+         N+ H
Sbjct:   109 DNRNKMNNPNIPNYPNVNVSAPET-KQDTKIIPNKEKKKII---NNEGTVLQPLKNNVEH 164

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             N  NN  T +             N+Q +    +P+ KH+ +    + +        + NN
Sbjct:   165 NKANNLLTSKKHNTNVNNKKKSKNVQQE----TPI-KHLPNEEENMKQGKTKNSNNKNNN 219

Query:   118 IFVNKIKNNNDAQSYKGINNKTI--FLEENNDERY---NQENE 5
                N  KNNN+  +    NN  +    +  N+ +Y   N ENE
Sbjct:   220 NKNNNNKNNNNKNNNNNNNNNNLESITKNKNNSQYISTNVENE 262

 Score = 85 (29.9 bits), Expect = 1.3, P = 0.73
 Identities = 38/174 (21%), Positives = 77/174 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKD-IQNI-NQNNNIV-GSDQXDDIFFKNNN 341
             NK N  +  +  ++  NN+     +KNV ++  I+++ N+  N+  G  +  +    NN 
Sbjct:   165 NKANNLLTSKKHNTNVNNKK---KSKNVQQETPIKHLPNEEENMKQGKTKNSNNKNNNNK 221

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             +N  +  + +N ++N  NN      K +   +     N++++N  K+     M+      
Sbjct:   222 NNNNKNNNNKNNNNNNNNNNLESITKNKNNSQYIS-TNVENENLNKNEQKGKMNKMKTKT 280

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQS-----YKGIN---NKTIFLEENNDERYNQEN 8
               +  +  + E NN   N  K +N  Q      +K  N   N  I  ++ ND+++   N
Sbjct:   281 QRFNKE-EQNETNNFTNNNKKGSNRYQQNKKGQFKNSNMNYNSWINNQQGNDQQHLNTN 338

 Score = 82 (28.9 bits), Expect = 3.0, P = 0.95
 Identities = 36/149 (24%), Positives = 68/149 (45%), Frame = -2

Query:   457 RNDNISNKNVHKKDIQNINQNNNIVGS----DQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             +N+    K ++KK+ Q+     N++      +Q + + F NN ++      + N++H   
Sbjct:    21 KNNEWGKKKMNKKNNQSGMNQQNVMNQQKVMNQPNAMNFPNNMNHPNNMNHLNNMNHPNN 80

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH-MDHNNVPINEWPG---DAHE-KEL 125
              N P + N+          N++QH N    P +++ M++ N+P   +P     A E K+ 
Sbjct:    81 MNHPNNINQPNLINYQYPMNHVQHIN---HPDNRNKMNNPNIP--NYPNVNVSAPETKQD 135

Query:   124 NNIFVNKIKN---NNDAQSYKGINNKTIFLEENN 32
               I  NK K    NN+    + + N     + NN
Sbjct:   136 TKIIPNKEKKKIINNEGTVLQPLKNNVEHNKANN 169

 Score = 82 (28.9 bits), Expect = 3.0, P = 0.95
 Identities = 41/152 (26%), Positives = 70/152 (46%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQ---NINQNNNIVGSDQXDDIFFKNNNDNFGE--GQDIQNIHH 299
             NN N +++N N H  ++    NINQ N I      + +   N+ DN  +    +I N + 
Sbjct:    67 NNMN-HLNNMN-HPNNMNHPNNINQPNLINYQYPMNHVQHINHPDNRNKMNNPNIPN-YP 123

Query:   298 NVYNNTP-TDQNKK--EYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKE 128
             NV  + P T Q+ K    +E+    NN   + T+  P+  +++HN    N      H   
Sbjct:   124 NVNVSAPETKQDTKIIPNKEKKKIINN---EGTVLQPLKNNVEHNKAN-NLLTSKKHNTN 179

Query:   127 LNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +NN    K KN       K + N+   +++   +  N +N
Sbjct:   180 VNN--KKKSKNVQQETPIKHLPNEEENMKQGKTKNSNNKN 217

 Score = 81 (28.5 bits), Expect = 3.9, P = 0.98
 Identities = 27/123 (21%), Positives = 58/123 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNIN---QNNNIVGSDQXDDIF-FKN 347
             +NK N   +    ++  NN N+N+ +   +K + Q I+   +N N+  ++Q   +   K 
Sbjct:   219 NNKNNNNKNNNNKNNNNNNNNNNLESITKNKNNSQYISTNVENENLNKNEQKGKMNKMKT 278

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSG-F--NNIQHDNTMKSPVDKHMDH 176
                 F + +  QN  +N  NN     N+  Y++   G F  +N+ +++ + +       H
Sbjct:   279 KTQRFNKEE--QNETNNFTNNNKKGSNR--YQQNKKGQFKNSNMNYNSWINNQQGNDQQH 334

Query:   175 NNVPINE 155
              N  +++
Sbjct:   335 LNTNVDK 341


>gi|454844 (M74170) ORF 3 [Schistosoma mansoni]
           Length = 393

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 9.8e-05, P = 9.8e-05
 Identities = 40/158 (25%), Positives = 76/158 (48%), Frame = +2

Query:    14 LIIPFIIIFFQKNGFVIYAFI*L---CIIIIFYFINKYII*FLFMCISRPFIYRDIIMIH 184
             L+I   +  F +   VI  F+ +    I++I  F+  ++   L + +      R I++I 
Sbjct:   171 LVITLFVAIFVRTILVITLFVAIFVRTILVITLFVTIFVRTILVITLFVAIFVRTILVIT 230

Query:   185 MFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDI 364
             +FV     SI+++ I+  + F      I I    I+ I ++++ V   T  V+ IF   +
Sbjct:   231 LFVTIFIISILLVTILVISVFIIAILTISIFVISILIITIFVISVFVITIFVVTIFAITV 290

Query:   365 IXL---I*SHNIIILVNILNI-LFMNIFIANVVISIIF 466
             + +   I +  I+  V+IL + L M IFI  +++  IF
Sbjct:   291 LVISIFIVAFFIVFAVSILLVPLLMTIFIIAILVITIF 328

 Score = 114 (40.1 bits), Expect = 0.00028, P = 0.00028
 Identities = 34/157 (21%), Positives = 74/157 (47%), Frame = +2

Query:     8 IFLIIPFII-IFFQKNG---FVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDII 175
             I LI+ F I +FF       FVI+  + L I+ IF+ +  ++I F    +  P +   + 
Sbjct:    29 IMLIVVFTITVFFISTTIIVFVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVLVVSVF 88

Query:   176 MIHMFVDRTFH-SIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIF 352
              + +F+      +I ++ +   T F      + I    I+ + ++++ +L  T  + I  
Sbjct:    89 FVTIFIIAILLVTIFVVSVFVVTIFIIAVLLVTIFVISILLVTIFVVSILVVTLFITIFV 148

Query:   353 KKDIIXLI*SHNIIILVNILNILFMNIFIANVVISII 463
             +  ++  I   N+ + + +  IL + +F+A  V +I+
Sbjct:   149 RAILVVTILVINLFVTIFVRAILVITLFVAIFVRTIL 185

 Score = 112 (39.4 bits), Expect = 0.00056, P = 0.00056
 Identities = 39/166 (23%), Positives = 88/166 (53%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCIS-RPFIYRDIIMIH 184
             IF++  F++  F     ++  F+ + I+++  F+   ++  LF+ I  R  +   I++I+
Sbjct:   102 IFVVSVFVVTIFIIAVLLVTIFV-ISILLVTIFVVSILVVTLFITIFVRAILVVTILVIN 160

Query:   185 MFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIY---IMMYILYVLSFTKIVIII-- 349
             +FV     +I+++ +  A    F+   ++I+  + I+   I++  L+V  F + +++I  
Sbjct:   161 LFVTIFVRAILVITLFVA---IFVRTILVITLFVAIFVRTILVITLFVTIFVRTILVITL 217

Query:   350 FKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISI 502
             F    +  I    + + + I++IL + I + +V I  I   I+ F+I I I
Sbjct:   218 FVAIFVRTILVITLFVTIFIISILLVTILVISVFIIAILT-ISIFVISILI 267

 Score = 112 (39.4 bits), Expect = 0.00056, P = 0.00056
 Identities = 36/169 (21%), Positives = 81/169 (47%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHM 187
             +F +  FII       FV+  F+    II    +  ++I  L + I   F+   I+++ +
Sbjct:    87 VFFVTIFIIAILLVTIFVVSVFVVTIFIIAVLLVTIFVISILLVTI---FVV-SILVVTL 142

Query:   188 FVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDII 367
             F+     +I+++ I+      F+  F+     I +++ +++  +L  T + + IF + I+
Sbjct:   143 FITIFVRAILVVTILVIN--LFVTIFVRAILVITLFVAIFVRTILVIT-LFVAIFVRTIL 199

Query:   368 XLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISFIT 514
              +     I +   ++  LF+ IF+  +++  +F  +  F+I  SI  +T
Sbjct:   200 VITLFVTIFVRTILVITLFVAIFVRTILVITLF--VTIFII--SILLVT 244

 Score = 111 (39.1 bits), Expect = 0.00076, P = 0.00076
 Identities = 37/163 (22%), Positives = 84/163 (51%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHM 187
             IF++  F++  F     ++  F+ + I+++  F+   ++  LF+ I   F+ R I+++ +
Sbjct:   102 IFVVSVFVVTIFIIAVLLVTIFV-ISILLVTIFVVSILVVTLFITI---FV-RAILVVTI 156

Query:   188 FVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDII 367
              V   F +I +  I+  T   F+  F+     I +++ +++  +L  T + + IF + I+
Sbjct:   157 LVINLFVTIFVRAILVIT--LFVAIFVRTILVITLFVAIFVRTILVIT-LFVTIFVRTIL 213

Query:   368 XLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYI 496
              +     I +   ++  LF+ IFI ++++  I   I+ F+I I
Sbjct:   214 VITLFVAIFVRTILVITLFVTIFIISILLVTILV-ISVFIIAI 255

 Score = 107 (37.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 40/159 (25%), Positives = 75/159 (47%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFV--IYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             I +I  F+ IF +    +    A     I++I  F+  ++   L + +      R I++I
Sbjct:   170 ILVITLFVAIFVRTILVITLFVAIFVRTILVITLFVTIFVRTILVITLFVAIFVRTILVI 229

Query:   182 HMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKD 361
              +FV     SI+++ I+  + F      I I    I+ I ++++ V   T  V+ IF   
Sbjct:   230 TLFVTIFIISILLVTILVISVFIIAILTISIFVISILIITIFVISVFVITIFVVTIFAIT 289

Query:   362 IIXL---I*SHNIIILVNILNI-LFMNIFIANVVISIIF 466
             ++ +   I +  I+  V+IL + L M IFI  +++  IF
Sbjct:   290 VLVISIFIVAFFIVFAVSILLVPLLMTIFIIAILVITIF 328

 Score = 107 (37.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 37/171 (21%), Positives = 78/171 (45%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFV---IYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIM 178
             I L+  F++       F+   + A + + I++I  F+  ++   L + +      R I++
Sbjct:   127 ILLVTIFVVSILVVTLFITIFVRAILVVTILVINLFVTIFVRAILVITLFVAIFVRTILV 186

Query:   179 IHMFVD---RTFHSIIMLYIIEAT*FFFIFFFILIS-RCIIIYIMMYILYVLSFTKIVII 346
             I +FV    RT   I +   I       I  F+ I  R I++  +   ++++S   + I+
Sbjct:   187 ITLFVAIFVRTILVITLFVTIFVRTILVITLFVAIFVRTILVITLFVTIFIISILLVTIL 246

Query:   347 IFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISI 502
             +    II ++     +I + I+ I  +++F+  + +  IF  I   +I I I
Sbjct:   247 VISVFIIAILTISIFVISILIITIFVISVFVITIFVVTIFA-ITVLVISIFI 297

 Score = 106 (37.3 bits), Expect = 0.0036, P = 0.0036
 Identities = 36/166 (21%), Positives = 77/166 (46%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHM 187
             IF++   ++  F      + A + + I++I  F+  ++   L + +      R I++I +
Sbjct:   132 IFVVSILVVTLFIT--IFVRAILVVTILVINLFVTIFVRAILVITLFVAIFVRTILVITL 189

Query:   188 FVD---RTFHSIIMLYIIEAT*FFFIFFFILIS-RCIIIYIMMYILYVLSFTKIVIIIFK 355
             FV    RT   I +   I       I  F+ I  R I++  +   ++++S   + I++  
Sbjct:   190 FVAIFVRTILVITLFVTIFVRTILVITLFVAIFVRTILVITLFVTIFIISILLVTILVIS 249

Query:   356 KDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISI 502
               II ++     +I + I+ I  +++F+  + +  IF  I   +I I I
Sbjct:   250 VFIIAILTISIFVISILIITIFVISVFVITIFVVTIFA-ITVLVISIFI 297

 Score = 101 (35.6 bits), Expect = 0.016, P = 0.016
 Identities = 36/154 (23%), Positives = 79/154 (51%), Frame = +2

Query:     2 FFIFLIIPFII--IFFQKNGF-VIYAFI*LCI---IIIFYFINKYII*FLFMCISRPFIY 163
             F IFLI+  II  IFF    F +I++   L I   ++  +F+  +II  L + I   F+ 
Sbjct:    49 FVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVLVVSVFFVTIFIIAILLVTI---FVV 105

Query:   164 RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVI 343
               + ++ +F+      ++ +++I       +  F++    + ++I +++  +L  T +VI
Sbjct:   106 -SVFVVTIFIIAVL--LVTIFVIS---ILLVTIFVVSILVVTLFITIFVRAILVVTILVI 159

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISII 463
              +F    +  I    + + + +  IL + +F+A  V +I+
Sbjct:   160 NLFVTIFVRAILVITLFVAIFVRTILVITLFVAIFVRTIL 199

 Score = 99 (34.8 bits), Expect = 0.028, P = 0.027
 Identities = 35/156 (22%), Positives = 77/156 (49%), Frame = +2

Query:     2 FFIFLIIPFII--IFFQKNGF-VIYAFI*LCI---IIIFYFINKYII*FLFMCISRPFIY 163
             F IFLI+  II  IFF    F +I++   L I   ++  +F+  +II  L + I   F+ 
Sbjct:    49 FVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVLVVSVFFVTIFIIAILLVTI---FVV 105

Query:   164 RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVI 343
                ++    +     +I ++ I+  T   F+   ++++  I I++   ++  +    + +
Sbjct:   106 SVFVVTIFIIAVLLVTIFVISILLVT--IFVVSILVVTLFITIFVRAILVVTILVINLFV 163

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIF 466
              IF + I+ +     I +   ++  LF+ IF+  +++  +F
Sbjct:   164 TIFVRAILVITLFVAIFVRTILVITLFVAIFVRTILVITLF 204

 Score = 95 (33.4 bits), Expect = 0.089, P = 0.085
 Identities = 39/149 (26%), Positives = 81/149 (54%), Frame = +2

Query:    71 FI*LCIIIIF----YFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYIIEA 238
             FI + +I++F    +FI+  II F+   I    I      + +F+     +++++ ++  
Sbjct:    26 FIMIMLIVVFTITVFFISTTIIVFVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVLVV 85

Query:   239 T*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI*SHNIIILVNILNI 418
             + FF   F I I    I  + ++++ +     +++ IF   I+ +      I +V+IL +
Sbjct:    86 SVFFVTIFIIAILLVTIFVVSVFVVTIFIIAVLLVTIFVISILLVT-----IFVVSILVV 140

Query:   419 -LFMNIFI-ANVVISIIFG*INWFL-IYI-SISFIT 514
              LF+ IF+ A +V++I+   IN F+ I++ +I  IT
Sbjct:   141 TLFITIFVRAILVVTILV--INLFVTIFVRAILVIT 174

 Score = 89 (31.3 bits), Expect = 0.47, P = 0.38
 Identities = 34/162 (20%), Positives = 66/162 (40%), Frame = +2

Query:    14 LIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFV 193
             L+I   +  F +   VI  F+ + II I       I  F+   ++       I++I +FV
Sbjct:   213 LVITLFVAIFVRTILVITLFVTIFIISILLVTILVISVFIIAILTISIFVISILIITIFV 272

Query:   194 DRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXL 373
                F  +I ++++       +   I I    I++ +  +L  L  T  +I I    I  +
Sbjct:   273 ISVF--VITIFVVTIFAITVLVISIFIVAFFIVFAVSILLVPLLMTIFIIAILVITIFVI 330

Query:   374 I*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYIS 499
             +    + +L  I+  +F  I I   ++  I      F+ + S
Sbjct:   331 V--FTVSVLAGIIACVFSTITIFLTIVIFIINIYRIFMTFTS 370

 Score = 87 (30.6 bits), Expect = 0.82, P = 0.56
 Identities = 42/167 (25%), Positives = 81/167 (48%), Frame = +2

Query:    14 LIIPFIIIFFQKNGFVIYAFI*L---CIIIIFYFINKYII*FLFMCIS--RPFIYRDIIM 178
             L+I   +  F +   VI  F+ +    I++I  F+  +II  L + I     FI   I+ 
Sbjct:   199 LVITLFVTIFVRTILVITLFVAIFVRTILVITLFVTIFIISILLVTILVISVFIIA-ILT 257

Query:   179 IHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKK 358
             I +FV      II +++I    F    F + I     I +++  +++++F     I+F  
Sbjct:   258 ISIFVISIL--IITIFVISV--FVITIFVVTI---FAITVLVISIFIVAF----FIVFAV 306

Query:   359 DIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISFIT 514
              I+ +     +++ + I+ IL + IF+    +S++ G I      I+I F+T
Sbjct:   307 SILLV----PLLMTIFIIAILVITIFVIVFTVSVLAGIIACVFSTITI-FLT 353

 Score = 85 (29.9 bits), Expect = 1.4, P = 0.75
 Identities = 40/161 (24%), Positives = 79/161 (49%), Frame = +2

Query:    14 LIIPFIIIFFQKNGFVIYAFI*L---CIIIIFYFINKYII*FLFMCIS--RPFIYRDIIM 178
             L+I   +  F +   VI  F+ +    I++I  F+  +II  L + I     FI   I+ 
Sbjct:   199 LVITLFVTIFVRTILVITLFVAIFVRTILVITLFVTIFIISILLVTILVISVFIIA-ILT 257

Query:   179 IHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKK 358
             I +FV      II +++I     F I  F++    I + ++   +++++F     I+F  
Sbjct:   258 ISIFVISIL--IITIFVISV---FVITIFVVTIFAITVLVIS--IFIVAF----FIVFAV 306

Query:   359 DIIXLI*SHNIIILVNILNILFMNIFIANV---VISIIFG*INWFLIYI 496
              I+ +     I I+  ++  +F+ +F  +V   +I+ +F  I  FL  +
Sbjct:   307 SILLVPLLMTIFIIAILVITIFVIVFTVSVLAGIIACVFSTITIFLTIV 355

 Score = 84 (29.6 bits), Expect = 1.9, P = 0.85
 Identities = 28/116 (24%), Positives = 62/116 (53%), Frame = +2

Query:   155 FIYRDIIMIHMFVDRTFHSIIM-LYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFT 331
             F+   ++M+ M V      ++M ++I+      F      IS  II++++  I+ ++   
Sbjct:     2 FMMMMMVMLMMMVAVVVMVVMMVMFIMIMLIVVFTITVFFISTTIIVFVIFLIVILI--- 58

Query:   332 KIVIIIFKKDIIXLI*SHNIIIL-VNILNILFMNIFIANVVISIIFG*INWFLIYISI 502
              I+ I F   I  +I S  ++++ V ++++ F+ IFI  +++  IF  ++ F++ I I
Sbjct:    59 -ILAIFFGVTIFLIIFSMTMLVIPVLVVSVFFVTIFIIAILLVTIFV-VSVFVVTIFI 114

 Score = 84 (29.6 bits), Expect = 1.9, P = 0.85
 Identities = 21/136 (15%), Positives = 66/136 (48%), Frame = +2

Query:    59 VIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYIIEA 238
             ++ A + + ++++ + +   I+ F        FI   II+  +F+      II+      
Sbjct:    12 MMVAVVVMVVMMVMFIMIMLIVVFTITVF---FISTTIIVFVIFLIVIL--IILAIFFGV 66

Query:   239 T*FFFIFFF-ILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI*SHNIIILVNILN 415
             T F  IF   +L+   +++ +    +++++   + I +    ++ +     +++ + +++
Sbjct:    67 TIFLIIFSMTMLVIPVLVVSVFFVTIFIIAILLVTIFVVSVFVVTIFIIAVLLVTIFVIS 126

Query:   416 ILFMNIFIANVVISIIF 466
             IL + IF+ ++++  +F
Sbjct:   127 ILLVTIFVVSILVVTLF 143


>sp|P40467|YIN0_YEAST PUTATIVE 108.8 KD TRANSCRIPTIONAL REGULATORY PROTEIN IN
            FKH1-STH1 INTERGENIC REGION >pir||S48404 probable membrane protein
            YIL130w - yeast (Saccharomyces cerevisiae) >gi|557793 (Z38059) orf,
            len: 964, CAI: 0.15, possible regulatory protein [Saccharomyces
            cerevisiae] >gi|763216 (Z47047) unknown [Saccharomyces cerevisiae]
            Length = 964

  Minus Strand HSPs:

 Score = 119 (41.9 bits), Expect = 0.00015, P = 0.00015
 Identities = 46/167 (27%), Positives = 75/167 (44%), Frame = -2

Query:   502 NTYVDEEPIDSTK-----NNRNDNISNK----NVHKKDIQ-NINQNNNIVGSDQXDDIFF 353
             NT + E P++  +     +    N+SN+    N    DI+ + N  +NI+  D  DD+F 
Sbjct:   734 NTPISENPLNEAQQQDQVSQGTTNMSNERDPNNFLSIDIRLDNNGQSNIL--DATDDVFI 791

Query:   352 KNNND-NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH 176
             +N+ D       D  +   N  NN+  D     Y   S G NN  ++N   +  + H ++
Sbjct:   792 RNDGDIPTNSAFDFSSSKSNASNNSNPDTINNNYNNVS-GKNN-NNNNITNNSNNNHNNN 849

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERY 20
             NN   N    + +    NN   N   NNN+  + K  N+  I ++ NN   Y
Sbjct:   850 NNDNNNNNNNNNNNNNNNNNSGNSSNNNNNNNNNKNNNDFGIKID-NNSPSY 900

 Score = 111 (39.1 bits), Expect = 0.0025, P = 0.0025
 Identities = 43/150 (28%), Positives = 69/150 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             S+K N   +  P D+  NN N N+S KN +  +I N N NNN   ++  D+    NNN+N
Sbjct:   807 SSKSNASNNSNP-DTINNNYN-NVSGKNNNNNNITN-NSNNNH-NNNNNDN---NNNNNN 859

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
                  +  N   N  NN   + N K     ++ F  I+ DN   SP  +      +P+++
Sbjct:   860 NNNNNNNNNNSGNSSNNNNNNNNNKN----NNDFG-IKIDNN--SPSYEGFPQLQIPLSQ 912

Query:   154 WPGDAHEKE--LNNIFVNKIKNNNDAQSYKGI 65
                +  +KE    NI +   +N  D+    G+
Sbjct:   913 DNLNIEDKEEMSPNIEIKNEQNMTDSNDILGV 944

 Score = 94 (33.1 bits), Expect = 0.37, P = 0.31
 Identities = 30/112 (26%), Positives = 50/112 (44%), Frame = -2

Query:   472 STKNNRNDNISNK--NVHKK---DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             S KNN N+NI+N   N H     D  N N NNN   ++  +     NNN+N    ++  +
Sbjct:   829 SGKNNNNNNITNNSNNNHNNNNNDNNNNNNNNNNNNNNNNNSGNSSNNNNNNNNNKNNND 888

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFN-NIQHDNTMKSPVDKHMDHNNVPINE 155
                 + NN+P+ +   + +   S  N NI+    M   ++   + N    N+
Sbjct:   889 FGIKIDNNSPSYEGFPQLQIPLSQDNLNIEDKEEMSPNIEIKNEQNMTDSND 940

 Score = 83 (29.2 bits), Expect = 7.4, P = 1.0
 Identities = 38/142 (26%), Positives = 63/142 (44%), Frame = -2

Query:   457 RND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             RND +I   +         N +NN       D I   NNN N   G++  N ++N+ NN+
Sbjct:   792 RNDGDIPTNSAFDFSSSKSNASNN----SNPDTI---NNNYNNVSGKN--NNNNNITNNS 842

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKI 101
               + N    +  ++  NN  ++N   +  +   ++NN        + + K  NN F  KI
Sbjct:   843 NNNHNNNNNDNNNNNNNNNNNNNNNNNSGNSSNNNNN--------NNNNKN-NNDFGIKI 893

Query:   100 KNNNDAQSYKGINNKTIFLEENN 32
              NN+   SY+G     I L ++N
Sbjct:   894 DNNSP--SYEGFPQLQIPLSQDN 914

 Score = 82 (28.9 bits), Expect = 9.7, P = 1.0
 Identities = 30/106 (28%), Positives = 51/106 (48%), Frame = -2

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NNN N   G++  N ++N+ NN+  + N    +  ++  NN  ++N   +  +   ++NN
Sbjct:   822 NNNYNNVSGKN--NNNNNITNNSNNNHNNNNNDNNNNNNNNNNNNNNNNNSGNSSNNNNN 879

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
                N      + K  NN F  KI NN+   SY+G     I L ++N
Sbjct:   880 ---NN-----NNKN-NNDFGIKIDNNSP--SYEGFPQLQIPLSQDN 914

 Score = 82 (28.9 bits), Expect = 9.7, P = 1.0
 Identities = 30/108 (27%), Positives = 47/108 (43%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +  NN N +  N N +    +N N NNNI  +   +     NNN+N     D  N ++N 
Sbjct:   811 NASNNSNPDTINNNYNNVSGKN-NNNNNITNNSNNNH----NNNNN-----DNNNNNNNN 860

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE-WP 149
              NN   + N       ++  NN +++N     +D     NN P  E +P
Sbjct:   861 NNNNNNNNNSGNSSNNNNNNNNNKNNNDFGIKID-----NNSPSYEGFP 904


>gi|2149437 (U85963) asparigine-rich protein [Plasmodium falciparum]
            Length = 624

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00020, P = 0.00020
 Identities = 48/165 (29%), Positives = 81/165 (49%), Frame = -2

Query:   493 VDEEPIDSTK-NNRNDNISN-KNVHKKDIQN----INQNNNIVGSDQXDDIFFKNNNDNF 332
             +DE  I++   + +ND ++N +NV   +I N    IN NNN + ++  ++    NNN+N 
Sbjct:   269 MDETLIENIDIHEKNDEVNNFENVKGNNINNNNNNINNNNNNINNNNNNNN--NNNNNNN 326

Query:   331 GEGQDIQNI-HHNVYNNTPTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
                  + NI H+NV  N   + N  +  Y+      NNI ++N   + +    ++N +  
Sbjct:   327 NNNNSLVNILHNNVSENILLNDNMLDDLYQNGKYKKNNIINNNVNNNEL---FNNNIISY 383

Query:   160 NEWPGDAH---EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             N   G  +   E   +NI  N   NNN+    K +N   +F E         +NEK
Sbjct:   384 NN-NGQVYVNQESGTSNIINNN--NNNNIFELKKLN---LFAERKKKGDKEIDNEK 433

 Score = 111 (39.1 bits), Expect = 0.0015, P = 0.0015
 Identities = 53/166 (31%), Positives = 79/166 (47%), Frame = -2

Query:   505 GN-TYVDEEPIDSTKNNRND--NISNKNVHKKDIQNINQNNN-------IVGSDQXDDIF 356
             GN  +VD+    +  NN N+  NI+N N +  +   +N  NN       IV S+   ++ 
Sbjct:   161 GNINHVDKMNNMNNINNINNMNNINNMN-NMNNYNTLNVLNNEKEGVRTIVMSELSSEMI 219

Query:   355 FKNNNDNFGEGQDIQNIHHNV-YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
                NN N G   D   ++ NV YNN  TD      +   +   N + +N  +S +D+ + 
Sbjct:   220 M-GNNKNVG---DANMVNSNVNYNNISTDNYANILKHLCTPVKNKKIENVCES-MDETLI 274

Query:   178 HNNVPINEWPGDAHEK--ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              N         D HEK  E+NN F N +K NN   +   INN    +  NN+   N  N
Sbjct:   275 ENI--------DIHEKNDEVNN-FEN-VKGNNINNNNNNINNNNNNINNNNNNNNNNNN 323

 Score = 107 (37.7 bits), Expect = 0.0050, P = 0.0050
 Identities = 40/150 (26%), Positives = 71/150 (47%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N  +N+   N++  +  NIN NNN + ++  ++    NNN+N      +  +H+NV  N 
Sbjct:   287 NNFENVKGNNINNNN-NNINNNNNNINNNNNNNNNNNNNNNN-NNNSLVNILHNNVSENI 344

Query:   280 PTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKH--MDHNN---VPINEWPGDAH---EK 131
               + N  +  Y+      NNI ++N   + +  +  + +NN   V +N+  G ++     
Sbjct:   345 LLNDNMLDDLYQNGKYKKNNIINNNVNNNELFNNNIISYNNNGQVYVNQESGTSNIINNN 404

Query:   130 ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
               NNIF  K  N    +  KG  +K I  E+  D
Sbjct:   405 NNNNIFELKKLNLFAERKKKG--DKEIDNEKKKD 436

 Score = 103 (36.3 bits), Expect = 0.017, P = 0.017
 Identities = 31/106 (29%), Positives = 56/106 (52%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNN---NIVGSDQX-DDIFFKN 347
             +N  N   +   I++  NN N+N +N N +   + NI  NN   NI+ +D   DD++   
Sbjct:   299 NNNNNINNNNNNINNNNNNNNNNNNNNNNNNNSLVNILHNNVSENILLNDNMLDDLY--- 355

Query:   346 NNDNFGEGQDIQN-IHHN-VYNNT--PTDQNKKEYEEESSGFNNIQHDN 212
              N  + +   I N +++N ++NN     + N + Y  + SG +NI ++N
Sbjct:   356 QNGKYKKNNIINNNVNNNELFNNNIISYNNNGQVYVNQESGTSNIINNN 404

 Score = 100 (35.2 bits), Expect = 0.040, P = 0.039
 Identities = 42/145 (28%), Positives = 70/145 (48%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY-N 287
             NN N+NI+N N       NIN NNN   ++  ++    NNN+N        N+  N+  N
Sbjct:   298 NNNNNNINNNN------NNINNNNNNNNNNNNNN----NNNNNSLVNILHNNVSENILLN 347

Query:   286 NTPTD---QNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH---EKEL 125
             +   D   QN K Y++ +   NN+ ++    + +  + ++  V +N+  G ++       
Sbjct:   348 DNMLDDLYQNGK-YKKNNIINNNVNNNELFNNNIISYNNNGQVYVNQESGTSNIINNNNN 406

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
             NNIF  K  N    +  KG  +K I  E+  D
Sbjct:   407 NNIFELKKLNLFAERKKKG--DKEIDNEKKKD 436

 Score = 98 (34.5 bits), Expect = 0.072, P = 0.069
 Identities = 48/162 (29%), Positives = 76/162 (46%), Frame = -2

Query:   490 DEEPIDSTKNNRN---DNISN--KN----VHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             D   ++S  N  N   DN +N  K+    V  K I+N+ ++ +    +  D I  KN+  
Sbjct:   228 DANMVNSNVNYNNISTDNYANILKHLCTPVKNKKIENVCESMDETLIENID-IHEKNDEV 286

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             N  E     NI++N  NN   + N       ++  NN  ++N   S V+  + HNNV  N
Sbjct:   287 NNFENVKGNNINNN-NNNINNNNNNINNNNNNNNNNNNNNNNNNNSLVN--ILHNNVSEN 343

Query:   157 EWPGDAHEKELNNIFVN-KIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
                 D     L++++ N K K NN   +   +NN  +F   NN   YN   +
Sbjct:   344 ILLND---NMLDDLYQNGKYKKNNIINN--NVNNNELF--NNNIISYNNNGQ 388

 Score = 97 (34.1 bits), Expect = 0.094, P = 0.090
 Identities = 44/168 (26%), Positives = 79/168 (47%), Frame = -2

Query:   490 DEEPIDSTKNNRN---DNISN--KN----VHKKDIQNINQNNNIVGSDQXDDIFFKNNN- 341
             D   ++S  N  N   DN +N  K+    V  K I+N+ ++ +    +  D I  KN+  
Sbjct:   228 DANMVNSNVNYNNISTDNYANILKHLCTPVKNKKIENVCESMDETLIENID-IHEKNDEV 286

Query:   340 DNFG--EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             +NF   +G +I N ++N+ NN     N       ++  NN  ++N++ + +  ++  N +
Sbjct:   287 NNFENVKGNNINNNNNNINNNNNNINNNNNNNNNNNNNNN-NNNNSLVNILHNNVSENIL 345

Query:   166 PINEWPGDAHEK---ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               +    D ++    + NNI  N + NNN+       NN  I    N     NQE+
Sbjct:   346 LNDNMLDDLYQNGKYKKNNIINNNV-NNNEL-----FNNNIISYNNNGQVYVNQES 395

 Score = 95 (33.4 bits), Expect = 0.17, P = 0.15
 Identities = 31/105 (29%), Positives = 54/105 (51%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNN-----IVGSDQXDDIFFKNN--NDNFGEGQDIQN- 308
             NN N+NI+N N +  +  N N NNN     I+ ++  ++I   +N  +D +  G+  +N 
Sbjct:   305 NNNNNNINNNNNNNNNNNNNNNNNNNSLVNILHNNVSENILLNDNMLDDLYQNGKYKKNN 364

Query:   307 -IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
              I++NV NN   + N   Y      + N Q   T  S +  + ++NN+
Sbjct:   365 IINNNVNNNELFNNNIISYNNNGQVYVN-QESGT--SNIINNNNNNNI 409

 Score = 90 (31.7 bits), Expect = 0.67, P = 0.49
 Identities = 39/157 (24%), Positives = 75/157 (47%), Frame = -2

Query:   499 TYVDEEPIDSTKNNRNDN-ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             T V  + I++   + ++  I N ++H+K+   +N   N+ G++        NNN+N    
Sbjct:   255 TPVKNKKIENVCESMDETLIENIDIHEKN-DEVNNFENVKGNN------INNNNNNINNN 307

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPV--DKHMD--HNNVPINE 155
              +  NI++N  NN   + N       ++   NI H+N  ++ +  D  +D  + N    +
Sbjct:   308 NN--NINNNNNNNNNNNNNNNN---NNNSLVNILHNNVSENILLNDNMLDDLYQNGKYKK 362

Query:   154 WPGDAHEKELNN--IFVNKIKN-NNDAQSYKGINNKTIFLEENND 29
                +     +NN  +F N I + NN+ Q Y    + T  +  NN+
Sbjct:   363 --NNIINNNVNNNELFNNNIISYNNNGQVYVNQESGTSNIINNNN 405

 Score = 89 (31.3 bits), Expect = 0.87, P = 0.58
 Identities = 47/160 (29%), Positives = 75/160 (46%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N  D ++N N    +I NIN  NNI   +  ++    N  +N  EG  ++ I  +  ++ 
Sbjct:   164 NHVDKMNNMN----NINNINNMNNINNMNNMNNYNTLNVLNNEKEG--VRTIVMSELSSE 217

Query:   280 PTDQNKKEYEEESS-----GFNNIQHDN---TMK---SPV-DKHMDHNNVPINEW---PG 146
                 N K   + +       +NNI  DN    +K   +PV +K +++    ++E      
Sbjct:   218 MIMGNNKNVGDANMVNSNVNYNNISTDNYANILKHLCTPVKNKKIENVCESMDETLIENI 277

Query:   145 DAHEK--ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             D HEK  E+NN F N +K NN   +   INN    +  NN+   N  N
Sbjct:   278 DIHEKNDEVNN-FEN-VKGNNINNNNNNINNNNNNINNNNNNNNNNNN 323

 Score = 87 (30.6 bits), Expect = 1.5, P = 0.78
 Identities = 44/158 (27%), Positives = 69/158 (43%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVH--KKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             D   N    ++ N +V+  +K I NIN  + +   +  ++I   NN +N     ++ N +
Sbjct:   138 DVVTNGNTMSLFNNSVNFLRKKIGNINHVDKMNNMNNINNI---NNMNNINNMNNMNNYN 194

Query:   301 H-NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
               NV NN           E SS    I  +N  K+  D +M ++NV  N    D +   L
Sbjct:   195 TLNVLNNEKEGVRTIVMSELSSEM--IMGNN--KNVGDANMVNSNVNYNNISTDNYANIL 250

Query:   124 NNIF--VNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              ++   V   K  N  +S      + I + E NDE  N EN K
Sbjct:   251 KHLCTPVKNKKIENVCESMDETLIENIDIHEKNDEVNNFENVK 293


>gi|1762998 (U67260) RING-finger protein [Helicoverpa armigera
            nucleopolyhedrovirus]
            Length = 357

  Minus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.00024, P = 0.00024
 Identities = 39/143 (27%), Positives = 75/143 (52%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKN--NRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN 344
             S   NT VD++  D   +  N ND+++ N +V+  D+ ++N N   V SD  + I    N
Sbjct:   171 SVNNNTNVDDQNNDDDDDDVNDNDDVNDNDDVNDDDVNDVNTN---VNSD--NQITNTTN 225

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFN-NIQH----DNTMKSPVDKHMD 179
             +++     ++ N + NV  N   D N  + +  +S  N N+QH    DN + + V +   
Sbjct:   226 DNDTNVDANVCNTNANVDTNANVDTNADDDDVANSAANDNVQHTVDSDNNVNNNVSQ-TS 284

Query:   178 HNNVPINEWPGDA-HEKELNNIFVNKIKN 95
             H+N+  N+   ++ ++ + N++  + I N
Sbjct:   285 HDNINSNQVNNNSKNDNDKNSVDDDDISN 313

 Score = 100 (35.2 bits), Expect = 0.018, P = 0.018
 Identities = 39/147 (26%), Positives = 68/147 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N   T VD    D++ NN N N+ ++N +  D  ++N N+++  +D  +D    + N N
Sbjct:   159 NNDIETTVDN---DASVNN-NTNVDDQN-NDDDDDDVNDNDDVNDNDDVNDDDVNDVNTN 213

Query:   334 FGEGQDIQNIHHNVYNNTPTDQN----KKEYEEESSGFNNIQHDNTMKSPVDKHMDH--- 176
                   I N  ++  N+T  D N        +  ++   N   D+   S  + ++ H   
Sbjct:   214 VNSDNQITNTTND--NDTNVDANVCNTNANVDTNANVDTNADDDDVANSAANDNVQHTVD 271

Query:   175 --NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQS 77
               NNV  N     +H+   +N   N  KN+ND  S
Sbjct:   272 SDNNVN-NNVSQTSHDNINSNQVNNNSKNDNDKNS 305

 Score = 97 (34.1 bits), Expect = 0.043, P = 0.042
 Identities = 40/142 (28%), Positives = 65/142 (45%), Frame = -2

Query:   511 NKGNTYVDEE-PIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             N  NT V+ +  I +T N+ + N+ + NV   +  N++ N N+  +   DD+     NDN
Sbjct:   208 NDVNTNVNSDNQITNTTNDNDTNV-DANVCNTNA-NVDTNANVDTNADDDDVANSAANDN 265

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
                  D  N   NV NN    Q   +    +   NN ++DN   S  D  + + ++PI  
Sbjct:   266 VQHTVDSDN---NVNNNV--SQTSHDNINSNQVNNNSKNDNDKNSVDDDDISNLSLPIVN 320

Query:   154 WPG------DAH-EKELNNIFVNKIKNNN 89
                      D H +   +N+F +   NNN
Sbjct:   321 ITNLSRTVIDNHCDNASDNVFPSSNSNNN 349

 Score = 93 (32.7 bits), Expect = 0.13, P = 0.12
 Identities = 34/132 (25%), Positives = 59/132 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKN-NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +N  +T VD    ++  N + N N+   N    D+ N   N+N+  +   D+    N N+
Sbjct:   224 TNDNDTNVDANVCNTNANVDTNANVDT-NADDDDVANSAANDNVQHTVDSDN----NVNN 278

Query:   337 NFGEGQDIQNIHHN-VYNNTPTDQNKKEYEEES-SGFNN--IQHDNTMKSPVDKHMDHNN 170
             N  +     NI+ N V NN+  D +K   +++  S  +   +   N  ++ +D H D  N
Sbjct:   279 NVSQTSH-DNINSNQVNNNSKNDNDKNSVDDDDISNLSLPIVNITNLSRTVIDNHCD--N 335

Query:   169 VPINEWPGDAHEKELNN 119
                N +P        NN
Sbjct:   336 ASDNVFPSSNSNNNSNN 352

 Score = 93 (32.7 bits), Expect = 0.13, P = 0.12
 Identities = 38/163 (23%), Positives = 69/163 (42%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQ-------NINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             D+T +N +    N N    DI+       ++N N N+   +  DD    N+ND+  +  D
Sbjct:   142 DATIHNEDTAELNTNTVNNDIETTVDNDASVNNNTNVDDQNNDDDDDDVNDNDDVNDNDD 201

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFN---NIQHDNT---MKSPVDKHMDHNNVPINE 155
             + +   N  N      N+       +  N   N+ + N      + VD + D ++V  N 
Sbjct:   202 VNDDDVNDVNTNVNSDNQITNTTNDNDTNVDANVCNTNANVDTNANVDTNADDDDVA-NS 260

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                D  +  +++   N + NN    S+  IN+  +    NN +  N +N
Sbjct:   261 AANDNVQHTVDSD--NNVNNNVSQTSHDNINSNQV---NNNSKNDNDKN 304

 Score = 91 (32.0 bits), Expect = 0.23, P = 0.21
 Identities = 34/165 (20%), Positives = 71/165 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNND 338
             N  N   D    +   ++ N N  +  +H +D   +N N  NN + +   +D    NNN 
Sbjct:   118 NNSNNNDDNNSTNDNDDDNNSNCDDATIHNEDTAELNTNTVNNDIETTVDNDASV-NNNT 176

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFN-NIQHDNTMKSPVDKHMDHNNVPI 161
             N  + Q+  +   +V +N   + N    +++ +  N N+  DN + +  + +    NV  
Sbjct:   177 NVDD-QNNDDDDDDVNDNDDVNDNDDVNDDDVNDVNTNVNSDNQITNTTNDN--DTNVDA 233

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N    +A+     N+  N   +++D  +    +N    ++ +N+   N
Sbjct:   234 NVCNTNANVDTNANVDTNA--DDDDVANSAANDNVQHTVDSDNNVNNN 279

 Score = 85 (29.9 bits), Expect = 1.2, P = 0.71
 Identities = 30/141 (21%), Positives = 67/141 (47%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKK--DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             S +N+ +DN S+  V+ +  D+ N N N++   ++  DD    N +D     +D   ++ 
Sbjct:    97 SDRNSDSDN-SDSEVYDEIVDVNNSNNNDDNNSTNDNDDDNNSNCDDATIHNEDTAELNT 155

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             N  NN      +   + ++S  NN   D+      D  ++ N+  +N+   D ++ ++N+
Sbjct:   156 NTVNN----DIETTVDNDASVNNNTNVDDQNNDDDDDDVNDND-DVND-NDDVNDDDVND 209

Query:   118 IFVNKIKNNNDAQSYKGINNKTI 50
             +  N + ++N   +    N+  +
Sbjct:   210 VNTN-VNSDNQITNTTNDNDTNV 231

 Score = 80 (28.2 bits), Expect = 4.8, P = 0.99
 Identities = 30/132 (22%), Positives = 55/132 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKN-NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +N  +T VD    ++  N + N N+   N    D+ N   N+N+  +   D+    NNN 
Sbjct:   224 TNDNDTNVDANVCNTNANVDTNANVDT-NADDDDVANSAANDNVQHTVDSDNNV--NNNV 280

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESS-GFNNIQHDNTMKSPVDKHMDHNNVPI 161
             +     +I +   N  +    D+N  + ++ S+     +   N  ++ +D H D  N   
Sbjct:   281 SQTSHDNINSNQVNNNSKNDNDKNSVDDDDISNLSLPIVNITNLSRTVIDNHCD--NASD 338

Query:   160 NEWPGDAHEKELNN 119
             N +P        NN
Sbjct:   339 NVFPSSNSNNNSNN 352


>gi|1685115 (U68754) putative transcription factor [Dictyostelium discoideum]
            Length = 872

  Minus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.00027, Sum P(2) = 0.00027
 Identities = 40/152 (26%), Positives = 65/152 (42%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +NK N   +   I    NN  +NI N N +  +  N N NNN   S    ++   NNN+N
Sbjct:    68 NNKNNNKSNLLDIILDNNNLENNIDNNNNNNNNNNNNNNNNNNNNSKSIINLIDNNNNNN 127

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEES--SGFNNIQHDNTMKSPVD-KHMDHNNVP 164
               +  +  N ++N+    P D    +   ES   GF  +      + P+D          
Sbjct:   128 --KNNNNNNNNNNILK-IPIDYTPVDKNTESIFKGF--LPFSFKQQQPIDTSDQQQKETK 182

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
               +   +++ K  NNI +N   NNN+  + +  NN
Sbjct:   183 KLQLNINSNNKNNNNI-INNSNNNNNINNIESNNN 216

 Score = 112 (39.4 bits), Expect = 0.0017, P = 0.0017
 Identities = 44/168 (26%), Positives = 79/168 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTK----NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN 347
             +N  N  +   P++S +    +N N+N +NKN +K ++ +I  +NN +  +  D+    N
Sbjct:    42 NNNNNKIIS--PLNSNRQQPNSNTNNNSNNKNNNKSNLLDIILDNNNL-ENNIDNNNNNN 98

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH--- 176
             NN+N     +  N   ++ N    + N  +    ++  NNI       +PVDK+ +    
Sbjct:    99 NNNNNNNNNNNNNNSKSIINLIDNNNNNNKNNNNNNNNNNILKIPIDYTPVDKNTESIFK 158

Query:   175 NNVPIN---EWP---GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
               +P +   + P    D  +KE   + +N I +NN        NN  I    NN+   N
Sbjct:   159 GFLPFSFKQQQPIDTSDQQQKETKKLQLN-INSNNK-------NNNNIINNSNNNNNIN 209

 Score = 107 (37.7 bits), Expect = 0.0076, P = 0.0076
 Identities = 39/135 (28%), Positives = 62/135 (45%), Frame = -2

Query:   412 QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGF 233
             Q I QNN  + ++  ++    NNN+NF     I ++ +N  N   +  N    +  S+  
Sbjct:    10 QQIKQNN--INNNNNNNNNNSNNNNNF---DPITSLTNNNNNKIISPLNSNRQQPNSNTN 64

Query:   232 NNIQHDNTMKSPV-DKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNK 56
             NN  + N  KS + D  +D+NN+  N    D +    NN   N   NNN+  + K I N 
Sbjct:    65 NNSNNKNNNKSNLLDIILDNNNLENNI---DNNNNNNNNN--NNNNNNNNNNNSKSIIN- 118

Query:    55 TIFLEENNDERYNQEN 8
                ++ NN+   N  N
Sbjct:   119 --LIDNNNNNNKNNNN 132

 Score = 107 (37.7 bits), Expect = 0.0076, P = 0.0076
 Identities = 46/168 (27%), Positives = 79/168 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDS-TKNNRNDNISNKNVHKKDIQ-NINQNNNIVGSDQXD--DIFFKN 347
             SN  N +   +PI S T NN N  IS  N +++    N N N+N   +++ +  DI   N
Sbjct:    28 SNNNNNF---DPITSLTNNNNNKIISPLNSNRQQPNSNTNNNSNNKNNNKSNLLDIILDN 84

Query:   346 NN-DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NN +N     +I N ++N  NN   + N      +S   N I ++N      + + ++NN
Sbjct:    85 NNLEN-----NIDNNNNNNNNNNNNNNNNNNNNSKSI-INLIDNNNNNNKNNNNNNNNNN 138

Query:   169 V---PINEWPGDAHEKELNNIFVN-KIKNNN--DAQSYKGINNKTIFLEENNDERYN 17
             +   PI+  P D + + +   F+    K     D    +    K + L  N++ + N
Sbjct:   139 ILKIPIDYTPVDKNTESIFKGFLPFSFKQQQPIDTSDQQQKETKKLQLNINSNNKNN 195

 Score = 103 (36.3 bits), Expect = 0.026, P = 0.025
 Identities = 36/135 (26%), Positives = 62/135 (45%), Frame = -2

Query:   412 QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGF 233
             Q I QNN  + ++  ++    NNN+NF     I ++ +N  N   +  N    +  S+  
Sbjct:    10 QQIKQNN--INNNNNNNNNNSNNNNNF---DPITSLTNNNNNKIISPLNSNRQQPNSNTN 64

Query:   232 NNIQHDNTMKSPV-DKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNK 56
             NN  + N  KS + D  +D+NN+  N    + +    NN   N   NNN+++S   + + 
Sbjct:    65 NNSNNKNNNKSNLLDIILDNNNLENNIDNNNNNNNNNNNN--NNNNNNNNSKSIINLIDN 122

Query:    55 TIFLEENNDERYNQEN 8
                  +NN+   N  N
Sbjct:   123 NNNNNKNNNNNNNNNN 138

 Score = 98 (34.5 bits), Expect = 0.11, P = 0.10
 Identities = 45/172 (26%), Positives = 79/172 (45%), Frame = -2

Query:   514 SNKGNTYVDEE---PI-DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN 347
             S +GN Y +E+   P  D  + N N+N +N  ++  +  N N NNN   +   +  +  N
Sbjct:   586 SKEGNYYQEEDGAVPYWDMNRYNNNNN-NNNGINNNNNNNNNNNNN---NSNNNGSYNNN 641

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH--N 173
             N++N      I+ I +N  NN  +  N       +S  NN  +  +  +P+ + + H   
Sbjct:   642 NSNNNNNNNRIEPIVNNNINNFNSINNN------NSNNNNNNNSTSQNAPLLQRLIHVVE 695

Query:   172 NVPI--NEWPGDAHEKEL--NNIFVNKIKNNNDAQSYKG-INNKTIFLEENNDERYNQE- 11
             N  +  NE      + ++  N++ + K K        K   NN    L+ N ++  NQ  
Sbjct:   696 NQLLEPNELSSIREDIDIMKNDLILRKKKRIAQLNDLKQKANNDVQILKANIEKGSNQRS 755

Query:    10 NE 5
             NE
Sbjct:   756 NE 757

 Score = 91 (32.0 bits), Expect = 0.53, Sum P(2) = 0.41
 Identities = 30/129 (23%), Positives = 55/129 (42%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQN 266
             I   N++     N N NNN   ++  D I    NN+N      + +      +NT  + N
Sbjct:    12 IKQNNINNN---NNNNNNNSNNNNNFDPITSLTNNNNNKIISPLNSNRQQPNSNTNNNSN 68

Query:   265 KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNND 86
              K    +S+  + I  +N +++ +D + ++NN   N    + +    +   +N I NNN+
Sbjct:    69 NKN-NNKSNLLDIILDNNNLENNIDNNNNNNNNNNNN--NNNNNNNNSKSIINLIDNNNN 125

Query:    85 AQSYKGINN 59
                    NN
Sbjct:   126 NNKNNNNNN 134

 Score = 89 (31.3 bits), Expect = 0.95, Sum P(2) = 0.61
 Identities = 32/132 (24%), Positives = 58/132 (43%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQN 266
             I   N++     N N NNN   ++  D I    NN+N      + +      +NT  + N
Sbjct:    12 IKQNNINNN---NNNNNNNSNNNNNFDPITSLTNNNNNKIISPLNSNRQQPNSNTNNNSN 68

Query:   265 KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE--KELNNIFVNKIKNN 92
              K    +S+  + I  +N +++ +D + ++NN   N    + +   K + N+  N   NN
Sbjct:    69 NKN-NNKSNLLDIILDNNNLENNIDNNNNNNNNNNNNNNNNNNNNSKSIINLIDNN--NN 125

Query:    91 NDAQSYKGINNKTI 50
             N+  +    NN  I
Sbjct:   126 NNKNNNNNNNNNNI 139

 Score = 85 (29.9 bits), Expect = 3.8, P = 0.98
 Identities = 37/134 (27%), Positives = 62/134 (46%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +  NN N+N +N N +     N N +NN   +++ + I   NN +NF    +  N  +N 
Sbjct:   618 NNNNNNNNNNNNNNSNNNGSYNNNNSNNNNNNNRIEPIV-NNNINNFNSINN--NNSNNN 674

Query:   292 YNNTPTDQNKKEYEEESSGFNN-IQHDNTMKSPVDKHMD--HNNVPINEWPGDAHEKELN 122
              NN  T QN    +       N +   N + S + + +D   N++ + +    A   +LN
Sbjct:   675 NNNNSTSQNAPLLQRLIHVVENQLLEPNELSS-IREDIDIMKNDLILRKKKRIA---QLN 730

Query:   121 NIFVNKIKNNNDAQSYK 71
             ++   K K NND Q  K
Sbjct:   731 DL---KQKANNDVQILK 744

 Score = 84 (29.6 bits), Expect = 0.25, Sum P(2) = 0.22
 Identities = 35/128 (27%), Positives = 62/128 (48%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNN--IVG----SDQXDDIFFKNNNDNF 332
             + +  I++  NN N+N SN N +   I ++  NNN  I+     + Q  +    NN++N 
Sbjct:    12 IKQNNINNNNNNNNNN-SNNNNNFDPITSLTNNNNNKIISPLNSNRQQPNSNTNNNSNNK 70

Query:   331 GEGQ----DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
                +    DI   ++N+ NN   + N       ++  NN   +N  KS ++  +D+NN  
Sbjct:    71 NNNKSNLLDIILDNNNLENNIDNNNNNNNNNNNNNNNNN---NNNSKSIINL-IDNNN-- 124

Query:   163 INEWPGDAHEKELNNI 116
              N    + +    NNI
Sbjct:   125 -NNNKNNNNNNNNNNI 139

 Score = 84 (29.6 bits), Expect = 5.1, P = 0.99
 Identities = 41/158 (25%), Positives = 70/158 (44%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +  NN N+N +N N +     N N +NN   +++ + I   NN +NF    +  N  +N 
Sbjct:   618 NNNNNNNNNNNNNNSNNNGSYNNNNSNNNNNNNRIEPIV-NNNINNFNSINN--NNSNNN 674

Query:   292 YNNTPTDQNKKEYEEESSGFNN-IQHDNTMKSPVDKHMD--HNNVPINEWPGDAHEKELN 122
              NN  T QN    +       N +   N + S + + +D   N++ + +    A   +L 
Sbjct:   675 NNNNSTSQNAPLLQRLIHVVENQLLEPNELSS-IREDIDIMKNDLILRKKKRIAQLNDLK 733

Query:   121 ---NIFVNKIKNNNDAQSYKGINNKTIF---LEENNDERYNQ 14
                N  V  +K N +  S +  N    F   L++  D+R NQ
Sbjct:   734 QKANNDVQILKANIEKGSNQRSNETKSFITELKQEIDKRINQ 775

 Score = 82 (28.9 bits), Expect = 8.6, P = 1.0
 Identities = 25/103 (24%), Positives = 46/103 (44%), Frame = -2

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEK 131
             NI++N  NN     N   ++  +S  NN  ++N + SP++ +    N   N    + +  
Sbjct:    16 NINNNNNNNNNNSNNNNNFDPITSLTNN--NNNKIISPLNSNRQQPNSNTNNNSNNKNNN 73

Query:   130 ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             + N + +  I +NN+ ++    NN       NN+   N  N K
Sbjct:    74 KSNLLDI--ILDNNNLENNIDNNNNNNNNNNNNNNNNNNNNSK 114

 Score = 64 (22.5 bits), Expect = 8.7, Sum P(2) = 1.0
 Identities = 13/38 (34%), Positives = 20/38 (52%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDI 359
             ++ N  N+NI N + +  +I NI  NNN + S     I
Sbjct:   189 NSNNKNNNNIINNSNNNNNINNIESNNNNLNSASTSPI 226

 Score = 59 (20.8 bits), Expect = 8.7, Sum P(2) = 1.0
 Identities = 25/100 (25%), Positives = 40/100 (40%), Frame = -2

Query:   352 KNNNDNFGEGQD--IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             K+   N+ + +D  +     N YNN   + N       ++  NN  + N   S  + + +
Sbjct:   585 KSKEGNYYQEEDGAVPYWDMNRYNNNNNNNNGINNNNNNNNNNNNNNSNNNGSYNNNNSN 644

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKT 53
             +NN   N          +NN   N I NNN   +    NN T
Sbjct:   645 NNNN--NNRIEPIVNNNINNF--NSINNNNSNNNNN--NNST 680

 Score = 54 (19.0 bits), Expect = 9.2, Sum P(3) = 1.0
 Identities = 22/112 (19%), Positives = 43/112 (38%), Frame = -2

Query:   400 QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQ 221
             QNN+++ + Q       N +      Q  Q    +++       N+   +   + +NN  
Sbjct:   394 QNNHLILNQQTI-----NQHLQMLSKQHQQQASQSMFQQQQLHNNQHSNDSNYNSYNNNN 448

Query:   220 HDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGI 65
             ++N      + +  H  +P    P  ++    NN   N   NNN+  +Y  I
Sbjct:   449 NNNN-----NNYSQHEQLP----PISSYNSMNNNNNSNNSNNNNNNNNYSQI 491

 Score = 51 (18.0 bits), Expect = 0.25, Sum P(2) = 0.22
 Identities = 12/41 (29%), Positives = 18/41 (43%), Frame = -2

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             NN  +N   NNN+  +    NN   +   NN+   N  N +
Sbjct:   613 NNNGINNNNNNNNNNNNNNSNNNGSY--NNNNSNNNNNNNR 651

 Score = 42 (14.8 bits), Expect = 2.0, Sum P(2) = 0.86
 Identities = 11/35 (31%), Positives = 15/35 (42%), Frame = -2

Query:   127 LNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDER 23
             +NN   N   NNN+  +  G  N       NN+ R
Sbjct:   617 INNNNNNNNNNNNNNSNNNGSYNNNNSNNNNNNNR 651

 Score = 39 (13.7 bits), Expect = 0.00027, Sum P(2) = 0.00027
 Identities = 8/27 (29%), Positives = 10/27 (37%), Frame = -2

Query:    88 DAQSYKGINNKTIFLEENNDERYNQEN 8
             D   Y   NN    +  NN+   N  N
Sbjct:   603 DMNRYNNNNNNNNGINNNNNNNNNNNN 629


>sp|P14248|RPB1_PLAFD DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
            >pir||RNZQ2L DNA-directed RNA polymerase (EC 2.7.7.6) II large
            chain - Plasmodium falciparum >gi|9943 (X16561) RNA polymerase II
            large subunit (AA 1-2452) [Plasmodium falciparum]
            Length = 2452

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00029, P = 0.00029
 Identities = 41/166 (24%), Positives = 76/166 (45%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISN--KNVHKKDIQNINQ---NNNIV--GSDQXDDIFFKNNNDN 335
             ++  P+ +  +N N+N +N   N++   ++NI +   N   +  G D      F N N  
Sbjct:  1676 INSSPVSNNMHNNNNNNNNDSSNINDIKVKNIKKEDGNEGALRGGGDSNTSALFGNKNS- 1734

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM--KSPVDKHMDHNNVPI 161
                 Q   NI +N  +N   D  ++E E+   G +N+   NT   K+    +  +NN   
Sbjct:  1735 ----QKEDNIVNNNNDNNDDDDEEEEEEDFLFGDHNVSPKNTKDGKNKNTNNKSNNNENK 1790

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             N+  G+ +    N      + N+ND  +    N   I ++E+ND  + + + K
Sbjct:  1791 NKKSGNNNSNNSNTYDDGDVDNDNDDDNDD--NKSDITIKEDNDVAFMKTSTK 1841

 Score = 105 (37.0 bits), Expect = 0.044, P = 0.044
 Identities = 38/156 (24%), Positives = 70/156 (44%), Frame = -2

Query:   496 YVDEEPIDSTKNNRNDNISNK-NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ 320
             Y D+   D     R   ++ + N    D+ + N N  +   ++ ++    N+  N+ E +
Sbjct:  1568 YTDDNSEDLVLRIRVKYLNGEYNFMNYDVVD-NANEQVDEQEEDEEHLVANDRGNYDETK 1626

Query:   319 DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA 140
             +  + HH+ YNN  T+  K + +      NNI  D   K+     ++ +N   NE   + 
Sbjct:  1627 NSTHPHHD-YNNNTTNIFKSKVK------NNISSDINTKNEDSISINSSN---NEQVKNI 1676

Query:   139 HEKEL-NNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
             +   + NN+  N   NNND+ +   I  K I  E+ N+
Sbjct:  1677 NSSPVSNNMHNNNNNNNNDSSNINDIKVKNIKKEDGNE 1714

 Score = 99 (34.8 bits), Expect = 0.25, P = 0.22
 Identities = 43/152 (28%), Positives = 64/152 (42%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ-DIQNIHHNVYN 287
             +N +    NKN  K+D  NI  NNN    D  DD   +  +  FG+     +N       
Sbjct:  1723 SNTSALFGNKNSQKED--NIVNNNNDNNDD--DDEEEEEEDFLFGDHNVSPKNTKDGKNK 1778

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKS-PVDKHMDHNNVPINEWPGDAHEKELNNIFV 110
             NT    N  E + + SG NN  + NT     VD   D +N   ++   D   KE N++  
Sbjct:  1779 NTNNKSNNNENKNKKSGNNNSNNSNTYDDGDVDNDNDDDN---DDNKSDITIKEDNDVAF 1835

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              K    N  +  + + NK     E+N  R + E+
Sbjct:  1836 MKTSTKNAEEDLE-LKNKNHI--EHNISREDTED 1866

 Score = 95 (33.4 bits), Expect = 0.78, P = 0.54
 Identities = 42/153 (27%), Positives = 70/153 (45%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNI----VGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             KNN + +I+ KN   +D  +IN +NN     + S    +    NNN+N  +  +I +I  
Sbjct:  1648 KNNISSDINTKN---EDSISINSSNNEQVKNINSSPVSNNMHNNNNNNNNDSSNINDI-- 1702

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
              V N    D N+           +    N      D  +++NN   N    D  E+E + 
Sbjct:  1703 KVKNIKKEDGNEGALRGGGDSNTSALFGNKNSQKEDNIVNNNND--NNDDDDEEEEEEDF 1760

Query:   118 IFVN---KIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +F +     KN  D ++ K  NNK+     NN+E  N+++
Sbjct:  1761 LFGDHNVSPKNTKDGKN-KNTNNKS-----NNNENKNKKS 1794

 Score = 94 (33.1 bits), Expect = 1.0, P = 0.64
 Identities = 42/175 (24%), Positives = 76/175 (43%), Frame = -2

Query:   496 YVDEEPIDSTKNNRNDNISNK-NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ 320
             Y D+   D     R   ++ + N    D+ + N N  +   ++ ++    N+  N+ E +
Sbjct:  1568 YTDDNSEDLVLRIRVKYLNGEYNFMNYDVVD-NANEQVDEQEEDEEHLVANDRGNYDETK 1626

Query:   319 DIQNIHH-------NVY-----NNTPTDQNKKEYEEES-SGFNNIQHDNTMKSPVDKHMD 179
             +  + HH       N++     NN  +D N K  +  S +  NN Q  N   SPV  +M 
Sbjct:  1627 NSTHPHHDYNNNTTNIFKSKVKNNISSDINTKNEDSISINSSNNEQVKNINSSPVSNNMH 1686

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKT-IFLEENNDERYNQEN 8
             +NN   N    + ++ ++ NI   K   N  A    G +N + +F  +N+ +  N  N
Sbjct:  1687 NNNNNNNNDSSNINDIKVKNI--KKEDGNEGALRGGGDSNTSALFGNKNSQKEDNIVN 1742

 Score = 93 (32.7 bits), Expect = 1.3, P = 0.74
 Identities = 41/162 (25%), Positives = 72/162 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNI---NQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             DS   N ++N   KN++   + N    N NNN   S   +DI  KN     G    ++  
Sbjct:  1661 DSISINSSNNEQVKNINSSPVSNNMHNNNNNNNNDSSNINDIKVKNIKKEDGNEGALRGG 1720

Query:   304 HHNVYNNTPTDQNKKEYEEESS-GFNNIQHDNTMKSPVDKHM---DHNNVPINEWPG--- 146
               +  N +    NK   +E++    NN  +D+  +   ++     DHN  P N   G   
Sbjct:  1721 GDS--NTSALFGNKNSQKEDNIVNNNNDNNDDDDEEEEEEDFLFGDHNVSPKNTKDGKNK 1778

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             + + K  NN   NK   NN++ +    ++  +  + +ND+  N +N+
Sbjct:  1779 NTNNKSNNNENKNKKSGNNNSNNSNTYDDGDV--DNDNDDD-NDDNK 1822

 Score = 90 (31.7 bits), Expect = 3.1, P = 0.96
 Identities = 37/151 (24%), Positives = 72/151 (47%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKD---IQNINQ-NNNIVGSDQXDDIFFKNN--NDNFGEGQ--DIQ 311
             K   N++++N  + K D    + +N+ +  +  +D   D+   NN  ND+F +    D  
Sbjct:  1210 KEYENNDLNNMMISKGDQSPFKGMNEFHMGVADNDMGSDLGNNNNYNNDDFVDDDYVDDD 1269

Query:   310 NIHHNVYNNTPTDQNKKEYEEESS-----GFNNIQHDNTMKSPVDKHMDHNNVPINEWPG 146
             +   + Y++   D +  + +E  S     G N   + NT+K+  D++   N + +     
Sbjct:  1270 DYDDDDYDDDDYDDDDLDDDENYSDNINIGGNRKYYGNTLKNNYDENSMLNPIDVVHKVN 1329

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLE 41
             +  EK    + + +I N+ND  S +  NN TI L+
Sbjct:  1330 NFLEKL---VIIKQI-NSNDTLSVEAQNNATILLK 1360

 Score = 75 (26.4 bits), Expect = 4.8, Sum P(2) = 0.99
 Identities = 31/137 (22%), Positives = 58/137 (42%), Frame = -2

Query:   406 INQNNNI-VGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT-DQNKKEYEEESSGF 233
             IN N  I     Q   I F +NN++     +  N ++N+ N+    D+            
Sbjct:  1123 INMNRLIEYAKSQFPCIPFVSNNNSTNNNNNNNN-NNNISNSRKLMDKGNLSSTHNHKEN 1181

Query:   232 NNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKT 53
                +     K+  DK  + NN  ++E   +    +LNN+ ++K     D   +KG+N   
Sbjct:  1182 KKRRKRRRRKNKFDKFKNENNELMSEIKKEYENNDLNNMMISK----GDQSPFKGMNEFH 1237

Query:    52 IFLEEN-------NDERYNQEN 8
             + + +N       N+  YN ++
Sbjct:  1238 MGVADNDMGSDLGNNNNYNNDD 1259

 Score = 58 (20.4 bits), Expect = 4.8, Sum P(2) = 0.99
 Identities = 18/44 (40%), Positives = 22/44 (50%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVG 380
             N GN  V +  + S  NN N+N +N N       N N NNNI G
Sbjct:   694 NVGN--VQQNDMSSPNNNNNNN-NNNN------SNNNNNNNIGG 728


>pir||S23692 hypothetical protein 9 - Plasmodium falciparum
            Length = 518

  Minus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00032, P = 0.00032
 Identities = 39/148 (26%), Positives = 70/148 (47%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N+N +N N +  +  N N NNN   +D  ++   KNN++N    ++  N ++N  NN
Sbjct:   341 NNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNN-KNNDNNNNNNKNNDNNNNNNKNN 399

Query:   283 TPTDQNKKEYEEES-SGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
                + +  +YEE S     ++ H N     +   +  N++  +     + E E  N   N
Sbjct:   400 DNNNGDNVDYEENSLPRMCSVDHRNRPLPTLKFFLSDNDIVSDNNIYSSPESE--NKGKN 457

Query:   106 KIKNNNDAQSYKGINNKTIFLEENNDERY 20
             + KN   A  Y  ++N  I  ++ N++ Y
Sbjct:   458 EKKNEKQA-IYIPLDN-LIINDKKNNQNY 484

 Score = 114 (40.1 bits), Expect = 0.00043, P = 0.00043
 Identities = 43/159 (27%), Positives = 79/159 (49%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             D+  I    N  N+N +NKN       N N NNN   +D  ++   KNN++N    ++  
Sbjct:   329 DDRCIRKNMNPNNNNNNNKN-------NDNNNNNNKNNDNNNNNN-KNNDNNNNNNKNND 380

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEK 131
             N ++N  NN   + N K   + ++G N    +N++  P    +DH N P+        + 
Sbjct:   381 NNNNNNKNNDNNNNNNKN-NDNNNGDNVDYEENSL--PRMCSVDHRNRPLPTLKFFLSDN 437

Query:   130 EL---NNIFVNKIKNNNDAQSYKGINNKTIFLE-EN---NDERYNQ 14
             ++   NNI+ +  ++ N  ++ K    + I++  +N   ND++ NQ
Sbjct:   438 DIVSDNNIYSSP-ESENKGKNEKKNEKQAIYIPLDNLIINDKKNNQ 482

 Score = 111 (39.1 bits), Expect = 0.0012, P = 0.0012
 Identities = 40/148 (27%), Positives = 77/148 (52%), Frame = -2

Query:   457 RNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTP 278
             +N N +N N + K+  N N NNN   +D  ++   KNN++N    ++  N ++N  NN  
Sbjct:   335 KNMNPNNNNNNNKN--NDNNNNNNKNNDNNNNNN-KNNDNNNNNNKNNDNNNNNNKNNDN 391

Query:   277 TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL---NNIFVN 107
              + N K   + ++G N    +N++  P    +DH N P+        + ++   NNI+ +
Sbjct:   392 NNNNNKN-NDNNNGDNVDYEENSL--PRMCSVDHRNRPLPTLKFFLSDNDIVSDNNIYSS 448

Query:   106 KIKNNNDAQSYKGINNKTIFLE-EN---NDERYNQ 14
               ++ N  ++ K    + I++  +N   ND++ NQ
Sbjct:   449 P-ESENKGKNEKKNEKQAIYIPLDNLIINDKKNNQ 482

 Score = 102 (35.9 bits), Expect = 0.017, P = 0.017
 Identities = 37/143 (25%), Positives = 61/143 (42%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN-NND 338
             +N  N   ++   ++ KNN N+N +NKN    +  N N +NN   +   D+    N NND
Sbjct:   341 NNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNND 400

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGF--NNIQHDNTMKSPVDKHMDHNNVP 164
             N   G ++    +++      D   +           N+I  DN + S  +      N  
Sbjct:   401 N-NNGDNVDYEENSLPRMCSVDHRNRPLPTLKFFLSDNDIVSDNNIYSSPESENKGKNEK 459

Query:   163 INEWPGDAHEKELNNIFVNKIKNNND 86
              NE    A    L+N+ +N  KNN +
Sbjct:   460 KNE--KQAIYIPLDNLIINDKKNNQN 483


>pir||S14548 asparagine-rich protein (clone 37C3) - Plasmodium falciparum
            >gi|9853 (X17488) Plasmodium falciparum mRNA for asparagine-rich
            antigen (clone 37C3) [Plasmodium falciparum]
            Length = 1064

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00038, P = 0.00038
 Identities = 46/155 (29%), Positives = 70/155 (45%), Frame = -2

Query:   472 STKNNRNDNISN--KNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             +T NN N+NI N   +V   +   I++ N  N + +D  DD+   NNN N     +  N 
Sbjct:   821 NTYNNNNNNILNDGNSVVGNNESMIHKKNVVNCINNDVEDDLGNMNNNHNNNNNNNNNNN 880

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             ++N  NN     N        + F N +H+N   +   + +  +N  IN   G   E  L
Sbjct:   881 NNNNNNNNNNSNNNNNNNNNLNVFMN-EHNNPTNN---RGIYGSNESINN-NGLMDEGRL 935

Query:   124 NNIFV-NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             N I    K  + N+ QS     + T+    NNDE Y + N
Sbjct:   936 NFIHTAGKHVDKNNMQS----GSTTVVNVLNNDENYIKSN 971

 Score = 106 (37.3 bits), Expect = 0.013, P = 0.013
 Identities = 39/158 (24%), Positives = 74/158 (46%), Frame = -2

Query:   478 IDSTKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ--DIQ 311
             I+S  NN N+  ++ N+ V      N N   NI+ +   ++    NNN + G G   +I 
Sbjct:   758 INSCNNNSNNANSLLNRLVMSNG-SNGNTKLNIINNYNNNN----NNNSSSGGGVMVNIN 812

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQ---HDNTMKSPVDKHMDHNNVPINEWPGDA 140
             N+H+N   NT  + N     + +S   N +   H   + + ++  ++ +   +N    + 
Sbjct:   813 NVHNNDNMNTYNNNNNNILNDGNSVVGNNESMIHKKNVVNCINNDVEDDLGNMNNNHNNN 872

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNK-TIFLEENNDERYNQ 14
             +    NN   N   NNN++ +    NN   +F+ E+N+   N+
Sbjct:   873 NNNNNNNNNNNNNNNNNNSNNNNNNNNNLNVFMNEHNNPTNNR 915

 Score = 105 (37.0 bits), Expect = 0.018, P = 0.018
 Identities = 43/162 (26%), Positives = 69/162 (42%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNVHKKD--IQNINQNNNIVGSDQXDDI--FFKNNNDNFGE 326
             ++ + I +T    N N  N N +  +  +  +  +N   G+ + + I  +  NNN+N   
Sbjct:   744 INNDSIITTTTATNINSCNNNSNNANSLLNRLVMSNGSNGNTKLNIINNYNNNNNNNSSS 803

Query:   325 GQDIQ-NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             G  +  NI+ NV+NN     N   Y   +   NNI +D       ++ M H    +N   
Sbjct:   804 GGGVMVNIN-NVHNN----DNMNTYNNNN---NNILNDGNSVVGNNESMIHKKNVVNCIN 855

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              D  E +L N+  N   NNN+  +    NN       NN    N  N
Sbjct:   856 NDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNN---NNNNSNNNNNNN 898

 Score = 102 (35.9 bits), Expect = 0.043, P = 0.042
 Identities = 31/125 (24%), Positives = 56/125 (44%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIF--FKNNNDNFGEGQDIQNIHHNVYN 287
             N N NI + N H  ++ N+N N N +G +   ++   + NNN+N     +I N ++N  N
Sbjct:   134 NNNSNIHHNNHHMHNM-NLNINPNHLGHNMSHNMNHNYNNNNNNMYINNNINNNNNNNNN 192

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N  ++ N       + G + I    T+K  +         P      +  +  L+++   
Sbjct:   193 NNNSNSNNNN-NNNNIGNDVIHRKETVKVEIKGVKRGRGRPPKRKLSEESQMSLDDMEQT 251

Query:   106 KIKNNND 86
               +NNND
Sbjct:   252 LCRNNND 258

 Score = 101 (35.6 bits), Expect = 0.058, P = 0.056
 Identities = 51/189 (26%), Positives = 84/189 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNND 338
             N GN+ V     +S  + +N  N  N +V + D+ N+N N NN   ++  ++    NNN+
Sbjct:   832 NDGNSVVGNN--ESMIHKKNVVNCINNDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNNNN 888

Query:   337 NFGEGQDIQNIHHNVY---NNTPTDQNKKEY-EEESSGFNNIQHDNTMK--SPVDKHMDH 176
             N     +  N + NV+   +N PT+ N+  Y   ES   N +  +  +       KH+D 
Sbjct:   889 NNSNNNNNNNNNLNVFMNEHNNPTN-NRGIYGSNESINNNGLMDEGRLNFIHTAGKHVDK 947

Query:   175 NNVP------INEWPGDAH--EKELNNIFVNKIKNNNDAQSYKGINN---------KTIF 47
             NN+       +N    D +  +  +N   ++ +KNN++       NN         K I 
Sbjct:   948 NNMQSGSTTVVNVLNNDENYIKSNINYTNMDNMKNNDNPIDDDNPNNIVEMNLRVEKNI- 1006

Query:    46 LEENNDERYNQENE 5
             L  NNDE      E
Sbjct:  1007 LNNNNDEHIINNTE 1020

 Score = 100 (35.2 bits), Expect = 0.076, P = 0.073
 Identities = 37/157 (23%), Positives = 73/157 (46%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             + GNT ++   I++  NN N+N S+      +I N++ N+N+       + +  NNN+  
Sbjct:   781 SNGNTKLNI--INNYNNNNNNNSSSGGGVMVNINNVHNNDNM-------NTYNNNNNNIL 831

Query:   331 GEGQDIQ-NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
              +G  +  N    ++     +    + E++    NN  H+N   +  + + ++NN   N 
Sbjct:   832 NDGNSVVGNNESMIHKKNVVNCINNDVEDDLGNMNN-NHNNNNNNNNNNNNNNNNNNNNN 890

Query:   154 WPGDAHEKELNNIFVNKIKN--NNDA--QSYKGINNKTIFLE 41
                + +     N+F+N+  N  NN     S + INN  +  E
Sbjct:   891 SNNNNNNNNNLNVFMNEHNNPTNNRGIYGSNESINNNGLMDE 932

 Score = 100 (35.2 bits), Expect = 0.076, P = 0.073
 Identities = 44/168 (26%), Positives = 78/168 (46%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNND 338
             N GN+ V     +S  + +N  N  N +V + D+ N+N N NN   ++  ++    NNN+
Sbjct:   832 NDGNSVVGNN--ESMIHKKNVVNCINNDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNNNN 888

Query:   337 NFGEGQDIQNIHHNVY---NNTPTDQNKKEY-EEESSGFNNIQHDNTMK--SPVDKHMDH 176
             N     +  N + NV+   +N PT+ N+  Y   ES   N +  +  +       KH+D 
Sbjct:   889 NNSNNNNNNNNNLNVFMNEHNNPTN-NRGIYGSNESINNNGLMDEGRLNFIHTAGKHVDK 947

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             NN+      G      + N   N IK+N +  +   + N    ++++N     + N
Sbjct:   948 NNMQ----SGSTTVVNVLNNDENYIKSNINYTNMDNMKNNDNPIDDDNPNNIVEMN 999

 Score = 99 (34.8 bits), Expect = 0.10, P = 0.095
 Identities = 47/168 (27%), Positives = 79/168 (47%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNND 338
             N GN+ V     +S  + +N  N  N +V + D+ N+N N NN   ++  ++    NNN+
Sbjct:   832 NDGNSVVGNN--ESMIHKKNVVNCINNDV-EDDLGNMNNNHNNNNNNNNNNNNNNNNNNN 888

Query:   337 NFGEGQDIQNIHHNVY---NNTPTDQNKKEY-EEESSGFNNIQHDNTMK--SPVDKHMDH 176
             N     +  N + NV+   +N PT+ N+  Y   ES   N +  +  +       KH+D 
Sbjct:   889 NNSNNNNNNNNNLNVFMNEHNNPTN-NRGIYGSNESINNNGLMDEGRLNFIHTAGKHVDK 947

Query:   175 NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             NN+      G      + N   N IK+N +   Y  ++N      +NND   + +N
Sbjct:   948 NNMQ----SGSTTVVNVLNNDENYIKSNIN---YTNMDNM-----KNNDNPIDDDN 991

 Score = 99 (34.8 bits), Expect = 0.10, P = 0.095
 Identities = 39/171 (22%), Positives = 76/171 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N+    +  +  +   N  N+ ++N+  ++ + Q  NQ  N V +   + +  + NN  
Sbjct:   579 TNQMTNQMTNQMTNQMTNQVNNQMTNQMTNQVNNQMTNQMTNQVNNQMTNQMTNQMNN-- 636

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYE-EESSGFNNIQHDNTMKSPVDKHMDHN--NVP 164
                 Q    ++ ++ +      N   +    S+G N + + N + + V+ +MD+N  N  
Sbjct:   637 ----QMKNQVNSHINSQVAGHMNANMFNGNNSNGTNMLGNMNMLNNMVNSNMDNNVNNNY 692

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              N +PG  +   LNN+  + + NNN A+     N+      ENND       EK
Sbjct:   693 SNNYPGSGNNG-LNNM-TSCVMNNNGAEIDMDDNDNI----ENNDHENMMTLEK 740

 Score = 98 (34.5 bits), Expect = 0.14, P = 0.13
 Identities = 32/128 (25%), Positives = 53/128 (41%), Frame = -2

Query:   391 NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
             ++ GS +  D    N+       ++  N+H N  NN   + N  ++  +++  +NI H+N
Sbjct:    85 HVHGSRKAVDAAITNDLLRSEMEENFNNMHMNHNNNNNNNNNNNQHHHQNNN-SNIHHNN 143

Query:   211 TMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
                     HM + N+ IN  P        +N+  N   NNN+      INN       NN
Sbjct:   144 -------HHMHNMNLNIN--PNHLGHNMSHNMNHNYNNNNNNMYINNNINNNNNNNNNNN 194

Query:    31 DERYNQEN 8
             +   N  N
Sbjct:   195 NSNSNNNN 202

 Score = 95 (33.4 bits), Expect = 0.31, P = 0.27
 Identities = 42/171 (24%), Positives = 83/171 (48%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDI-FFKNNNDNFGEGQDIQ 311
             E+ + +  NN N+N +N N +  +  N N NN+   ++  +++  F N ++N    + I 
Sbjct:   859 EDDLGNMNNNHNNNNNNNNNNNNNNNNNNNNNSNNNNNNNNNLNVFMNEHNNPTNNRGIY 918

Query:   310 NIHHNVYNNTPTDQNK--------KEYEEES--SG----FNNIQHD-NTMKSPVDKHMDH 176
               + ++ NN   D+ +        K  ++ +  SG     N + +D N +KS ++ + + 
Sbjct:   919 GSNESINNNGLMDEGRLNFIHTAGKHVDKNNMQSGSTTVVNVLNNDENYIKSNIN-YTNM 977

Query:   175 NNVPINEWPGDAHEKELNNIF-VN-KIKNN--NDAQSYKGINNKTIFLEENNDE 26
             +N+  N+ P D  +   NNI  +N +++ N  N+      INN    +  NN E
Sbjct:   978 DNMKNNDNPID--DDNPNNIVEMNLRVEKNILNNNNDEHIINNTEDMMSTNNKE 1029

 Score = 90 (31.7 bits), Expect = 1.3, P = 0.71
 Identities = 29/129 (22%), Positives = 58/129 (44%), Frame = -2

Query:   391 NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
             ++ GS +  D    N+       ++  N+H N  NN   + N  ++  +++  +NI H+N
Sbjct:    85 HVHGSRKAVDAAITNDLLRSEMEENFNNMHMNHNNNNNNNNNNNQHHHQNNN-SNIHHNN 143

Query:   211 TMKSPVDKHMDHNNVPINEWPGDAHE--KELNNIFVNKIKNNNDAQSYKGINNKTIFLEE 38
                  ++ +++ N++  N      H      NN+++N   NNN+  +    NN       
Sbjct:   144 HHMHNMNLNINPNHLGHNMSHNMNHNYNNNNNNMYINNNINNNNNNN----NNNNNSNSN 199

Query:    37 NNDERYNQENE 5
             NN+   N  N+
Sbjct:   200 NNNNNNNIGND 210

 Score = 85 (29.9 bits), Expect = 4.8, P = 0.99
 Identities = 44/172 (25%), Positives = 77/172 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N     +D +  D+ +NN ++N+    + K+D  +IN N++I+ +    +I   NNN N 
Sbjct:   713 NNNGAEIDMDDNDNIENNDHENMMT--LEKED--SIN-NDSIITTTTATNINSCNNNSNN 767

Query:   331 GEGQDIQNIHHNVYN-NTP----TDQNKKEYEEESSG------FNNIQHDNTMKSPVDKH 185
                   + +  N  N NT      + N       SSG       NN+ +++ M +    +
Sbjct:   768 ANSLLNRLVMSNGSNGNTKLNIINNYNNNNNNNSSSGGGVMVNINNVHNNDNMNT----Y 823

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKN--NNDAQSYKG-INNKTIFLEENNDERYNQ 14
              ++NN  +N+        E + I    + N  NND +   G +NN       NN+   N 
Sbjct:   824 NNNNNNILNDGNSVVGNNE-SMIHKKNVVNCINNDVEDDLGNMNNNHNNNNNNNNNNNNN 882

Query:    13 EN 8
              N
Sbjct:   883 NN 884

 Score = 71 (25.0 bits), Expect = 1.3, Sum P(2) = 0.73
 Identities = 28/127 (22%), Positives = 50/127 (39%), Frame = -2

Query:   433 NVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKE 257
             N+   D+ N IN  NN++     D  F  N   N      ++   +N   N  T+Q   +
Sbjct:   511 NIFNVDVNNLINNQNNMINLGFHDG-FGTNGLMNNQMINQMKTQLNNQMTNQMTNQMTNQ 569

Query:   256 YEEESSGFNNIQHDNTMKSPVDKHMDH--NNVPINEWPGDAHEKELNNIFVNKIKNNNDA 83
                + +     Q  N M + +   M +  NN   N+     +  ++ N   N++ N    
Sbjct:   570 MTNQMTNQMTNQMTNQMTNQMTNQMTNQVNNQMTNQMTNQVNN-QMTNQMTNQVNNQMTN 628

Query:    82 QSYKGINNK 56
             Q    +NN+
Sbjct:   629 QMTNQMNNQ 637

 Score = 68 (23.9 bits), Expect = 2.9, Sum P(2) = 0.94
 Identities = 39/156 (25%), Positives = 62/156 (39%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQN--NNIVGSDQXD----DIFFKNNNDNFGEGQDIQNIHHNV 293
             N N+ N  V+     N+N N  NN  GS             NNN    +  D  NI +N 
Sbjct:   672 NMNMLNNMVNSNMDNNVNNNYSNNYPGSGNNGLNNMTSCVMNNNGAEIDMDDNDNIENND 731

Query:   292 YNNTPTDQNKKEYEEES----SGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             + N  T + +     +S    +   NI   N   +  +  +  N + ++   G     +L
Sbjct:   732 HENMMTLEKEDSINNDSIITTTTATNINSCNNNSNNANSLL--NRLVMSN--GSNGNTKL 787

Query:   124 NNIFVNKIKNNNDAQSYKG----INNKTIFLEENNDERYNQEN 8
             N   +N   NNN+  S  G    +N   +   +N +  YN  N
Sbjct:   788 N--IINNYNNNNNNNSSSGGGVMVNINNVHNNDNMNT-YNNNN 827

 Score = 61 (21.5 bits), Expect = 1.3, Sum P(2) = 0.73
 Identities = 11/33 (33%), Positives = 18/33 (54%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKD 416
             +N  N   +    +S  NN N+NI N  +H+K+
Sbjct:   184 NNNNNNNNNNNNSNSNNNNNNNNIGNDVIHRKE 216


>pir||C45600 asparagine-rich blood stage antigen (clone Pfa35-2) - Plasmodium
            falciparum (fragment) >gi|552184 (M59474) asparagine-rich antigen
            Pfa35-2 [Plasmodium falciparum]
            Length = 407

  Minus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.00041, P = 0.00041
 Identities = 49/166 (29%), Positives = 77/166 (46%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDD--IFFKNN-----NDNFG 329
             E+  D  KN+ NDNI N  V+  D  N+  ++ I  S Q ++  I  KNN     N N  
Sbjct:   128 EDHKDDNKNSSNDNIPN--VNNSDNCNLTSDDRIKSSIQENNTCISPKNNSVVLNNTNME 185

Query:   328 EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             E +   N + N   +   D    +Y++E     N  + NT       + D ++V + +  
Sbjct:   186 ENRSYSN-NDNASKDIIMDNMCDKYKKEGKPSENSVYVNTYNDKEKTNHD-SDVAMEKDN 243

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINN---KTIFLE--ENNDERYNQEN 8
              D    E+   + NK  NNND +    I N    + F +  +NND+R + EN
Sbjct:   244 SDIIYTEIEQNY-NKKNNNNDKKKEYNIANVKAHSNFYDTFDNNDKR-DDEN 293

 Score = 106 (37.3 bits), Expect = 0.0038, P = 0.0038
 Identities = 41/153 (26%), Positives = 68/153 (44%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI--HHNVY 290
             N  ND    K  H  D+     N++I+ ++   +   KNNN++  +  +I N+  H N Y
Sbjct:   223 NTYNDK--EKTNHDSDVAMEKDNSDIIYTEIEQNYNKKNNNNDKKKEYNIANVKAHSNFY 280

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNT-MKSPVDKH-MDHNNVPI--NEWPGDAHEKELN 122
             +    D N K  +E       ++ +N  +K   +K+ M+ NNV    NE        E+ 
Sbjct:   281 DTF--DNNDKRDDENGMAEIKVEEENLDIKKISNKNSMNKNNVSYLENEQYLKCKIGEVK 338

Query:   121 NIFV--NKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N     N  ++NN+  +Y   NN       N +  YN
Sbjct:   339 NKNEQGNTAEDNNNNNNYSNNNNNNSNYNSNYNSNYN 375

 Score = 96 (33.8 bits), Expect = 0.069, P = 0.067
 Identities = 41/155 (26%), Positives = 69/155 (44%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI--HHNVY 290
             N  ND    K  H  D+     N++I+ ++   +   KNNN++  +  +I N+  H N Y
Sbjct:   223 NTYNDK--EKTNHDSDVAMEKDNSDIIYTEIEQNYNKKNNNNDKKKEYNIANVKAHSNFY 280

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNT-MKSPVDKH-MDHNNVPI--NEWPGDAHEKELN 122
             +    D N K  +E       ++ +N  +K   +K+ M+ NNV    NE        E+ 
Sbjct:   281 DTF--DNNDKRDDENGMAEIKVEEENLDIKKISNKNSMNKNNVSYLENEQYLKCKIGEVK 338

Query:   121 NIFV--NKIKNNNDAQSYKGINNKTIFLEEN--NDERYN 17
             N     N  ++NN+  +Y   NN       N  ++  YN
Sbjct:   339 NKNEQGNTAEDNNNNNNYSNNNNNNSNYNSNYNSNYNYN 377

 Score = 93 (32.7 bits), Expect = 0.16, P = 0.15
 Identities = 44/162 (27%), Positives = 70/162 (43%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             E+  D  KN+ NDNI N  V+  D  N+  ++ I  S Q ++      N++         
Sbjct:   128 EDHKDDNKNSSNDNIPN--VNNSDNCNLTSDDRIKSSIQENNTCISPKNNSV-------- 177

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM-KSPVDKHMDHNNVPINEWPGDAHEK 131
                 V NNT  ++N+  Y    +   +I  DN   K   +     N+V +N +  +  EK
Sbjct:   178 ----VLNNTNMEENRS-YSNNDNASKDIIMDNMCDKYKKEGKPSENSVYVNTY--NDKEK 230

Query:   130 ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDER--YNQENEK 2
               ++  V   K+N+D   Y  I         NND++  YN  N K
Sbjct:   231 TNHDSDVAMEKDNSDI-IYTEIEQNYNKKNNNNDKKKEYNIANVK 274

 Score = 86 (30.3 bits), Expect = 1.1, P = 0.68
 Identities = 47/196 (23%), Positives = 94/196 (47%), Frame = -2

Query:   502 NTYVDEEPIDSTK----------NNRNDNIS------NKNVHKKDIQNINQNNNIVGSDQ 371
             N Y+D +  D+ K          +N+ND+ +      +K  +KK+  + NQN+++V  D+
Sbjct:    64 NNYIDTKENDTMKKGTSSRNILYDNKNDDTNFNCFGKDKYANKKNEIDKNQNDSVVVYDE 123

Query:   370 -XDDIFFKNNNDNFGEGQDIQNIHHNVYNN-TPTDQNKKEYEEESSGF----NNIQHDNT 209
               +    K++N N     +I N++++   N T  D+ K   +E ++      N++  +NT
Sbjct:   124 NTNKEDHKDDNKN-SSNDNIPNVNNSDNCNLTSDDRIKSSIQENNTCISPKNNSVVLNNT 182

Query:   208 MKSPVDKHMDHNNVP---INEWPGDAHEKE----LNNIFVN----KIKNNNDAQSYKGIN 62
                    + +++N     I +   D ++KE     N+++VN    K K N+D+      +
Sbjct:   183 NMEENRSYSNNDNASKDIIMDNMCDKYKKEGKPSENSVYVNTYNDKEKTNHDSDVAMEKD 242

Query:    61 NKTIFLEENNDERYNQEN 8
             N  I   E  ++ YN++N
Sbjct:   243 NSDIIYTEI-EQNYNKKN 259

 Score = 84 (29.6 bits), Expect = 2.0, P = 0.86
 Identities = 46/173 (26%), Positives = 80/173 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTK----------NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFF 353
             N Y+D +  D+ K          +N+ND+ +N N   KD +  N+ N I   +Q D +  
Sbjct:    64 NNYIDTKENDTMKKGTSSRNILYDNKNDD-TNFNCFGKD-KYANKKNEI-DKNQNDSVVV 120

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGF--NNIQHDNTMKSPVDKHMD 179
              + N N  + +D      N  +N P   N       S     ++IQ +NT  SP      
Sbjct:   121 YDENTNKEDHKDDNKNSSN--DNIPNVNNSDNCNLTSDDRIKSSIQENNTCISP-----K 173

Query:   178 HNNVPINEWPGDAHEKELNNIFVNK-IKNNNDAQSYK--GI-NNKTIFLEENND-ERYNQ 14
             +N+V +N    + +    NN   +K I  +N    YK  G  +  ++++   ND E+ N 
Sbjct:   174 NNSVVLNNTNMEENRSYSNNDNASKDIIMDNMCDKYKKEGKPSENSVYVNTYNDKEKTNH 233

Query:    13 ENE 5
             +++
Sbjct:   234 DSD 236

 Score = 82 (28.9 bits), Expect = 3.3, P = 0.96
 Identities = 43/184 (23%), Positives = 76/184 (41%), Frame = -2

Query:   511 NKGNT-YVDEEPIDSTKNNRNDNI-SNKNVHKKDIQNINQN----NNIVGSDQ-XDDIFF 353
             N GN  Y +    ++  NN ++N   N N H     NI+ N    NN + +    ++   
Sbjct:     9 NYGNFGYNNNNHYNNNYNNSSNNYYHNNNYHNNHRVNIHMNYRNKNNCMNNYYPYNNYID 68

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQN-----KKEYEEESSGFNNIQHDNTM----KS 200
                ND   +G   +NI   +Y+N   D N     K +Y  + +  +  Q+D+ +     +
Sbjct:    69 TKENDTMKKGTSSRNI---LYDNKNDDTNFNCFGKDKYANKKNEIDKNQNDSVVVYDENT 125

Query:   199 PVDKHMDHNNVPINEWPGDAHEKELNNI-----FVNKIKNNNDAQSYKGINNKTIFLEEN 35
               + H D N    N+   + +  +  N+       + I+ NN   S K  NN  +    N
Sbjct:   126 NKEDHKDDNKNSSNDNIPNVNNSDNCNLTSDDRIKSSIQENNTCISPK--NNSVVLNNTN 183

Query:    34 NDERYNQEN 8
              +E  +  N
Sbjct:   184 MEENRSYSN 192


>pir||S67568 probable membrane protein YDL035c - yeast (Saccharomyces
            cerevisiae) >gnl|PID|e237296 (Z71781) unknown [Saccharomyces
            cerevisiae] >gnl|PID|e252988 (Z74083) ORF YDL035c [Saccharomyces
            cerevisiae]
            Length = 961

  Minus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.00047, P = 0.00047
 Identities = 45/156 (28%), Positives = 79/156 (50%), Frame = -2

Query:   487 EEPIDSTKNNRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             E P+ +  +N+NDN     N+ +K    IN N+N   +D  D+    NNNDN  +  +  
Sbjct:   464 ESPL-AMYDNKNDNSDITSNIKEKG-GIINNNSN---NDDDDN---NNNNDNDNDNNNSN 515

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH--NNVPI--NE--WP 149
             N ++N  NN   + N       ++  NN  + N +K+ VD +  +  +N+P   NE   P
Sbjct:   516 NNNNN--NNNNNNNNNNNNNNNNNNNNNNNNSNNIKNNVDNNNTNPADNIPTLSNEAFTP 573

Query:   148 GDAHEKE-LNN--------IFVNKIKNNNDAQSYKGINNKTIFLEEN 35
                  +E +NN         F N ++ +  AQ+YK +  +   +++N
Sbjct:   574 SQQFSQERVNNNADRCENSSFTN-VQQHFQAQTYKQMKKRRAQIQKN 619

 Score = 103 (36.3 bits), Expect = 0.029, P = 0.028
 Identities = 32/117 (27%), Positives = 54/117 (46%), Frame = -2

Query:   439 NKNVHKKDIQNINQNNNIVGSDQX-DDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNK 263
             NKN +     NI +   I+ ++   DD    NNNDN  +  +  N ++N  NN   + N 
Sbjct:   472 NKNDNSDITSNIKEKGGIINNNSNNDDDDNNNNNDNDNDNNNSNNNNNN--NNNNNNNNN 529

Query:   262 KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL-NNIFVNKIKNNN 89
                   ++  NN  + N +K+ VD   ++N  P +  P  ++E    +  F  +  NNN
Sbjct:   530 NNNNNNNNNNNNNNNSNNIKNNVD---NNNTNPADNIPTLSNEAFTPSQQFSQERVNNN 585

 Score = 99 (34.8 bits), Expect = 0.089, P = 0.085
 Identities = 33/133 (24%), Positives = 62/133 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N+  D++  D+  NN NDN  N N +  +  N N NNN   ++  ++    NNN++    
Sbjct:   493 NSNNDDD--DNNNNNDNDN-DNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNIK 549

Query:   322 QDIQNIHHNVYNNTPTDQNK-----KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
              ++ N + N  +N PT  N+     +++ +E    N  + +N+  + V +H         
Sbjct:   550 NNVDNNNTNPADNIPTLSNEAFTPSQQFSQERVNNNADRCENSSFTNVQQHFQAQTYKQM 609

Query:   157 EWPGDAHEKELNNIFV 110
             +      +K L  IF+
Sbjct:   610 KKRRAQIQKNLRAIFI 625

 Score = 98 (34.5 bits), Expect = 0.12, P = 0.11
 Identities = 31/98 (31%), Positives = 50/98 (51%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN--ND 338
             N  N   D +  +S  NN N+N +N N +  +  N N NNN   ++  ++I  KNN  N+
Sbjct:   501 NNNNNDNDNDNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNSNNI--KNNVDNN 555

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEE------ESSGFNNIQ 221
             N     +I  + +  +  TP+ Q  +E         E+S F N+Q
Sbjct:   556 NTNPADNIPTLSNEAF--TPSQQFSQERVNNNADRCENSSFTNVQ 598

 Score = 93 (32.7 bits), Expect = 0.48, P = 0.38
 Identities = 24/72 (33%), Positives = 37/72 (51%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD-IQNIH 302
             I++  NN +D+ +N N +  D  N N NNN   ++  ++    NNN+N     +   NI 
Sbjct:   490 INNNSNNDDDDNNNNNDNDNDNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNIK 549

Query:   301 HNVYNNT--PTD 272
             +NV NN   P D
Sbjct:   550 NNVDNNNTNPAD 561

 Score = 82 (28.9 bits), Expect = 9.6, P = 1.0
 Identities = 27/98 (27%), Positives = 41/98 (41%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  N   D +  +S  NN N+N +N N +  +  N N NNN   S+   +    NNN N 
Sbjct:   501 NNNNNDNDNDNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNIKNNV-DNNNTNP 559

Query:   331 GEG-QDIQNIHHNVYNNTPTDQ-NKKEYEEESSGFNNIQ 221
              +    + N           ++ N      E+S F N+Q
Sbjct:   560 ADNIPTLSNEAFTPSQQFSQERVNNNADRCENSSFTNVQ 598


>gnl|PID|e311435 (Y08926) AARP1 protein [Plasmodium falciparum]
            Length = 3844

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00047, P = 0.00047
 Identities = 36/155 (23%), Positives = 75/155 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N   D    D+  ++ ND+ +N + +  D  N + NN+   +D  ++    N++DN
Sbjct:  1233 NNDDNNDNDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDN 1292

Query:   334 FGEGQDIQNIHHNVYN--NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN--- 170
                 +D  N+H +  N  N    ++       SS  N  +++N+    VD++ D+     
Sbjct:  1293 DDNDED-SNLHGSSSNMLNIINSRDNNSVTN-SSNINTARNNNSTYIIVDQNGDNETLFA 1350

Query:   169 -VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGIN 62
              + IN  P ++   E+ N+  N + + N+ ++Y+ +N
Sbjct:  1351 EILINRNPNNSINMEIVNVTDNNVGDENNNRNYRHLN 1387

 Score = 116 (40.8 bits), Expect = 0.0022, P = 0.0022
 Identities = 41/162 (25%), Positives = 75/162 (46%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             D++  D   ++ NDN +N + +  D  N + NN+   +D  DD    +NND+     D  
Sbjct:  1226 DDDNNDDNNDDNNDNDNNDDDNNDDDNNDDDNNDDDNND--DDNNDDDNNDDDNNDDDNN 1283

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQ-HDN---TMKSPVDKHMDHNNVPIN-EWPG 146
             +  +N  +N   D++   +   S+  N I   DN   T  S ++   ++N+  I  +  G
Sbjct:  1284 DDDNNDDDNDDNDEDSNLHGSSSNMLNIINSRDNNSVTNSSNINTARNNNSTYIIVDQNG 1343

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             D +E     I +N+  NN+       + +  +  +ENN+  Y   N
Sbjct:  1344 D-NETLFAEILINRNPNNSINMEIVNVTDNNVG-DENNNRNYRHLN 1387

 Score = 103 (36.3 bits), Expect = 0.13, P = 0.12
 Identities = 42/143 (29%), Positives = 63/143 (44%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             NR D   NK   KK   N+   N+   +++ DD    NNN+N     +  N ++N  N++
Sbjct:  3126 NRKDYERNKKERKKKNTNLYPTNSQTNNNENDDNNNNNNNNNNNNNNNNNNNNNNNNNDS 3185

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV-PINEWPGDAHEKEL------- 125
               D NK +    ++ FNN  +  T      K  +H++V  I  W       +        
Sbjct:  3186 RGDVNKPK---NNNSFNN--NSETKGGNKKKKKNHSDVLNIKYWRNINTAVDFFKIYWIL 3240

Query:   124 -NNIFVNKIKNNNDAQSYKGINNKTIFLEEN 35
              N I +NK KN N   +Y   NN    L  N
Sbjct:  3241 YNEILINK-KNKNI--NYISCNNMIEILVRN 3268

 Score = 102 (35.9 bits), Expect = 0.17, P = 0.16
 Identities = 37/158 (23%), Positives = 69/158 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N    Y+D+   D   +N +DN  N + +  D  + N ++N    +  DD    +NND+
Sbjct:  1197 NNDDINYMDDND-DDNDDNDDDNDDNDDDNDDDNNDDNNDDNNDNDNNDDDNNDDDNNDD 1255

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
                  D  +  +N  +N   D N  +  ++ +  ++   DN   S +  H   +N+ +N 
Sbjct:  1256 DNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDD-NDDNDEDSNL--HGSSSNM-LNI 1311

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGIN--NKTIFLE 41
                  +    N+  +N  +NNN        N  N+T+F E
Sbjct:  1312 INSRDNNSVTNSSNINTARNNNSTYIIVDQNGDNETLFAE 1351

 Score = 98 (34.5 bits), Expect = 0.54, P = 0.42
 Identities = 47/160 (29%), Positives = 76/160 (47%), Frame = -2

Query:   490 DEEPIDSTKN----NRNDNISNKNVHKKDI--QNI-NQNNNIVGSDQXDDIFFKNNNDNF 332
             + E +D   N    N NDNI   N++  +I   NI   N+NI G    D+I+  NNN   
Sbjct:  2852 EHEMVDGISNMGVANNNDNIYGDNIYGDNIYGDNIYGDNDNIYG----DNIYDNNNNSCV 2907

Query:   331 GEGQDI--QNIHHNVYNNTPTDQNKKEYEEESSGFNN-IQHDNTMKSPVDKHMDHNNVPI 161
             G G+D    N   ++      D NK  YEE        ++ +   K  ++   D  ++  
Sbjct:  2908 G-GEDFICDNKSDDINFEFIKDLNKINYEENKKQKKEMLEIEKLNKENING--DKKDIYK 2964

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGI--NNKTIFLEENNDERYNQ 14
              ++P +  E + +NI    +K +     Y+GI   NK I+ E  N+ +  Q
Sbjct:  2965 FKYPCNIEEIKDHNI---SMKTSLSMDVYEGIVSTNKNIY-EIYNELKRKQ 3011

 Score = 96 (33.8 bits), Expect = 0.93, P = 0.60
 Identities = 39/162 (24%), Positives = 74/162 (45%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQX--DDIFFKNNNDNFG 329
             N   D   + + + NR+  +S   V  +   N+N N++++G ++   DDI + ++ND+  
Sbjct:  1153 NNTCDVGVVINEEANRSSGMSQNVVTYESGINMN-NDDVLGEERTNNDDINYMDDNDDDN 1211

Query:   328 EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             +  D  N           D N  + +++++  NN  +++   +  D + D NN   N   
Sbjct:  1212 DDNDDDN-----------DDNDDDNDDDNNDDNNDDNNDNDNNDDDNNDDDNNDDDNN-- 1258

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
              D +  + NN   N   +NND  +    NN      ++NDE  N
Sbjct:  1259 DDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDD--NDDNDEDSN 1300

 Score = 94 (33.1 bits), Expect = 1.6, P = 0.80
 Identities = 35/129 (27%), Positives = 65/129 (50%), Frame = -2

Query:   481 PIDS-TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             P +S T NN ND+ +N N +  +  N N NNN       ++    NNND+ G+    +N 
Sbjct:  3146 PTNSQTNNNENDDNNNNNNNNNNNNNNNNNNN-------NN---NNNNDSRGDVNKPKN- 3194

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH----MDHNNVPINEWPGDAH 137
             +++  NN+ T    K+ ++  S   NI++   + + VD      + +N + IN+   + +
Sbjct:  3195 NNSFNNNSETKGGNKKKKKNHSDVLNIKYWRNINTAVDFFKIYWILYNEILINKKNKNIN 3254

Query:   136 EKELNNIFVNKIKN 95
                 NN+    ++N
Sbjct:  3255 YISCNNMIEILVRN 3268

 Score = 94 (33.1 bits), Expect = 1.6, P = 0.80
 Identities = 38/159 (23%), Positives = 69/159 (43%), Frame = -2

Query:   505 GNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             G    + + I+   +N +DN  N + +  +  + + +NN    D  DD     NNDN   
Sbjct:  1192 GEERTNNDDINYMDDNDDDNDDNDDDNDDNDDDNDDDNN---DDNNDD-----NNDNDNN 1243

Query:   325 GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPG 146
               D  +  +N  +N   D N  +  ++    NN   +N   +  D + D +N   N+   
Sbjct:  1244 DDDNNDDDNNDDDNNDDDNNDDDNNDDD---NNDDDNNDDDNNDDDNNDDDNDD-NDEDS 1299

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGIN-----NKT-IFLEENND 29
             + H    N + +   ++NN   +   IN     N T I +++N D
Sbjct:  1300 NLHGSSSNMLNIINSRDNNSVTNSSNINTARNNNSTYIIVDQNGD 1344

 Score = 93 (32.7 bits), Expect = 0.96, Sum P(2) = 0.62
 Identities = 45/150 (30%), Positives = 64/150 (42%), Frame = -2

Query:   451 DNISN-KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT 275
             D I N K   +KDI   + NNN    D  DD    +N+DN  +  D  N       N   
Sbjct:  2410 DYIKNDKCKSRKDICFNDNNNNYNNDDDNDD----DNDDNNDDNNDDDN-------NNGG 2458

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKI-K 98
             D N    EE  S  ++   +N      D HMD +++    +    H+K  N    NK  K
Sbjct:  2459 DNNYDTGEESLSTLSSCSSENVSS---DNHMDDSDIAEEFYFKYTHDKNKNIKMANKKNK 2515

Query:    97 NNNDAQSYKG---INNKTIFLEENNDERYN--QENEK 2
               N  +++K    +NN       +N   YN   EN+K
Sbjct:  2516 KRNLKENHKEDFHMNNSNT----HNVSSYNFFDENKK 2548

 Score = 93 (32.7 bits), Expect = 2.1, P = 0.88
 Identities = 35/139 (25%), Positives = 67/139 (48%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQX--DDIFFKNNNDNFG 329
             N   D   + + + NR+  +S   V  +   N+N N++++G ++   DDI + ++ND+  
Sbjct:  1153 NNTCDVGVVINEEANRSSGMSQNVVTYESGINMN-NDDVLGEERTNNDDINYMDDNDDDN 1211

Query:   328 EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             +  D  N  ++  N+   D N  +  ++++  +N   DN   +  D + D NN   N   
Sbjct:  1212 DDNDDDNDDNDDDND---DDNNDDNNDDNNDNDNNDDDN---NDDDNNDDDNNDDDNN-- 1263

Query:   148 GDAHEKELNNIFVNKIKNNND 86
              D +  + NN   N   +NND
Sbjct:  1264 DDDNNDDDNNDDDNNDDDNND 1284

 Score = 93 (32.7 bits), Expect = 2.1, P = 0.88
 Identities = 42/145 (28%), Positives = 59/145 (40%), Frame = -2

Query:   451 DNISN-KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT 275
             D I N K   +KDI   + NNN    D  DD    +N+DN  +  D  N       N   
Sbjct:  2410 DYIKNDKCKSRKDICFNDNNNNYNNDDDNDD----DNDDNNDDNNDDDN-------NNGG 2458

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKN 95
             D N    EE  S  ++   +N      D HMD +++    +    H+K  N    NK   
Sbjct:  2459 DNNYDTGEESLSTLSSCSSENVSS---DNHMDDSDIAEEFYFKYTHDKNKNIKMANK--- 2512

Query:    94 NNDAQSYKGINNKTIFLEENNDERYN 17
              N  ++ K  N+K  F   NN   +N
Sbjct:  2513 KNKKRNLKE-NHKEDF-HMNNSNTHN 2536

 Score = 92 (32.4 bits), Expect = 2.8, P = 0.94
 Identities = 38/158 (24%), Positives = 71/158 (44%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             +++ +   + N ND+I+    +  D  + N +N+    D  DD    NN+DN  +  D  
Sbjct:  1187 NDDVLGEERTN-NDDIN----YMDDNDDDNDDNDDDNDDNDDDNDDDNNDDNNDDNNDND 1241

Query:   310 NIH--HNVYNNTPTDQNKKEYEEESSGF--NNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
             N    +N  +N   D N  +  ++ +    NN   +N   +  D + D +N   N+   +
Sbjct:  1242 NNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNNDDDNDD-NDEDSN 1300

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGIN-----NKT-IFLEENND 29
              H    N + +   ++NN   +   IN     N T I +++N D
Sbjct:  1301 LHGSSSNMLNIINSRDNNSVTNSSNINTARNNNSTYIIVDQNGD 1344

 Score = 91 (32.0 bits), Expect = 1.7, Sum P(2) = 0.82
 Identities = 37/144 (25%), Positives = 63/144 (43%), Frame = -2

Query:   448 NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQ 269
             NI+N +  K D        +I  +D  ++  + N++DN  +  D  + +++  NN   D 
Sbjct:  2405 NITNCDYIKND--KCKSRKDICFNDNNNN--YNNDDDNDDDNDDNNDDNNDDDNNNGGDN 2460

Query:   268 NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNN 89
             N    EE  S  ++   +N      D HMD +++    +    H+K  N    NK KN  
Sbjct:  2461 NYDTGEESLSTLSSCSSENVSS---DNHMDDSDIAEEFYFKYTHDKNKNIKMANK-KNKK 2516

Query:    88 DAQSYKGINNKTIFLEENNDERYN 17
               ++ K  N+K  F   NN   +N
Sbjct:  2517 --RNLKE-NHKEDF-HMNNSNTHN 2536

 Score = 90 (31.7 bits), Expect = 5.0, P = 0.99
 Identities = 41/164 (25%), Positives = 69/164 (42%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNIS---NKNVHKKDIQNINQ--NNNIVGSDQXDDIFFKNNNDNFG 329
             ++E   D+     +DNI+   + N++K    NIN+  ++NI  ++   D   K  +DN  
Sbjct:  2176 INEMASDNINEMVSDNINEMTSDNINKMTSDNINKMTSDNI--NEMASDNINKMTSDNIN 2233

Query:   328 EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             E     NI+    +N     N+  YE+ + G      D      VD  +++N   I E  
Sbjct:  2234 E-MTSDNINKMTSDNINKMANQMNYEQNTDGIIIKSSDIPNNVQVDIFINNNISQIYECA 2292

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                   E N   +  IKN          +N      +NN    N+E+E+
Sbjct:  2293 ------EQNIELLKDIKNGESTNMCNKADNLFAIQNDNNYPYRNKESEE 2335

 Score = 89 (31.3 bits), Expect = 6.5, P = 1.0
 Identities = 38/163 (23%), Positives = 75/163 (46%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNV--HKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE--- 326
             D+  ++      N+N  +  V  +++  ++   + N+V  +   ++   NN+D  GE   
Sbjct:  1140 DDSLLNQKGGTTNNNTCDVGVVINEEANRSSGMSQNVVTYESGINM---NNDDVLGEERT 1196

Query:   325 -GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
                DI  +  N  +N   D +  + ++++   NN   +N   +  D + D NN   N   
Sbjct:  1197 NNDDINYMDDNDDDNDDNDDDNDDNDDDNDDDNN-DDNNDDNNDNDNNDDDNNDDDNN-- 1253

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              D +  + NN   N   +NND  +    NN     ++NND+  N +N++
Sbjct:  1254 DDDNNDDDNNDDDNNDDDNNDDDNNDDDNND----DDNNDDD-NDDNDE 1297

 Score = 89 (31.3 bits), Expect = 6.5, P = 1.0
 Identities = 39/164 (23%), Positives = 66/164 (40%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNIS---NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             ++E   D+     +DNI+   + N++K    NIN+  +   ++   D   K  +DN  E 
Sbjct:  2176 INEMASDNINEMVSDNINEMTSDNINKMTSDNINKMTSDNINEMASDNINKMTSDNINE- 2234

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
                 NI+    +N     N+  YE+ + G      D      VD  +++N   I E    
Sbjct:  2235 MTSDNINKMTSDNINKMANQMNYEQNTDGIIIKSSDIPNNVQVDIFINNNISQIYECA-- 2292

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                 E N   +  IKN          +N      +NN    N+E+E+
Sbjct:  2293 ----EQNIELLKDIKNGESTNMCNKADNLFAIQNDNNYPYRNKESEE 2335

 Score = 88 (31.0 bits), Expect = 8.4, P = 1.0
 Identities = 36/151 (23%), Positives = 66/151 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N +D +  +  +  DI  ++ N++   +D  DD    N++DN  +  D  N  +N  +N 
Sbjct:  1186 NNDDVLGEERTNNDDINYMDDNDD--DNDDNDDDNDDNDDDNDDDNNDDNNDDNNDNDNN 1243

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKI 101
               D N    +++++  +N   DN   +  D + D NN   N    D +  + NN   N  
Sbjct:  1244 DDDNN----DDDNNDDDNNDDDN---NDDDNNDDDNNDDDNN--DDDNNDDDNNDDDND- 1293

Query:   100 KNNNDAQSYKGINNK-TIFLEENNDERYNQEN 8
              N+ D+  +   +N   I    +N+   N  N
Sbjct:  1294 DNDEDSNLHGSSSNMLNIINSRDNNSVTNSSN 1325

 Score = 82 (28.9 bits), Expect = 1.7, Sum P(2) = 0.82
 Identities = 20/58 (34%), Positives = 29/58 (50%), Frame = -2

Query:   481 PIDS-TKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             P +S T NN ND  N +N N +  +  N N NNN   +D   D+    NN++F    +
Sbjct:  3146 PTNSQTNNNENDDNNNNNNNNNNNNNNNNNNNNNNNNNDSRGDVNKPKNNNSFNNNSE 3203

 Score = 82 (28.9 bits), Expect = 1.7, Sum P(2) = 0.82
 Identities = 23/86 (26%), Positives = 36/86 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  NT  D        NN ND+++       +  NIN +NN   ++  ++    NNN+N
Sbjct:   124 SNYDNTMFDRSCSIPGLNNMNDDVNKSGGVSLNDDNINNDNNNTNNNTNNNT--NNNNNN 181

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKE 257
                  +  N + N         NKK+
Sbjct:   182 TNNNTNNNNNNKNCEGKANDQTNKKK 207

 Score = 58 (20.4 bits), Expect = 1.7, Sum P(2) = 0.82
 Identities = 26/103 (25%), Positives = 44/103 (42%), Frame = -2

Query:   298 NVYNNTPTDQNKKEYEE---ESSGFNNIQHDNTMKS-PVDKHMDHNNVPINEWPGDAHEK 131
             NVY+   TD  KK+ E+   +     N Q +N  K+   +K +D N +       D ++ 
Sbjct:  3529 NVYSKKATDILKKKNEKMKNDKEETGNEQANNCNKTLDGNKTLDGNKILDGNKTLDGNKI 3588

Query:   130 ELNNIFV--NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               +N  +  NK+ + N       I +    L+ NN+   N  N
Sbjct:  3589 LDDNKLLDDNKLLDGNKTLDGNKILDDNKILDSNNNNNNNNNN 3631

 Score = 51 (18.0 bits), Expect = 8.4, Sum P(2) = 1.0
 Identities = 20/99 (20%), Positives = 35/99 (35%), Frame = -2

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             N YN+   D   K  +E          D         +  +N+   N +  + H ++   
Sbjct:   604 NEYNDVQNDYIHKADDEICINEKVYDEDTNKYIDTSPNFSYNHNIQNHYMVEEHSEDKKP 663

Query:   118 IFVNKIK--NNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              ++NKIK    ND    + +      L  N  ++ N  N
Sbjct:   664 YYMNKIKYIKKNDEFFEEHMKMYESMLIYNRSKKSNDNN 702

 Score = 51 (18.0 bits), Expect = 8.4, Sum P(2) = 1.0
 Identities = 23/100 (23%), Positives = 44/100 (44%), Frame = -2

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKE 128
             I+     ++   QN   YE   SG N + +D+ +      + D N +  N+   D ++ +
Sbjct:  1162 INEEANRSSGMSQNVVTYE---SGIN-MNNDDVLGEERTNNDDINYMDDNDDDNDDNDDD 1217

Query:   127 LN-NIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              + N   N   NN+D       N+     ++NND+  N ++
Sbjct:  1218 NDDNDDDNDDDNNDDNNDDNNDNDNND--DDNNDDDNNDDD 1256

 Score = 47 (16.5 bits), Expect = 0.96, Sum P(2) = 0.62
 Identities = 13/39 (33%), Positives = 17/39 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQ 398
             SN  N     E  D  KN   D  +NK   +  I N+N+
Sbjct:  1917 SNSNNNSDGHE--DDNKNRCTDVKTNKQEEEFSISNVNE 1953

 Score = 42 (14.8 bits), Expect = 5.1e+03, Sum P(3) = 1.0
 Identities = 11/34 (32%), Positives = 17/34 (50%), Frame = -3

Query:   414 FKILTKIIILWDQIKXMISFLKIIMTILVKDKTY 313
             F   TK   L   +   +SF+K I   ++K+K Y
Sbjct:  2678 FYYRTKNGFLSYHVSLPLSFIKEIQYFMIKNKLY 2711


>sp|P54682|D7_DICDI CAMP-INDUCIBLE PRESPORE PROTEIN D7 PRECURSOR >gi|915201
            (U25143) cAMP-inducible prespore protein [Dictyostelium discoideum]
            Length = 850

  Minus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00060, P = 0.00060
 Identities = 42/154 (27%), Positives = 69/154 (44%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVG----SDQXDDIFFKNNNDNFGEGQDI-QNIHH 299
             N+ NDN    N +  +I N N NN  V     S Q  +I  +N      E +D  + ++ 
Sbjct:   545 NDANDNFEQVNNNNNNINNNNNNNFKVDKSKKSAQQVEIALENERLYLQEVEDAPERLYE 604

Query:   298 NVYNNTPTD--QNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
              ++N+      Q  +E E + +G N     N+ K         NN   NE   DA E+  
Sbjct:   605 EIHNSNLNKAVQEAEEIERQQNG-NGSPAVNSHKIVTQMGNVENNEITNEQ--DAIEQAQ 661

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             +   + +I+N  D   Y+   ++  FL+EN  +    +NE
Sbjct:   662 H---LQRIENGEDIDEYEAAQHEVAFLDENEQDAAKLQNE 698


>gi|1513240 (U66370) ORFveg110 [Dictyostelium discoideum]
            Length = 295

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.00072, Sum P(2) = 0.00072
 Identities = 29/100 (29%), Positives = 50/100 (50%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             KN    F E  +   +   + NN  + + KK    +S     +QH+NT  +   ++ ++N
Sbjct:   192 KNFTKIFDENWEALRV---IVNNRDSQKEKKSKLIDSISTTLLQHNNTATTTTSQN-NNN 247

Query:   172 NVPINEWPGDAH---------EKELNNIFVNKIKNNNDAQSYKGIN 62
             N+ ++E   D           +K LN IFV+   NNND  ++K +N
Sbjct:   248 NIDLDEIKEDVESIINQFCIQDKPLNQIFVDN--NNNDISNFKDLN 291

 Score = 54 (19.0 bits), Expect = 0.00072, Sum P(2) = 0.00072
 Identities = 13/45 (28%), Positives = 27/45 (60%), Frame = -2

Query:   499 TYVDEEP--IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD 365
             TY+ ++   +  + NN+N++ +N N++  +I N  +N N  G  + D
Sbjct:    32 TYIRKQSNQLFFSSNNKNNDNNNNNIN--NIDNNYENKNFGGVPEED 76


>pir||S14470 asparagine-rich protein (clone 28C6) - Plasmodium falciparum
            (fragment) >gi|9851 (X17487) Plasmodium falciparum mRNA for
            asparagine-rich antigen (clone 28C6) [Plasmodium falciparum]
            Length = 239

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.00073, P = 0.00073
 Identities = 44/174 (25%), Positives = 76/174 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N Y +E      +NN ND+  + N    D  N+N+ +N    +   + F  NN  N
Sbjct:    11 NNYNNNYNNERNDFYCRNNLNDSFDSLN--NNDNNNMNRRSNFSIRNNKFNKFHDNNMSN 68

Query:   334 FGEGQDIQNI---HHNVYNNTPTDQN------KKEYEEESSGFNN--IQHDNTMKSPVDK 188
                  +  N    H+N  NN   D N      K  Y  ++S  NN  + ++N M S   K
Sbjct:    69 LNNNNNNNNNNNNHNNNNNNNNFDHNNRNSYKKSNYATDNSNNNNNNLNNNNNM-SGTKK 127

Query:   187 HM--DHNNV-PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
              +  D +    ++ W    +    +N  +N + NN +      +NN  + +  NN++  N
Sbjct:   128 LLWRDSDKTGSMSTWRLGKNSVSNHNSSMNHMNNNMNK-----LNNTNMMMSHNNNKMSN 182

Query:    16 QE 11
              +
Sbjct:   183 NK 184

 Score = 103 (36.3 bits), Expect = 0.0035, P = 0.0034
 Identities = 36/174 (20%), Positives = 73/174 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N Y +E      +NN ND+  + N    D  N+N+ +N    +   + F  NN  N
Sbjct:    11 NNYNNNYNNERNDFYCRNNLNDSFDSLN--NNDNNNMNRRSNFSIRNNKFNKFHDNNMSN 68

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
                  +  N ++N +NN   + N       S   +N   DN+  +  + + ++N     +
Sbjct:    69 LNNNNNNNNNNNN-HNNNNNNNNFDHNNRNSYKKSNYATDNSNNNNNNLNNNNNMSGTKK 127

Query:   154 --WPGDAHEKELNN--IFVNKIKNNNDAQSYKG-----INNKTIFLEENNDERYNQE 11
               W        ++   +  N + N+N + ++       +NN  + +  NN++  N +
Sbjct:   128 LLWRDSDKTGSMSTWRLGKNSVSNHNSSMNHMNNNMNKLNNTNMMMSHNNNKMSNNK 184

 Score = 99 (34.8 bits), Expect = 0.011, P = 0.011
 Identities = 33/131 (25%), Positives = 57/131 (43%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ-NIHHNVYN 287
             NN N+N +  N +  +  +    NN+  +D  D +   NNNDN    +    +I +N +N
Sbjct:     5 NNNNNNNNYNNNYNNERNDFYCRNNL--NDSFDSL---NNNDNNNMNRRSNFSIRNNKFN 59

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
                 D N       ++  NN  + N   +  + + DHNN   N +    +  + +N   N
Sbjct:    60 KFH-DNNMSNLNNNNNNNNNNNNHNNNNN--NNNFDHNNR--NSYKKSNYATDNSNNNNN 114

Query:   106 KIKNNNDAQSYK 71
              + NNN+    K
Sbjct:   115 NLNNNNNMSGTK 126

 Score = 97 (34.1 bits), Expect = 0.020, P = 0.020
 Identities = 39/166 (23%), Positives = 72/166 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHK-KDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +N  N  ++     S +NN+ +   + N+    +  N N NNN   ++  ++ F  NN +
Sbjct:    38 NNNDNNNMNRRSNFSIRNNKFNKFHDNNMSNLNNNNNNNNNNNNHNNNNNNNNFDHNNRN 97

Query:   337 NFGEGQ----DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             ++ +      +  N ++N+ NN      KK    +S    ++      K+ V  H    N
Sbjct:    98 SYKKSNYATDNSNNNNNNLNNNNNMSGTKKLLWRDSDKTGSMSTWRLGKNSVSNH----N 153

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
               +N    + ++  LNN  +    NNN   + K   +KT     NND + N
Sbjct:   154 SSMNHMNNNMNK--LNNTNMMMSHNNNKMSNNKR-GHKTFNKNYNNDAKSN 201

 Score = 94 (33.1 bits), Expect = 0.049, P = 0.048
 Identities = 32/128 (25%), Positives = 62/128 (48%), Frame = -2

Query:   409 NINQNNNIVGSDQXDDIFFKNN-NDNFGEGQDIQNIHHNVYNNTPTDQNK--KEYEEESS 239
             N N NNN   +++ +D + +NN ND+F    +  N + N  +N     NK  K ++   S
Sbjct:    10 NNNYNNNY--NNERNDFYCRNNLNDSFDSLNNNDNNNMNRRSNFSIRNNKFNKFHDNNMS 67

Query:   238 GFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
               NN  ++N   +  + + ++NN   N    ++++K  N    N   NNN+  +   ++ 
Sbjct:    68 NLNNNNNNNNNNNNHNNNNNNNNFDHNN--RNSYKKS-NYATDNSNNNNNNLNNNNNMSG 124

Query:    58 KTIFLEENNDE 26
                 L  ++D+
Sbjct:   125 TKKLLWRDSDK 135

 Score = 88 (31.0 bits), Expect = 0.27, P = 0.24
 Identities = 32/132 (24%), Positives = 58/132 (43%), Frame = -2

Query:   403 NQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKE-YEEESSGFNN 227
             N NNN   ++  ++  + N  ++F    ++ +   ++ NN   + N++  +   ++ FN 
Sbjct:     3 NNNNNNNNNNYNNN--YNNERNDFYCRNNLNDSFDSLNNNDNNNMNRRSNFSIRNNKFNK 60

Query:   226 IQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIF 47
               HDN M +  + + ++NN        + H    NN   N   +NN   SYK  N  T  
Sbjct:    61 F-HDNNMSNLNNNNNNNNN-------NNNHNNNNNN---NNFDHNN-RNSYKKSNYATDN 108

Query:    46 LEENNDERYNQEN 8
                NN+   N  N
Sbjct:   109 SNNNNNNLNNNNN 121

 Score = 88 (31.0 bits), Expect = 0.27, P = 0.24
 Identities = 39/177 (22%), Positives = 71/177 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNN 341
             +NK N + D    +   NN N+N +N + +  +  N + NN  +   S+   D    NNN
Sbjct:    55 NNKFNKFHDNNMSNLNNNNNNNNNNNNHNNNNNNNNFDHNNRNSYKKSNYATDNS-NNNN 113

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQN-------KKEYEEESSGFNNIQHDNTMKSPVDKHM 182
             +N     ++      ++ ++    +       K      +S  N++ ++    +  +  M
Sbjct:   114 NNLNNNNNMSGTKKLLWRDSDKTGSMSTWRLGKNSVSNHNSSMNHMNNNMNKLNNTNMMM 173

Query:   181 DHNNVPI-NEWPGD-AHEKELNNIFVNKI----KNNNDAQ-SYKGINNKTIFLEENND 29
              HNN  + N   G     K  NN   + I    KN+   + +   +NN    L  NND
Sbjct:   174 SHNNNKMSNNKRGHKTFNKNYNNDAKSNISSDMKNSTSHEINVDNMNNYMHHLYNNND 231

 Score = 84 (29.6 bits), Expect = 0.84, P = 0.57
 Identities = 31/130 (23%), Positives = 56/130 (43%), Frame = -2

Query:   397 NNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKE-YEEESSGFNNIQ 221
             NNN   ++   +  + N  ++F    ++ +   ++ NN   + N++  +   ++ FN   
Sbjct:     3 NNNNNNNNNNYNNNYNNERNDFYCRNNLNDSFDSLNNNDNNNMNRRSNFSIRNNKFNKF- 61

Query:   220 HDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLE 41
             HDN M +  + + ++NN        + H    NN   N   +NN   SYK  N  T    
Sbjct:    62 HDNNMSNLNNNNNNNNN-------NNNHNNNNNN---NNFDHNN-RNSYKKSNYATDNSN 110

Query:    40 ENNDERYNQEN 8
              NN+   N  N
Sbjct:   111 NNNNNLNNNNN 121


>gi|1620096 (U42580) Asn-rich, VKKNN (5x) [Paramecium bursaria Chlorella virus
            1]
            Length = 114

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.00077, P = 0.00077
 Identities = 33/106 (31%), Positives = 50/106 (47%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             +P  S  NNR  N +N N +     N N NNN  G D      + N+N+N+    + +  
Sbjct:     7 KPQTSRVNNRRVNNNNNNNN----WNNNNNNNNNGWDPNAWNNWNNSNNNYSNNWNFEEW 62

Query:   304 -HHNVYN-NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH-MDHNNV 167
              + N YN N   + N       S   NN++ +N  K+ V K+ +  NNV
Sbjct:    63 GNFNNYNWNNNGNNNGNNKGNNSVKKNNVKKNNVKKNNVKKNNVKKNNV 111

 Score = 87 (30.6 bits), Expect = 0.0030, P = 0.0030
 Identities = 33/117 (28%), Positives = 53/117 (45%), Frame = -2

Query:   430 VHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYE 251
             V+ + + N N NNN           + NNN+N   G D  N  +N +NN+  + +     
Sbjct:    13 VNNRRVNNNNNNNN-----------WNNNNNNNNNGWD-PNAWNN-WNNSNNNYSNNWNF 59

Query:   250 EESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQ 80
             EE   FNN   +N   +    +  +N+V  N    +  +K  NN+  N +K NN A+
Sbjct:    60 EEWGNFNNYNWNNNGNNN-GNNKGNNSVKKNNVKKNNVKK--NNVKKNNVKKNNVAK 113

 Score = 82 (28.9 bits), Expect = 0.023, P = 0.022
 Identities = 35/106 (33%), Positives = 51/106 (48%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND----NFGEGQD 317
             +P  S  NNR  N +N N +  +  N N NNN    +  ++    NNN     NF E  +
Sbjct:     7 KPQTSRVNNRRVNNNNNNNNWNN--NNNNNNNGWDPNAWNNWNNSNNNYSNNWNFEEWGN 64

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH-MDHNNV 167
               N + N  NN   + N K     S   NN++ +N  K+ V K+ +  NNV
Sbjct:    65 FNNYNWN--NNGNNNGNNKG--NNSVKKNNVKKNNVKKNNVKKNNVKKNNV 111


>pir||S50977 hypothetical protein YDL005c - yeast (Saccharomyces cerevisiae)
            >gi|642801 (Z48008) unknown [Saccharomyces cerevisiae] >gi|683692
            (Z48432) unknown [Saccharomyces cerevisiae] >gnl|PID|e252970
            (Z74053) ORF YDL005c [Saccharomyces cerevisiae]
            Length = 431

  Minus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.00088, P = 0.00088
 Identities = 39/122 (31%), Positives = 57/122 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNND 338
             ++ GN Y D   I S +NN N+NI N   + KD  N  N+NNN  G ++  +    NN D
Sbjct:   264 NDSGNNYNDIN-ISSIENNINNNI-NSTKNGKDNNNESNKNNN--GDEKNKN----NNED 315

Query:   337 NFGEGQDIQ-NIHHNVYNNTPTDQNKKEYEEESSGFNN--IQHD-NTMKSPVDKHMDHNN 170
             N       + N ++N  NN   D N       S   NN    +D N   + +    D+ N
Sbjct:   316 NENNNNSSEKNNNNNNNNNNNNDDNGNNNNNNSGNDNNNTTNNDSNNKNNSITTGNDNEN 375

Query:   169 VPINEWP 149
             +  N+ P
Sbjct:   376 IVNNDLP 382

 Score = 102 (35.9 bits), Expect = 0.013, P = 0.013
 Identities = 40/131 (30%), Positives = 66/131 (50%), Frame = -2

Query:   478 IDSTKN-NRNDNISNKN-VHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             +D TK  + ND+ +N N ++   I+N N NNNI  +    D   ++N +N G+ ++  N 
Sbjct:   255 VDETKGFDDNDSGNNYNDINISSIEN-NINNNINSTKNGKDNNNESNKNNNGDEKNKNNN 313

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
               N  NN  +++N       ++  NN   DN   +  +   D+NN   N    D++ K  
Sbjct:   314 EDNENNNNSSEKNNNN----NNNNNNNNDDNGNNNNNNSGNDNNNTTNN----DSNNKN- 364

Query:   124 NNIFV-NKIKN--NND 86
             N+I   N  +N  NND
Sbjct:   365 NSITTGNDNENIVNND 380

 Score = 102 (35.9 bits), Expect = 0.013, P = 0.013
 Identities = 40/145 (27%), Positives = 63/145 (43%), Frame = -2

Query:   478 IDSTKNNR-NDNISNKNVHKKDIQNINQN----NNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             I+STKN + N+N SNKN +  D +N N N    NN   S++ ++    NNN+N   G + 
Sbjct:   286 INSTKNGKDNNNESNKN-NNGDEKNKNNNEDNENNNNSSEKNNNNNNNNNNNNDDNGNNN 344

Query:   313 QNIHHNVYNNTPT-DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
              N   N  NNT   D N K     +   N    +N + + V  +   N  P +       
Sbjct:   345 NNNSGNDNNNTTNNDSNNKNNSITTGNDNENIVNNDLPTTVVSNPGDNPPPADNGEEYLT 404

Query:   136 EKELNNIFVN-KIKNNNDAQSYKGIN 62
               + N++ ++     +N      G N
Sbjct:   405 LNDFNDLNIDWSTTGDNGELDLSGFN 430

 Score = 100 (35.2 bits), Expect = 0.024, P = 0.024
 Identities = 31/86 (36%), Positives = 40/86 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SNK N   DE+     KNN  DN +N N  +K+  N N NNN       DD    NNN++
Sbjct:   299 SNKNNNG-DEK----NKNNNEDNENNNNSSEKNNNNNNNNNN-----NNDDNGNNNNNNS 348

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKE 257
               +  +  N   N  NN+ T  N  E
Sbjct:   349 GNDNNNTTNNDSNNKNNSITTGNDNE 374

 Score = 94 (33.1 bits), Expect = 0.13, P = 0.12
 Identities = 36/106 (33%), Positives = 51/106 (48%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN- 335
             NK N   +E   +S++ N N+N +N N    D  N N NNN  G+D  +     +NN N 
Sbjct:   309 NKNNNEDNENNNNSSEKNNNNNNNNNN--NND-DNGNNNNNNSGNDNNNTTNNDSNNKNN 365

Query:   334 -FGEGQDIQNIHHN------VYN---NTPTDQNKKEYEEESSGFNNIQHD 215
                 G D +NI +N      V N   N P   N +EY   +  FN++  D
Sbjct:   366 SITTGNDNENIVNNDLPTTVVSNPGDNPPPADNGEEYLTLND-FNDLNID 414

 Score = 92 (32.4 bits), Expect = 0.23, P = 0.21
 Identities = 36/119 (30%), Positives = 50/119 (42%), Frame = -2

Query:   358 FFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             F  N++ N     +I +I +N+ NN  + +N K+   ES+  NN    N           
Sbjct:   261 FDDNDSGNNYNDINISSIENNINNNINSTKNGKDNNNESNKNNNGDEKNK---------- 310

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              NN   NE   ++ EK  NN   N   NNND     G NN      +NN+   N  N K
Sbjct:   311 -NNNEDNENNNNSSEKNNNNN--NNNNNNNDDN---GNNNNNNSGNDNNNTTNNDSNNK 363

 Score = 90 (31.7 bits), Expect = 0.41, P = 0.34
 Identities = 36/140 (25%), Positives = 58/140 (41%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             +D TK   +DN S  N +  +I +I  N NN + S        KN  DN  E     N  
Sbjct:   255 VDETKGF-DDNDSGNNYNDINISSIENNINNNINST-------KNGKDNNNESNKNNNGD 306

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN 122
                 NN   ++N     E+++  NN  ++N   +  + + +  N   N    D++ K   
Sbjct:   307 EKNKNNNEDNENNNNSSEKNNNNNNNNNNNNDDNGNNNNNNSGNDNNNTTNNDSNNKN-- 364

Query:   121 NIFVNKIKNNNDAQSYKGINN 59
                 N I   ND ++   +NN
Sbjct:   365 ----NSITTGNDNENI--VNN 379

 Score = 80 (28.2 bits), Expect = 6.2, P = 1.0
 Identities = 30/109 (27%), Positives = 52/109 (47%), Frame = -2

Query:   358 FFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             F  N++ N     +I +I +N+ NN  + +N K+   ES+  NN    N  K+  + + +
Sbjct:   261 FDDNDSGNNYNDINISSIENNINNNINSTKNGKDNNNESNKNNNGDEKN--KNNNEDNEN 318

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
             +NN   +E   + +    NN   N   NNN++ +    NN T   + NN
Sbjct:   319 NNNS--SEKNNNNNNNNNNNNDDNGNNNNNNSGND---NNNTTNNDSNN 362

 Score = 79 (27.8 bits), Expect = 8.1, P = 1.0
 Identities = 32/122 (26%), Positives = 52/122 (42%), Frame = -2

Query:   373 QXDDIFFKNNND---NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMK 203
             Q  D+ F + N    +   G D        +N T  D+ K  +++  SG NN    N   
Sbjct:   221 QPSDVMFNDLNSMDISMFSGLDSTGFDSTAFNAT-VDETKG-FDDNDSG-NNYNDINI-- 275

Query:   202 SPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDER 23
             S ++ ++++N         + +E   NN    K KNNN+       NN +   E+NN+  
Sbjct:   276 SSIENNINNNINSTKNGKDNNNESNKNNNGDEKNKNNNEDNENN--NNSS---EKNNNNN 330

Query:    22 YNQEN 8
              N  N
Sbjct:   331 NNNNN 335


>gi|160616 (M83791) trophozoite antigen [Plasmodium falciparum]
           Length = 109

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.0010, P = 0.0010
 Identities = 25/103 (24%), Positives = 48/103 (46%), Frame = -2

Query:   427 HKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEE 248
             HK D  + + +N+   S+   D   K+++++  + + + + +H   NN  +D N K    
Sbjct:     1 HKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHKSDNNHKSDHN 60

Query:   247 ESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
               S  NN + D+  KS  +   D N+   +    D++ K  NN
Sbjct:    61 HKSD-NNHKSDHNHKSDSNHKSDSNHKSDSNHKSDSNHKSDNN 102

 Score = 85 (29.9 bits), Expect = 0.0051, P = 0.0051
 Identities = 26/111 (23%), Positives = 53/111 (47%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             N +  +    S  N+++D N  + + HK D ++++ NN+   ++   D   K+++++  +
Sbjct:     5 NNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHKSDNNHKSDHNHKSD 64

Query:   325 GQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
                  + +H   +N  +D N K      S  N+ + DN  KS      DHN+
Sbjct:    65 NNHKSDHNHKSDSNHKSDSNHKSDSNHKSDSNH-KSDNNHKS------DHNH 109

 Score = 82 (28.9 bits), Expect = 0.011, P = 0.011
 Identities = 26/98 (26%), Positives = 47/98 (47%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             K++N++  +     + +H   +N  +D N K   +  S  NN + DN  KS  +   DHN
Sbjct:     2 KSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSD-NNHKSDNNHKSDNNHKSDHN 60

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQS-YKGINN 59
             +   N    D + K  +N   +K  +N+ + S +K  +N
Sbjct:    61 HKSDNNHKSDHNHKSDSN---HKSDSNHKSDSNHKSDSN 96

 Score = 81 (28.5 bits), Expect = 0.015, P = 0.015
 Identities = 24/105 (22%), Positives = 45/105 (42%), Frame = -2

Query:   433 NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEY 254
             N HK D  + + +N+   S+   D   K+++ +  +     + +H   NN  +D N K  
Sbjct:     5 NNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHKSDNNHKSDHNHKSD 64

Query:   253 EEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
                 S  N+ + D+  KS  +   D N+   +    D + K  +N
Sbjct:    65 NNHKSDHNH-KSDSNHKSDSNHKSDSNHKSDSNHKSDNNHKSDHN 108

 Score = 77 (27.1 bits), Expect = 0.17, P = 0.16
 Identities = 27/113 (23%), Positives = 52/113 (46%), Frame = -2

Query:   427 HKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEE 248
             HK D  + + +N+   S+   D   K+++++  + + + + +H   NN  +D N K    
Sbjct:     1 HKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHKSDNNHKSDHN 60

Query:   247 ESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNN 89
               S  NN + D+  KS  +   D N+        D++ K  +N   +K  NN+
Sbjct:    61 HKSD-NNHKSDHNHKSDSNHKSDSNH------KSDSNHKSDSN---HKSDNNH 103

 Score = 72 (25.3 bits), Expect = 1.8, P = 0.83
 Identities = 28/117 (23%), Positives = 57/117 (48%), Frame = -2

Query:   427 HKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEE 248
             HK D  + + +N+   S+   D   K+++++  + + + + +H   NN  +D N K    
Sbjct:     1 HKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHKSDNNHK---- 56

Query:   247 ESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA-HEKELNNIFVNKIKNNNDAQS 77
               S  N+ + DN  KS      DHN+   +    D+ H+ + N+   +  K++N+ +S
Sbjct:    57 --SDHNH-KSDNNHKS------DHNHKSDSNHKSDSNHKSDSNHKSDSNHKSDNNHKS 105

 Score = 71 (25.0 bits), Expect = 2.5, P = 0.92
 Identities = 27/101 (26%), Positives = 46/101 (45%), Frame = -2

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM-DHNNVPINEWPGDA-HEKE 128
             H   NN  +D N K      S  N+ + D+  KS   KHM D+N+   N    D  H+ +
Sbjct:     1 HKSDNNHKSDSNHKSDSNHKSDSNH-KSDHNHKSD-HKHMSDNNHKSDNNHKSDNNHKSD 58

Query:   127 LNNIFVNKIKNNNDAQS---YKGINNKTIFLEENNDERYNQEN 8
              N+   N  K++++ +S   +K  +N        +D  +  +N
Sbjct:    59 HNHKSDNNHKSDHNHKSDSNHKSDSNHKSDSNHKSDSNHKSDN 101


>gi|467292 (U07817) glutamine-asparagine rich protein [Dictyostelium
           discoideum]
           Length = 720

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.063, P = 0.061
 Identities = 24/86 (27%), Positives = 44/86 (51%), Frame = -2

Query:   469 TKNNRNDNISNKNVHKKDIQNINQNNNIVG-SDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             T NN N++ +N N +     N N NNNI   S+   + +  NNN+N+    +  N ++N 
Sbjct:   630 TNNNNNNHDNNYNGN-----NYNANNNINNYSNNNYNNYSNNNNNNYNNNNNNNNNNNNY 684

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDN 212
              NN  ++ N       ++ +N+  ++N
Sbjct:   685 GNNNYSNNNNNNNNYNNNNYNDYNNNN 711

 Score = 97 (34.1 bits), Expect = 0.11, P = 0.11
 Identities = 25/80 (31%), Positives = 40/80 (50%), Frame = -2

Query:   505 GNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             GN Y     I++  NN  +N SN N +  +  N N NNN   ++  ++ +  NNN+N   
Sbjct:   643 GNNYNANNNINNYSNNNYNNYSNNNNNNYNNNNNNNNNN---NNYGNNNYSNNNNNN--- 696

Query:   325 GQDIQNIHHNVYNNTPTDQN 266
               +  N ++N YNN   + N
Sbjct:   697 -NNYNNNNYNDYNNNNYNNN 715

 Score = 97 (34.1 bits), Expect = 0.11, P = 0.11
 Identities = 26/81 (32%), Positives = 40/81 (49%), Frame = -2

Query:   505 GNTYVDEEPIDSTKNNRNDNISNKNVHK-KDIQNINQNNNIVGSDQXDDIFFKNNNDNFG 329
             GN Y     I++  NN  +N SN N +   +  N N NNN  G++   +    NNN+N  
Sbjct:   643 GNNYNANNNINNYSNNNYNNYSNNNNNNYNNNNNNNNNNNNYGNNNYSN---NNNNNNNY 699

Query:   328 EGQDIQNIHHNVYNNTPTDQNK 263
                +  + ++N YNN   + NK
Sbjct:   700 NNNNYNDYNNNNYNNN-YNNNK 720

 Score = 95 (33.4 bits), Expect = 0.20, P = 0.18
 Identities = 24/89 (26%), Positives = 43/89 (48%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQ--NNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             +  NN +DN  N N +  +  NIN   NNN       ++  + NNN+N     +  N ++
Sbjct:   631 NNNNNNHDNNYNGNNYNAN-NNINNYSNNNYNNYSNNNNNNYNNNNNNNNNNNNYGNNNY 689

Query:   298 NVYNNTPTDQNKKEYEE-ESSGFNNIQHDN 212
             +  NN   + N   Y +  ++ +NN  ++N
Sbjct:   690 SNNNNNNNNYNNNNYNDYNNNNYNNNYNNN 719

 Score = 88 (31.0 bits), Expect = 1.4, P = 0.74
 Identities = 28/122 (22%), Positives = 60/122 (49%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNK--NVHKKDI--QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             +P   T +N+N   S +  + +  D+  +  + NNN   ++  D+ +   N +N+    +
Sbjct:   598 QPYWPTSSNQNYQYSEQYDSQYCNDVCCEGSHTNNN---NNNHDNNY---NGNNYNANNN 651

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQH--DNTMKSPVDKHMDHNNVPINEWPGD 143
             I N  +N YNN  ++ N   Y   ++  NN  +  +N   +  + + ++NN   N++  +
Sbjct:   652 INNYSNNNYNNY-SNNNNNNYNNNNNNNNNNNNYGNNNYSNNNNNNNNYNNNNYNDYNNN 710

Query:   142 AHEKELNN 119
              +    NN
Sbjct:   711 NYNNNYNN 718

 Score = 87 (30.6 bits), Expect = 0.0010, Sum P(2) = 0.0010
 Identities = 32/139 (23%), Positives = 57/139 (41%), Frame = -2

Query:   412 QNIN--QNNNIVGS-DQXDDIFF---KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYE 251
             QN N  QNNN   + D     ++    N N  + E  D Q  +      + T+ N   ++
Sbjct:   579 QNPNRFQNNNYQATEDTTSQPYWPTSSNQNYQYSEQYDSQYCNDVCCEGSHTNNNNNNHD 638

Query:   250 EESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNK--IKNNNDAQS 77
                +G N   ++N      + + +++N   N +  + +    NN + N     NNN+  +
Sbjct:   639 NNYNGNNYNANNNINNYSNNNYNNYSNNNNNNYNNNNNNNNNNNNYGNNNYSNNNNNNNN 698

Query:    76 YKGINNKTIFLEENNDERYN 17
             Y   NN   +   N +  YN
Sbjct:   699 YNN-NNYNDYNNNNYNNNYN 717

 Score = 85 (29.9 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 35/135 (25%), Positives = 53/135 (39%), Frame = -2

Query:   412 QNIN--QNNNIVGS-DQXDDIFF---KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYE 251
             QN N  QNNN   + D     ++    N N  + E  D Q  +      + T+ N   ++
Sbjct:   579 QNPNRFQNNNYQATEDTTSQPYWPTSSNQNYQYSEQYDSQYCNDVCCEGSHTNNNNNNHD 638

Query:   250 EESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYK 71
                +G NN   +N + +       +NN   N +  + +    NN   N   NN    +Y 
Sbjct:   639 NNYNG-NNYNANNNINN-----YSNNNY--NNYSNNNNNNYNNNNNNNNNNNNYGNNNYS 690

Query:    70 GINNKTIFLEENNDERYNQEN 8
               NN       NN   YN  N
Sbjct:   691 NNNNNNNNYNNNNYNDYNNNN 711

 Score = 85 (29.9 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 37/135 (27%), Positives = 58/135 (42%), Frame = -2

Query:   412 QNIN--QNNNIVGS-DQXDDIFF---KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYE 251
             QN N  QNNN   + D     ++    N N  + E  D Q  +      + T+ N   ++
Sbjct:   579 QNPNRFQNNNYQATEDTTSQPYWPTSSNQNYQYSEQYDSQYCNDVCCEGSHTNNNNNNHD 638

Query:   250 EESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYK 71
                +G NN   +N + +  + +  +NN   N           NN + N   NNN+  +Y 
Sbjct:   639 NNYNG-NNYNANNNINNYSNNN--YNNYSNNN----------NNNYNNNNNNNNNNNNY- 684

Query:    70 GINNKTIFLEENNDERYNQEN 8
             G NN +     NN+  YN  N
Sbjct:   685 GNNNYSN--NNNNNNNYNNNN 703

 Score = 82 (28.9 bits), Expect = 6.9, P = 1.0
 Identities = 18/65 (27%), Positives = 31/65 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N Y +    ++  NN N+N +N N    +  N N NNN   ++  +D    N N+N
Sbjct:   657 NNNYNNYSNNNN-NNYNNNNNNNNNNNNYGNNNYSNNNNNNNNYNNNNYNDYNNNNYNNN 715

Query:   334 FGEGQ 320
             +   +
Sbjct:   716 YNNNK 720

 Score = 78 (27.5 bits), Expect = 0.013, Sum P(2) = 0.013
 Identities = 31/117 (26%), Positives = 49/117 (41%), Frame = -2

Query:   403 NQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI---HHNVYNNTPTDQNKKEYEEESSGF 233
             + N N   S+Q D  +    ND   EG    N    H N YN    + N       ++ +
Sbjct:   604 SSNQNYQYSEQYDSQYC---NDVCCEGSHTNNNNNNHDNNYNGNNYNANNNINNYSNNNY 660

Query:   232 NNIQHDNT--MKSPVDKHMDHNNVPINEWPGDAHEKE-LNNIFVNKIKNNNDAQSYKGIN 62
             NN  ++N     +  + + ++NN   N +  + +     NN   N   NNN   +Y   N
Sbjct:   661 NNYSNNNNNNYNNNNNNNNNNNNYGNNNYSNNNNNNNNYNNNNYNDYNNNNYNNNYN--N 718

Query:    61 NK 56
             NK
Sbjct:   719 NK 720

 Score = 69 (24.3 bits), Expect = 0.0010, Sum P(2) = 0.0010
 Identities = 17/41 (41%), Positives = 23/41 (56%), Frame = -2

Query:   496 YVDEEPIDSTKNNRNDNISNKNVHKKD---IQN--INQNNN 389
             Y+     ++  NN+NDN +N N +K D   I N  IN NNN
Sbjct:    10 YIKNNNNNNKNNNKNDNNNNNNNNKNDCDEIYNNIINNNNN 50

 Score = 65 (22.9 bits), Expect = 0.0026, Sum P(2) = 0.0026
 Identities = 15/40 (37%), Positives = 21/40 (52%), Frame = -2

Query:   496 YVDEEPIDSTKNNRNDNISNKNVHKKDIQ----NINQNNN 389
             Y+     ++  NN+NDN +N N +K D      NI  NNN
Sbjct:    10 YIKNNNNNNKNNNKNDNNNNNNNNKNDCDEIYNNIINNNN 49

 Score = 58 (20.4 bits), Expect = 1.9, Sum P(2) = 0.86
 Identities = 28/105 (26%), Positives = 40/105 (38%), Frame = -2

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFN---NIQHDNTMKSPVDKHMDHNNVPINEW 152
             Q+     +N Y  T  D   + Y   SS  N   + Q+D+   + V     H N   N  
Sbjct:   579 QNPNRFQNNNYQATE-DTTSQPYWPTSSNQNYQYSEQYDSQYCNDVCCEGSHTNNNNNN- 636

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                 H+   N    N    NN+  +Y   NN   +   NN+  YN  N
Sbjct:   637 ----HDNNYNG---NNYNANNNINNYSN-NNYNNY-SNNNNNNYNNNN 675

 Score = 40 (14.1 bits), Expect = 0.88, Sum P(2) = 0.59
 Identities = 11/38 (28%), Positives = 17/38 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQ 398
             N  N   ++   D   NN  +N +NKN   +   N N+
Sbjct:    26 NNNNNNNNKNDCDEIYNNIINNNNNKNGEYEHETNSNK 63


>pir||F22845 hypothetical protein 6 - Trypanosoma brucei mitochondrion (SGC6)
            Length = 347

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0012, P = 0.0012
 Identities = 49/164 (29%), Positives = 84/164 (51%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKN-GFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIM 178
             ++I+++  FI  FF     F+IY +I   I I F+    +I    ++      +Y + +M
Sbjct:    84 YYIYILYNFICFFFAFGINFLIY-YIEFFIFITFHIFFDFISFSNYIYNYFGILYMENVM 142

Query:   179 IHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLS-FTKIVI--II 349
                ++   F+ +I  Y +    F FIFF I   RC+ I IM ++ +    F  I++  I+
Sbjct:   143 FCAYLFCLFYFVI--YFL----FCFIFFVI---RCLFIVIMDFLFFNFDIFVSILLCDIV 193

Query:   350 FKKDIIXLI*SHNIII--------LVNILNILFMNIFIANVVISIIFG*INWFLIY 493
             +   I  L+   N I          V IL +LF+ +F+   VI++ FG    FL+Y
Sbjct:   194 YLDFISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLFL---VINLFFGFT--FLVY 244

 Score = 93 (32.7 bits), Expect = 0.13, P = 0.12
 Identities = 44/170 (25%), Positives = 71/170 (41%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             F I+ I  FI I F     + + FI     I  YF   Y+   +F        Y  I  +
Sbjct:   103 FLIYYIEFFIFITFH----IFFDFISFSNYIYNYFGILYMENVMFCAYLFCLFYFVIYFL 158

Query:   182 HMFVDRTFHSIIMLYIIEAT*FFFIF-FFILISRCIIIYIMMYILYVLSFTKIVIIIFKK 358
               F+   F  I  L+I+     FF F  F+ I  C I+Y+    L +L F  I   I+  
Sbjct:   159 FCFI---FFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGF 215

Query:   359 DIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INW-FLIYISISFI 511
                 +I     ++L  ++N+ F   F+   +  I+   + W ++IY    +I
Sbjct:   216 FSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYI 267

 Score = 92 (32.4 bits), Expect = 0.17, P = 0.16
 Identities = 52/175 (29%), Positives = 82/175 (46%), Frame = +2

Query:     5 FIFLI-IPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             F F++ I FI IF    GF I  F     + +  FI  + I  L M  +  +IY  I ++
Sbjct:    35 FDFVVCITFIFIFVL--GFFIRIFF--SFVFVLLFITFFGICSLTMLFTGYYIYY-IYIL 89

Query:   182 HMFVDRTFHSII--MLYIIEAT*FF-FIFFFILISRCIIIYIMMYILYV--LSFTKIVII 346
             + F+   F   I  ++Y IE   F  F  FF  IS    IY    ILY+  + F   +  
Sbjct:    90 YNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMENVMFCAYLFC 149

Query:   347 IFKKDIIXLI*SHNIII---LVNILNILFMN--IFIANVVISIIF-G*INWFLIYISISF 508
             +F   I  L      +I    + I++ LF N  IF++ ++  I++   I+  L+Y +  F
Sbjct:   150 LFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIF 209

 Score = 85 (29.9 bits), Expect = 1.2, P = 0.69
 Identities = 48/160 (30%), Positives = 75/160 (46%), Frame = +2

Query:     5 FIFLI-IPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             F F++ I FI IF    GF I  F     + +  FI  + I  L M  +  +IY  I ++
Sbjct:    35 FDFVVCITFIFIFVL--GFFIRIFF--SFVFVLLFITFFGICSLTMLFTGYYIYY-IYIL 89

Query:   182 HMFVDRTFHSII--MLYIIEAT*FF-FIFFFILISRCIIIYIMMYILYV--LSFTKIVII 346
             + F+   F   I  ++Y IE   F  F  FF  IS    IY    ILY+  + F   +  
Sbjct:    90 YNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMENVMFCAYLFC 149

Query:   347 IFKKDIIXLI*SHNIII---LVNILNILFMN--IFIANVVISIIF 466
             +F   I  L      +I    + I++ LF N  IF++ ++  I++
Sbjct:   150 LFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVY 194

 Score = 85 (29.9 bits), Expect = 1.2, P = 0.69
 Identities = 48/171 (28%), Positives = 88/171 (51%), Frame = +2

Query:     5 FIFLIIP--FIIIF-FQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDII 175
             FIF +I   FI+I  F    F I+  I LC I+   FI+  ++ F F+     FIY    
Sbjct:   161 FIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIF---NFIYGFFS 217

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIM-MYILYVLSFTKIV--II 346
              + + +   F   ++L+++    F F F    I   ++ Y+  +Y++Y  S   ++  I+
Sbjct:   218 FV-IILGLLF---LLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAIL 273

Query:   347 IFKKDIIXLI*SHNIIILVNILNILFMNIFIANVV-ISI---IFG*I-NWFLIYISISF 508
             IF K I   +    + IL+  + I F + F+ + + +S+   IFG + N+ ++  SI +
Sbjct:   274 IFFKFIYFDVFFVFVFILILFI-ISFFSFFLKDFLFLSLYFDIFGSLYNYDILSYSIFY 331

 Score = 78 (27.5 bits), Expect = 8.0, P = 1.0
 Identities = 36/114 (31%), Positives = 59/114 (51%), Frame = +2

Query:     2 FFIFLIIP---FIIIFFQKNGFVIYAFI*--LCIIIIFYFINKYII*FLFMC-ISRPFIY 163
             FF F+II    F+++F   N F  + F+   + II+++Y    Y+I +   C I  P I 
Sbjct:   215 FFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMI-YSRSCYILMPAIL 273

Query:   164 RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFF---FILISRCIIIYIMMYILYVLSFT 331
                  I+  V   F  I++L+II     FF FF   F+ +S    I+  +Y   +LS++
Sbjct:   274 IFFKFIYFDVFFVFVFILILFIIS----FFSFFLKDFLFLSLYFDIFGSLYNYDILSYS 328


>gi|1136289 (U42597) histidine kinase A [Dictyostelium discoideum]
            Length = 2150

  Minus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.0017, P = 0.0017
 Identities = 39/153 (25%), Positives = 68/153 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG--EGQDI-QNI 305
             D   NN N+N +N N +  +  N N NNN   ++   + +  NNN  +   E  +I +++
Sbjct:   103 DINNNNNNNNNNNNNNNNNNNNNNNSNNNNNNNNNNKNNY--NNNYYYSPIENSNISKSL 160

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
               +V N  P + N       ++  NN    + +   V+   ++NN   N+ P + +    
Sbjct:   161 EESVLNQFPHNFNLNS--SNNNYLNNSSSLHNINQSVNSLSNNNNNQTNQQPINNNNNNN 218

Query:   124 NNIFVNKIKN-NNDAQSYKGINNKTIFLEENNDERYN 17
             NN   N   N NN   +  G NN  I       +R++
Sbjct:   219 NNNNNNNSNNSNNSNNNNNGNNNNNITDSPTKSKRHS 255

 Score = 111 (39.1 bits), Expect = 0.0063, P = 0.0062
 Identities = 35/140 (25%), Positives = 58/140 (41%), Frame = -2

Query:   418 DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN----TPTDQNKKEYE 251
             DI N N NNN   ++  ++    NNN+N     +  N + N YNN    +P + +     
Sbjct:   103 DINNNNNNNNNNNNNNNNN---NNNNNNSNNNNNNNNNNKNNYNNNYYYSPIENSNISKS 159

Query:   250 EESSGFNNIQHDNTMKSPVDKHMDHNNV--PINEWPGDAHEKELNNIFVNKIKNNNDAQS 77
              E S  N   H+  + S  + ++++++    IN+          N      I NNN+  +
Sbjct:   160 LEESVLNQFPHNFNLNSSNNNYLNNSSSLHNINQSVNSLSNNNNNQTNQQPINNNNNNNN 219

Query:    76 YKGINNKTIFLEENNDERYNQEN 8
                 NN       NN+   N  N
Sbjct:   220 NNNNNNSNNSNNSNNNNNGNNNN 242

 Score = 106 (37.3 bits), Expect = 0.0056, Sum P(2) = 0.0055
 Identities = 27/103 (26%), Positives = 45/103 (43%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             D +  D   NN N N SN N +  +  + N NNN   ++  ++    NNN+N     +  
Sbjct:   650 DNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNN 709

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNT-MKSPVDKH 185
             N ++N  NN   + N   Y   ++   +  H +  M S   K+
Sbjct:   710 NNNNNNNNNNNNNNNNNNYHNGATMMMSHNHQSIGMSSSPKKN 752

 Score = 99 (34.8 bits), Expect = 0.051, Sum P(2) = 0.049
 Identities = 36/145 (24%), Positives = 63/145 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN- 335
             N  N   +    ++  NN N+N SN N +  +    N NNN   S   +    K+  ++ 
Sbjct:   105 NNNNNNNNNNNNNNNNNNNNNNNSNNNNNNNNNNKNNYNNNYYYSPIENSNISKSLEESV 164

Query:   334 ---FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
                F    ++ + ++N  NN+ +  N  +     S  NN Q   T + P++ + ++NN  
Sbjct:   165 LNQFPHNFNLNSSNNNYLNNSSSLHNINQSVNSLSNNNNNQ---TNQQPINNNNNNNNNN 221

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQS 77
              N    +++    NN   N   NNN   S
Sbjct:   222 NNNNSNNSNNSNNNN---NGNNNNNITDS 247

 Score = 98 (34.5 bits), Expect = 0.071, Sum P(2) = 0.069
 Identities = 26/102 (25%), Positives = 44/102 (43%), Frame = -2

Query:   466 KNNRNDNISNK-NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             + N++DN  N  N +  +  N N NNN   +   ++    NNN N     +  N ++N  
Sbjct:   645 RRNKDDNDENDGNSNNTNSNNSNNNNNNNNNSSNNN----NNNSNNNNNNNNNNNNNNNN 700

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             NN   + N       ++  NN  ++N   +     M HN+  I
Sbjct:   701 NNNNNNNNNNNNNNNNNNNNNNNNNNNYHNGATMMMSHNHQSI 743

 Score = 98 (34.5 bits), Expect = 0.071, Sum P(2) = 0.069
 Identities = 28/103 (27%), Positives = 46/103 (44%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N GN+        +  NN N+N SN N +  +  N N NNN   ++  ++    NNN+N 
Sbjct:   654 NDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 713

Query:   331 GEGQDIQNIHHNV-YNNTPTDQNKKEYEEESSGFNNIQHDNTMK 203
                 +  N ++N  Y+N  T      +  +S G ++    N  K
Sbjct:   714 NNNNNNNNNNNNNNYHNGATMM--MSHNHQSIGMSSSPKKNNFK 755

 Score = 97 (34.1 bits), Expect = 0.39, P = 0.32
 Identities = 39/166 (23%), Positives = 63/166 (37%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N+      I +  NN N+N  N NV     +    N++   S Q  +    N  D+
Sbjct:   573 NNTNNSTTSNNNITTNNNNNNNNNINNNVLSTPRKRTKGNHSKTNSLQDFETSSMNGGDD 632

Query:   334 F--GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
                G G        N  +N   D N       +S  NN  ++N+  +  +   ++NN   
Sbjct:   633 SISGAGSGGSLRRRNKDDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNN--- 689

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N    + +    NN   N   NNN+  +    NN       NN+  +N
Sbjct:   690 NNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNN----NNNNNYHN 730

 Score = 93 (32.7 bits), Expect = 0.30, Sum P(2) = 0.26
 Identities = 24/93 (25%), Positives = 44/93 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N   +    +S  NN N+N +N N +  +  N N NNN   ++  ++    NNN+N
Sbjct:   670 NNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNNNNN 727

Query:   334 FGEGQDIQNIHHNV---YNNTPTDQNKKEYEEESS 239
             +  G  +   H++     +++P   N K +    S
Sbjct:   728 YHNGATMMMSHNHQSIGMSSSPKKNNFKPFSRNCS 762

 Score = 93 (32.7 bits), Expect = 1.2, P = 0.69
 Identities = 43/162 (26%), Positives = 66/162 (40%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNV--HKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ 320
             ++E  ++   +N N N SN N   +   + NINQ+ N +           NNN+N    Q
Sbjct:   160 LEESVLNQFPHNFNLNSSNNNYLNNSSSLHNINQSVNSLS----------NNNNNQTNQQ 209

Query:   319 DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA 140
              I N ++N  NN   + N       ++  NN  ++N   SP  K   H+    N      
Sbjct:   210 PINNNNNNNNNNNNNNSNNSNNSNNNNNGNN--NNNITDSPT-KSKRHSTYETNIG-SHQ 265

Query:   139 HEKELNNIFVN-------KIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               K + ++  N       K+KN   + S     N T     NN    N  N
Sbjct:   266 RRKSIQSLIANSAIHSFSKLKNKPLSSSTPSTVN-TCGAVNNNSNNNNNNN 315

 Score = 92 (32.4 bits), Expect = 1.6, P = 0.79
 Identities = 36/168 (21%), Positives = 64/168 (38%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N GN   +    +ST +N N   +N N +     N N NNN++ + +      K N+   
Sbjct:   565 NNGNNNNNNNTNNSTTSNNNITTNNNNNN-----NNNINNNVLSTPRKRT---KGNHSKT 616

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
                QD +    N  +++ +           +  +N ++D    +    + ++NN   N  
Sbjct:   617 NSLQDFETSSMNGGDDSISGAGSGGSLRRRNKDDNDENDGNSNNTNSNNSNNNNNNNNNS 676

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               + +    NN   N   NNN+  +    NN       NN+   N  N
Sbjct:   677 SNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 724

 Score = 91 (32.0 bits), Expect = 2.0, P = 0.87
 Identities = 35/158 (22%), Positives = 64/158 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQ--NNNIVGSDQXDDIFFKNNN 341
             SN  N   +++PI++  NN N+N +N + +  +  N N   NNN +              
Sbjct:   199 SNNNNNQTNQQPINNNNNNNNNNNNNNSNNSNNSNNNNNGNNNNNITDSPTKSKRHSTYE 258

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNK-KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
              N G  Q  ++I   + N+     +K K     SS  + +     + +  + + ++NN  
Sbjct:   259 TNIGSHQRRKSIQSLIANSAIHSFSKLKNKPLSSSTPSTVNTCGAVNNNSNNNNNNNNNS 318

Query:   163 ---INEWPGD-AHEKELNNIFVNKIKNNNDAQSYKGIN 62
                +   P D + +  +N I       NN  +S  G N
Sbjct:   319 TGSLGAIPMDRSFDGNINTITEESTGGNNSPRSNCGSN 356

 Score = 90 (31.7 bits), Expect = 0.75, Sum P(2) = 0.53
 Identities = 31/131 (23%), Positives = 54/131 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGS--DQXDDIFFKN-- 347
             +N  N   +    ++  NN N N  N N +   I+N N + ++  S  +Q    F  N  
Sbjct:   118 NNNNNNNNNNSNNNNNNNNNNKNNYNNNYYYSPIENSNISKSLEESVLNQFPHNFNLNSS 177

Query:   346 NNDNFGEGQDIQNIHHNVY-----NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM 182
             NN+       + NI+ +V      NN  T+Q        ++  NN  + N   +  + + 
Sbjct:   178 NNNYLNNSSSLHNINQSVNSLSNNNNNQTNQQPINNNNNNNNNNNNNNSNNSNNSNNNNN 237

Query:   181 DHNNVPINEWP 149
              +NN  I + P
Sbjct:   238 GNNNNNITDSP 248

 Score = 87 (30.6 bits), Expect = 6.1, P = 1.0
 Identities = 30/119 (25%), Positives = 50/119 (42%), Frame = -2

Query:   355 FKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH 176
             F +N        DI N ++N  NN   + N       S+  NN  ++N  K+  + +  +
Sbjct:    91 FIHNVSPTSPSYDINNNNNNNNNNNNNNNNNNNNNNNSNNNNN--NNNNNKNNYNNNYYY 148

Query:   175 NNVPINEWPGDAHEKELN----NIFVNKIKNN--NDAQSYKGINNKTIFLEENNDERYNQ 14
             + +  +       E  LN    N  +N   NN  N++ S   IN     L  NN+ + NQ
Sbjct:   149 SPIENSNISKSLEESVLNQFPHNFNLNSSNNNYLNNSSSLHNINQSVNSLSNNNNNQTNQ 208

Query:    13 E 11
             +
Sbjct:   209 Q 209

 Score = 87 (30.6 bits), Expect = 6.1, P = 1.0
 Identities = 40/144 (27%), Positives = 64/144 (44%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDD-IFFKNNNDNFGEGQDIQNIHHNVYNNTP 278
             N +I+  N++  +  NIN NNN   S+  ++ +  +NNN N        NI     N   
Sbjct:   405 NFHINVSNLNNNNNNNINPNNNPNNSNNSNNNVSPRNNNHNISPRGS--NISPRSNNGGS 462

Query:   277 TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIF--VNK 104
             T  + +     ++  NNI ++N +  P +     N  P N  P       LN+    V+ 
Sbjct:   463 TTISPRNISNNNNIINNINNNNILTPPRNSPRLENVNPTNS-PR-LLATSLNSTLPIVSS 520

Query:   103 I-KNNNDAQSYKGINNKTIFLEENNDER 23
             +  +NN+ QS    NN T     NN+ R
Sbjct:   521 LTSSNNNNQS----NNNTNPSINNNNGR 544

 Score = 86 (30.3 bits), Expect = 7.9, P = 1.0
 Identities = 43/171 (25%), Positives = 70/171 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDN----ISNKNVHKKDIQ----NINQNNNIVGSDQXDDI 359
             +N+ N   +  P  +  N RN +    IS + +  K +     N N NNN   S   ++ 
Sbjct:   527 NNQSNN--NTNPSINNNNGRNGHCIQTISEEILGNKPVVYNNGNNNNNNNTNNSTTSNNN 584

Query:   358 FFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESS--GFNNIQHDNTMKSPVDKH 185
                NNN+N     +  NI++NV + TP  + K  + + +S   F     +    S     
Sbjct:   585 ITTNNNNN-----NNNNINNNVLS-TPRKRTKGNHSKTNSLQDFETSSMNGGDDSISGAG 638

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                +    N+   D ++   NN   N   NNN+  +    NN       NN+   N  N
Sbjct:   639 SGGSLRRRNKDDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNN 697

 Score = 84 (29.6 bits), Expect = 4.0, Sum P(2) = 0.98
 Identities = 25/88 (28%), Positives = 39/88 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             SN  N   +++PI++  NN N+N +N N +  +  N N NNN  G          NNN+N
Sbjct:   199 SNNNNNQTNQQPINNNNNNNNNN-NNNNSNNSN--NSNNNNN--G----------NNNNN 243

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYE 251
               +       H     N  + Q +K  +
Sbjct:   244 ITDSPTKSKRHSTYETNIGSHQRRKSIQ 271

 Score = 47 (16.5 bits), Expect = 0.0056, Sum P(2) = 0.0055
 Identities = 13/41 (31%), Positives = 21/41 (51%), Frame = -2

Query:   127 LNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             LNN   N   NNN+  +    NN +  +  ++ + Y+ ENE
Sbjct:  1714 LNN---NNNNNNNNNNNNNNSNNSSSIISPSSLD-YSDENE 1750


>gi|2393951 (AF012944) ORF DG1053 [Dictyostelium discoideum]
            Length = 565

  Minus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0017, P = 0.0017
 Identities = 38/150 (25%), Positives = 70/150 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST----KNNRNDNISNKNVH-KKDIQNINQNNNIVGSDQXDDIFFK 350
             S+  +T    EPI +T     NN  +NI N N +  +D  N N NNN   ++  ++    
Sbjct:   249 SSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNNNNNN---- 304

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM---KSPVDKHMD 179
             NNN+N     +  N ++N  NN  + + +KE     S  +N+ +   +    +  D +  
Sbjct:   305 NNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDTNSS 364

Query:   178 HNNVP-INEWPGDAHEKELNNIFVNKIKNNNDAQ 80
              N++  ++     A E++  + F N I  + + Q
Sbjct:   365 ANSIETVSVTSAIAAEEKDASSFFNNISASQELQ 398

 Score = 108 (38.0 bits), Expect = 0.0033, P = 0.0033
 Identities = 41/150 (27%), Positives = 66/150 (44%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQ 269
             I N  +   ++ N + +++IVG D  D+    NNN DN     +I NI  N  NNT  + 
Sbjct:   179 IENPILVSDNVVN-SLSDSIVGKDD-DETSPNNNNIDNIDNIDNIDNIDDN-NNNTNNNN 235

Query:   268 NKKEYEEES-SGFNNIQHDNTMKSPV------DKHMDHNNVPINEWPGDAHEKELNNIFV 110
             N    E E+ S  ++ +H      P+        + + NN+ IN     + + + +N   
Sbjct:   236 NSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNI-INNNENISRDDDNSNSNN 294

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             N   NNN+  +    NN       NN+   N  N
Sbjct:   295 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 328

 Score = 107 (37.7 bits), Expect = 0.0044, P = 0.0044
 Identities = 37/107 (34%), Positives = 52/107 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST---KNNRNDN-ISNKNVH-KKDIQNINQNNNIVGSDQXDDIFFK 350
             S+  +T    EPI +T    NN N+N I N N +  +D  N N NNN   ++        
Sbjct:   249 SSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNN-------- 300

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPV 194
             NNN+N     +  N ++N  NN   + N  E E+E S F +   DN   S V
Sbjct:   301 NNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFS-SDDNVNNSEV 351

 Score = 107 (37.7 bits), Expect = 0.0044, P = 0.0044
 Identities = 43/154 (27%), Positives = 68/154 (44%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQ 269
             I N  +   ++ N + +++IVG D  D+    NNN DN     +I NI  N  NNT  + 
Sbjct:   179 IENPILVSDNVVN-SLSDSIVGKDD-DETSPNNNNIDNIDNIDNIDNIDDN-NNNTNNNN 235

Query:   268 NKKEYEEES-SGFNNIQHDNTMKSPV------DKHMDHNNVPINEWPGDAHEKELNNIFV 110
             N    E E+ S  ++ +H      P+        + + NN+ IN     + + + +N   
Sbjct:   236 NSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNI-INNNENISRDDDNSNSNN 294

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN--EK 2
             N   NNN+  +    NN       NN+   N  N  EK
Sbjct:   295 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEK 332

 Score = 107 (37.7 bits), Expect = 0.0044, P = 0.0044
 Identities = 38/167 (22%), Positives = 76/167 (45%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRN-DNISN-KNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNF 332
             ++ V ++  +++ NN N DNI N  N+   D  N N  NNN  G+ + +++   ++N++ 
Sbjct:   195 DSIVGKDDDETSPNNNNIDNIDNIDNIDNIDDNNNNTNNNNNSGNQENENLSTSSSNEHT 254

Query:   331 -GEGQDI--------QNIHHNVYNNTPT----DQNKKEYEEESSGFNNIQHDNTMKSPVD 191
               + + I         N  +N+ NN       D N       ++  NN  ++N   +  +
Sbjct:   255 PAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNN 314

Query:   190 KHMDHNNVPINEWPGDAHEKELNNIFVNKIK-NNNDAQSYKGINNKT 53
              + ++NN   N       EKE+++ F +    NN++   +   N+ T
Sbjct:   315 NNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDT 361

 Score = 104 (36.6 bits), Expect = 0.011, P = 0.011
 Identities = 43/168 (25%), Positives = 70/168 (41%), Frame = -2

Query:   487 EEPI---DSTKNNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEG 323
             E PI   D+  N+ +D+I  K+  +    N N +N  NI   D  DD     NN+N    
Sbjct:   180 ENPILVSDNVVNSLSDSIVGKDDDETSPNNNNIDNIDNIDNIDNIDDNNNNTNNNNNSGN 239

Query:   322 QDIQNIHHNVYN-NTPTDQNKKEYEEESSGFNNIQH-----DNTMKSPVDKHMDHNNVPI 161
             Q+ +N+  +  N +TP          E S  NN  +     +N  +   + + ++NN   
Sbjct:   240 QENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNN 299

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N    + +    NN   N   NNN+  +  G   K I    ++D+  N
Sbjct:   300 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVN 347

 Score = 103 (36.3 bits), Expect = 0.015, P = 0.015
 Identities = 43/156 (27%), Positives = 66/156 (42%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQ 269
             I N  +   ++ N + +++IVG D  D+    NNN DN     +I NI  N  NNT  + 
Sbjct:   179 IENPILVSDNVVN-SLSDSIVGKDD-DETSPNNNNIDNIDNIDNIDNIDDN-NNNTNNNN 235

Query:   268 NKKEYEEES-SGFNNIQHDNTMKSPV------DKHMDHNNVPINEWP---GDAHEKELNN 119
             N    E E+ S  ++ +H      P+        + + NN+  N       D +    NN
Sbjct:   236 NSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNN 295

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                N   NNN+  +    NN       NN+   + E EK
Sbjct:   296 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEK 334

 Score = 99 (34.8 bits), Expect = 0.046, P = 0.045
 Identities = 43/166 (25%), Positives = 69/166 (41%), Frame = -2

Query:   487 EEPI---DSTKNNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEG 323
             E PI   D+  N+ +D+I  K+  +    N N +N  NI   D  DD     NN+N    
Sbjct:   180 ENPILVSDNVVNSLSDSIVGKDDDETSPNNNNIDNIDNIDNIDNIDDNNNNTNNNNNSGN 239

Query:   322 QDIQNIHHNVYN-NTPTDQNKKEYEEESSGFNNIQH-----DNTMKSPVDKHMDHNNVPI 161
             Q+ +N+  +  N +TP          E S  NN  +     +N  +   + + ++NN   
Sbjct:   240 QENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNN 299

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTI---FLEENN 32
             N    + +    NN   N   NNN+  +  G   K I   F  ++N
Sbjct:   300 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDN 345

 Score = 97 (34.1 bits), Expect = 0.083, P = 0.079
 Identities = 30/142 (21%), Positives = 60/142 (42%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ID   NN N+N ++ N   +++   + N +     Q + I       N     +I N + 
Sbjct:   224 IDDNNNNTNNNNNSGNQENENLSTSSSNEHTPA--QSEPIVTTTEGSNNNNENNIINNNE 281

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             N+  +   D N       ++  NN  ++N   +  + + ++NN   N       EKE+++
Sbjct:   282 NISRD---DDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISS 338

Query:   118 IFVNKIK-NNNDAQSYKGINNKT 53
              F +    NN++   +   N+ T
Sbjct:   339 FFSSDDNVNNSEVLFFNSTNSDT 361

 Score = 95 (33.4 bits), Expect = 0.15, P = 0.14
 Identities = 37/145 (25%), Positives = 61/145 (42%), Frame = -2

Query:   442 SNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN-NTPTDQ 269
             SN  +    I+N I  ++N+V S   D I  K++++      +I NI  N+ N +   D 
Sbjct:   170 SNIGIVDSLIENPILVSDNVVNS-LSDSIVGKDDDETSPNNNNIDNID-NIDNIDNIDDN 227

Query:   268 NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNN 89
             N       +SG  N +++N   S  ++H    + PI      ++    NNI  N    + 
Sbjct:   228 NNNTNNNNNSG--NQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISR 285

Query:    88 DAQSYKGINNKTIFLEENNDERYNQEN 8
             D  +    NN       NN+   N  N
Sbjct:   286 DDDNSNSNNNNNNNNNNNNNNNNNNNN 312

 Score = 86 (30.3 bits), Expect = 1.7, P = 0.83
 Identities = 22/85 (25%), Positives = 40/85 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N   D++  +S  NN N+N +N N +  +  N N NNN   ++  ++   K    +
Sbjct:   278 NNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEIS 337

Query:   334 --FGEGQDIQNIHHNVYNNTPTDQN 266
               F    ++ N     +N+T +D N
Sbjct:   338 SFFSSDDNVNNSEVLFFNSTNSDTN 362

 Score = 86 (30.3 bits), Expect = 1.7, P = 0.83
 Identities = 29/99 (29%), Positives = 48/99 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N+ N   + E I    +N N N +N N +  +  N N NNN   ++  ++    NNN+N
Sbjct:   271 NNENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNNNNN 328

Query:   334 FGEGQ-DIQNIHH---NVYNNTPTDQNKKEYEEESSGFNNIQ 221
              GE + +I +      NV N+     N    +  SS  N+I+
Sbjct:   329 SGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDTNSSA-NSIE 369

 Score = 83 (29.2 bits), Expect = 3.9, P = 0.98
 Identities = 41/164 (25%), Positives = 69/164 (42%), Frame = -2

Query:   487 EEPIDSTKN--NRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             E+P     N    N+ I    +V +   Q I   N+I+   Q     F +++ N G    
Sbjct:   118 EQPTQPFSNLIQPNEVIELQSDVIQHQNQVIEHQNSIIEQHQRHQHQFSSDSSNIGIVDS 177

Query:   316 -IQN---IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
              I+N   +  NV N+       K+ +E S   NNI + + + + +D   D+NN   N   
Sbjct:   178 LIENPILVSDNVVNSLSDSIVGKDDDETSPNNNNIDNIDNIDN-IDNIDDNNNNTNNN-- 234

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              ++  +E  N+  +    +  AQS + I   T     NN+      NE
Sbjct:   235 NNSGNQENENLSTSSSNEHTPAQS-EPIVTTTEGSNNNNENNIINNNE 281

 Score = 82 (28.9 bits), Expect = 5.1, P = 0.99
 Identities = 24/93 (25%), Positives = 43/93 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ-------- 320
             ++  NN N+N +N N +  +  N N NNN  G  + +   F +++DN    +        
Sbjct:   299 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTN 358

Query:   319 -DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI 224
              D  +  +++   + T     E ++ SS FNNI
Sbjct:   359 SDTNSSANSIETVSVTSAIAAEEKDASSFFNNI 391

 Score = 82 (28.9 bits), Expect = 5.1, P = 0.99
 Identities = 26/96 (27%), Positives = 40/96 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQX----DDIFFKN 347
             +N GN   +E    S+ N      S   V   +  N N  NNI+ +++     DD    N
Sbjct:   235 NNSGNQE-NENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSN 293

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSG 236
             NN+N     +  N ++N  NN   + N       +SG
Sbjct:   294 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSG 330


>gi|2425143 (AF020407) WimA [Dictyostelium discoideum]
            Length = 565

  Minus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0017, P = 0.0017
 Identities = 38/150 (25%), Positives = 70/150 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST----KNNRNDNISNKNVH-KKDIQNINQNNNIVGSDQXDDIFFK 350
             S+  +T    EPI +T     NN  +NI N N +  +D  N N NNN   ++  ++    
Sbjct:   249 SSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNNNNNN---- 304

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM---KSPVDKHMD 179
             NNN+N     +  N ++N  NN  + + +KE     S  +N+ +   +    +  D +  
Sbjct:   305 NNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDTNSS 364

Query:   178 HNNVP-INEWPGDAHEKELNNIFVNKIKNNNDAQ 80
              N++  ++     A E++  + F N I  + + Q
Sbjct:   365 ANSIETVSVTSAIAAEEKDASSFFNNISASQELQ 398

 Score = 108 (38.0 bits), Expect = 0.0033, P = 0.0033
 Identities = 41/150 (27%), Positives = 66/150 (44%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQ 269
             I N  +   ++ N + +++IVG D  D+    NNN DN     +I NI  N  NNT  + 
Sbjct:   179 IENPILVSDNVVN-SLSDSIVGKDD-DETSPNNNNIDNIDNIDNIDNIDDN-NNNTNNNN 235

Query:   268 NKKEYEEES-SGFNNIQHDNTMKSPV------DKHMDHNNVPINEWPGDAHEKELNNIFV 110
             N    E E+ S  ++ +H      P+        + + NN+ IN     + + + +N   
Sbjct:   236 NSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNI-INNNENISRDDDNSNSNN 294

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             N   NNN+  +    NN       NN+   N  N
Sbjct:   295 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 328

 Score = 107 (37.7 bits), Expect = 0.0044, P = 0.0044
 Identities = 37/107 (34%), Positives = 52/107 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST---KNNRNDN-ISNKNVH-KKDIQNINQNNNIVGSDQXDDIFFK 350
             S+  +T    EPI +T    NN N+N I N N +  +D  N N NNN   ++        
Sbjct:   249 SSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNN-------- 300

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPV 194
             NNN+N     +  N ++N  NN   + N  E E+E S F +   DN   S V
Sbjct:   301 NNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFS-SDDNVNNSEV 351

 Score = 107 (37.7 bits), Expect = 0.0044, P = 0.0044
 Identities = 43/154 (27%), Positives = 68/154 (44%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQ 269
             I N  +   ++ N + +++IVG D  D+    NNN DN     +I NI  N  NNT  + 
Sbjct:   179 IENPILVSDNVVN-SLSDSIVGKDD-DETSPNNNNIDNIDNIDNIDNIDDN-NNNTNNNN 235

Query:   268 NKKEYEEES-SGFNNIQHDNTMKSPV------DKHMDHNNVPINEWPGDAHEKELNNIFV 110
             N    E E+ S  ++ +H      P+        + + NN+ IN     + + + +N   
Sbjct:   236 NSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNI-INNNENISRDDDNSNSNN 294

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN--EK 2
             N   NNN+  +    NN       NN+   N  N  EK
Sbjct:   295 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEK 332

 Score = 107 (37.7 bits), Expect = 0.0044, P = 0.0044
 Identities = 38/167 (22%), Positives = 76/167 (45%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRN-DNISN-KNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNF 332
             ++ V ++  +++ NN N DNI N  N+   D  N N  NNN  G+ + +++   ++N++ 
Sbjct:   195 DSIVGKDDDETSPNNNNIDNIDNIDNIDNIDDNNNNTNNNNNSGNQENENLSTSSSNEHT 254

Query:   331 -GEGQDI--------QNIHHNVYNNTPT----DQNKKEYEEESSGFNNIQHDNTMKSPVD 191
               + + I         N  +N+ NN       D N       ++  NN  ++N   +  +
Sbjct:   255 PAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNN 314

Query:   190 KHMDHNNVPINEWPGDAHEKELNNIFVNKIK-NNNDAQSYKGINNKT 53
              + ++NN   N       EKE+++ F +    NN++   +   N+ T
Sbjct:   315 NNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDT 361

 Score = 104 (36.6 bits), Expect = 0.011, P = 0.011
 Identities = 43/168 (25%), Positives = 70/168 (41%), Frame = -2

Query:   487 EEPI---DSTKNNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEG 323
             E PI   D+  N+ +D+I  K+  +    N N +N  NI   D  DD     NN+N    
Sbjct:   180 ENPILVSDNVVNSLSDSIVGKDDDETSPNNNNIDNIDNIDNIDNIDDNNNNTNNNNNSGN 239

Query:   322 QDIQNIHHNVYN-NTPTDQNKKEYEEESSGFNNIQH-----DNTMKSPVDKHMDHNNVPI 161
             Q+ +N+  +  N +TP          E S  NN  +     +N  +   + + ++NN   
Sbjct:   240 QENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNN 299

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N    + +    NN   N   NNN+  +  G   K I    ++D+  N
Sbjct:   300 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVN 347

 Score = 103 (36.3 bits), Expect = 0.015, P = 0.015
 Identities = 43/156 (27%), Positives = 66/156 (42%), Frame = -2

Query:   445 ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQ 269
             I N  +   ++ N + +++IVG D  D+    NNN DN     +I NI  N  NNT  + 
Sbjct:   179 IENPILVSDNVVN-SLSDSIVGKDD-DETSPNNNNIDNIDNIDNIDNIDDN-NNNTNNNN 235

Query:   268 NKKEYEEES-SGFNNIQHDNTMKSPV------DKHMDHNNVPINEWP---GDAHEKELNN 119
             N    E E+ S  ++ +H      P+        + + NN+  N       D +    NN
Sbjct:   236 NSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNN 295

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                N   NNN+  +    NN       NN+   + E EK
Sbjct:   296 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEK 334

 Score = 99 (34.8 bits), Expect = 0.046, P = 0.045
 Identities = 43/166 (25%), Positives = 69/166 (41%), Frame = -2

Query:   487 EEPI---DSTKNNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEG 323
             E PI   D+  N+ +D+I  K+  +    N N +N  NI   D  DD     NN+N    
Sbjct:   180 ENPILVSDNVVNSLSDSIVGKDDDETSPNNNNIDNIDNIDNIDNIDDNNNNTNNNNNSGN 239

Query:   322 QDIQNIHHNVYN-NTPTDQNKKEYEEESSGFNNIQH-----DNTMKSPVDKHMDHNNVPI 161
             Q+ +N+  +  N +TP          E S  NN  +     +N  +   + + ++NN   
Sbjct:   240 QENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNN 299

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTI---FLEENN 32
             N    + +    NN   N   NNN+  +  G   K I   F  ++N
Sbjct:   300 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDN 345

 Score = 97 (34.1 bits), Expect = 0.083, P = 0.079
 Identities = 30/142 (21%), Positives = 60/142 (42%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ID   NN N+N ++ N   +++   + N +     Q + I       N     +I N + 
Sbjct:   224 IDDNNNNTNNNNNSGNQENENLSTSSSNEHTPA--QSEPIVTTTEGSNNNNENNIINNNE 281

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             N+  +   D N       ++  NN  ++N   +  + + ++NN   N       EKE+++
Sbjct:   282 NISRD---DDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISS 338

Query:   118 IFVNKIK-NNNDAQSYKGINNKT 53
              F +    NN++   +   N+ T
Sbjct:   339 FFSSDDNVNNSEVLFFNSTNSDT 361

 Score = 95 (33.4 bits), Expect = 0.15, P = 0.14
 Identities = 37/145 (25%), Positives = 61/145 (42%), Frame = -2

Query:   442 SNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN-NTPTDQ 269
             SN  +    I+N I  ++N+V S   D I  K++++      +I NI  N+ N +   D 
Sbjct:   170 SNIGIVDSLIENPILVSDNVVNS-LSDSIVGKDDDETSPNNNNIDNID-NIDNIDNIDDN 227

Query:   268 NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNN 89
             N       +SG  N +++N   S  ++H    + PI      ++    NNI  N    + 
Sbjct:   228 NNNTNNNNNSG--NQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISR 285

Query:    88 DAQSYKGINNKTIFLEENNDERYNQEN 8
             D  +    NN       NN+   N  N
Sbjct:   286 DDDNSNSNNNNNNNNNNNNNNNNNNNN 312

 Score = 86 (30.3 bits), Expect = 1.7, P = 0.83
 Identities = 22/85 (25%), Positives = 40/85 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N   D++  +S  NN N+N +N N +  +  N N NNN   ++  ++   K    +
Sbjct:   278 NNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEIS 337

Query:   334 --FGEGQDIQNIHHNVYNNTPTDQN 266
               F    ++ N     +N+T +D N
Sbjct:   338 SFFSSDDNVNNSEVLFFNSTNSDTN 362

 Score = 86 (30.3 bits), Expect = 1.7, P = 0.83
 Identities = 29/99 (29%), Positives = 48/99 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N+ N   + E I    +N N N +N N +  +  N N NNN   ++  ++    NNN+N
Sbjct:   271 NNENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNNNNN 328

Query:   334 FGEGQ-DIQNIHH---NVYNNTPTDQNKKEYEEESSGFNNIQ 221
              GE + +I +      NV N+     N    +  SS  N+I+
Sbjct:   329 SGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDTNSSA-NSIE 369

 Score = 83 (29.2 bits), Expect = 3.9, P = 0.98
 Identities = 41/164 (25%), Positives = 69/164 (42%), Frame = -2

Query:   487 EEPIDSTKN--NRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             E+P     N    N+ I    +V +   Q I   N+I+   Q     F +++ N G    
Sbjct:   118 EQPTQPFSNLIQPNEVIELQSDVIQHQNQVIEHQNSIIEQHQRHQHQFSSDSSNIGIVDS 177

Query:   316 -IQN---IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
              I+N   +  NV N+       K+ +E S   NNI + + + + +D   D+NN   N   
Sbjct:   178 LIENPILVSDNVVNSLSDSIVGKDDDETSPNNNNIDNIDNIDN-IDNIDDNNNNTNNN-- 234

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              ++  +E  N+  +    +  AQS + I   T     NN+      NE
Sbjct:   235 NNSGNQENENLSTSSSNEHTPAQS-EPIVTTTEGSNNNNENNIINNNE 281

 Score = 82 (28.9 bits), Expect = 5.1, P = 0.99
 Identities = 24/93 (25%), Positives = 43/93 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ-------- 320
             ++  NN N+N +N N +  +  N N NNN  G  + +   F +++DN    +        
Sbjct:   299 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTN 358

Query:   319 -DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI 224
              D  +  +++   + T     E ++ SS FNNI
Sbjct:   359 SDTNSSANSIETVSVTSAIAAEEKDASSFFNNI 391

 Score = 82 (28.9 bits), Expect = 5.1, P = 0.99
 Identities = 26/96 (27%), Positives = 40/96 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQX----DDIFFKN 347
             +N GN   +E    S+ N      S   V   +  N N  NNI+ +++     DD    N
Sbjct:   235 NNSGNQE-NENLSTSSSNEHTPAQSEPIVTTTEGSNNNNENNIINNNENISRDDDNSNSN 293

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSG 236
             NN+N     +  N ++N  NN   + N       +SG
Sbjct:   294 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSG 330


>pir||E22845 hypothetical protein 4 - Trypanosoma brucei mitochondrion (SGC6)
            Length = 445

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0018, P = 0.0018
 Identities = 41/170 (24%), Positives = 89/170 (52%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVI-YAFI*LCIIIIFYFINKYI-I*FLFMCISRPF-IYRDI 172
             +++  +I FI++F      ++ Y F  LC      F  +++ I  LF  +   F +Y  I
Sbjct:   134 YYMLNLINFILLFILLYFMILNYCFF-LCDFCFLVFDEEWLGILCLFYTLLILFKLY--I 190

Query:   173 IMIHMFVDRTFHSI-IMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYV--LSFTKIVI 343
               + +F+++ +  + + ++I   T F+ +F FILI   +I +I  YIL++  L F     
Sbjct:   191 AFLILFMEQLYIRLGVFIFIYMLT-FYILFCFILII-LLISFIYFYILFIKLLLFQSCTC 248

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
             ++   +   ++   +++ ++++ N  F+ +   +    I +  +N+ LIY SIS +
Sbjct:   249 VLIGLNSFAIV---SLLFVLSVNNFCFLFLIFISTKNYIFYLYLNFHLIY-SISLV 300

 Score = 104 (36.6 bits), Expect = 0.0080, P = 0.0080
 Identities = 36/160 (22%), Positives = 81/160 (50%), Frame = +2

Query:    14 LIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*-FLFMCISRPFIYRDIIMIHMF 190
             L I F+I+F ++       +I L + I  Y +  YI+  F+ + +   FIY  I+ I + 
Sbjct:   188 LYIAFLILFMEQ------LYIRLGVFIFIYMLTFYILFCFILIILLISFIYFYILFIKLL 241

Query:   191 VDRT----------FHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMM--YILYVLSFTK 334
             + ++          F  + +L+++    F F+F   + ++  I Y+ +  +++Y +S   
Sbjct:   242 LFQSCTCVLIGLNSFAIVSLLFVLSVNNFCFLFLIFISTKNYIFYLYLNFHLIYSISLVL 301

Query:   335 IVIIIFKKDIIXLI*-SHNI-IILVNILNILFMNIFIANVVISIIF 466
             ++II +   I  +    +N    L+N +   F N F+ +++++ +F
Sbjct:   302 LIIIYYFFIIYNIFDFKYNENYFLINFIFFSFFNNFLISLLLACLF 347

 Score = 98 (34.5 bits), Expect = 0.045, P = 0.044
 Identities = 41/163 (25%), Positives = 81/163 (49%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFI---NKYII*FLFMCISRPFIYRDII 175
             FIFLII   II        + +F  L ++I  ++I   + YI  F+F+ +   F++    
Sbjct:    14 FIFLIIYSFIILCDYTTLTLLSFDLLWLLINLFWITLLDSYIC-FIFILL---FLFC-FT 68

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFK 355
             +   F+      + ++ II+   +  IF FI I+  III I+  I  +L F  ++   F 
Sbjct:    69 LFFCFLSFDTRFLFIIIIIQ---YIIIFLFIFINHIIIISILFEIFSLLLFLLLMSSRFG 125

Query:   356 KDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INW-FLIY 493
               I+ L        ++N++N + + I +  ++++  F   ++ FL++
Sbjct:   126 YKILVLW----YYYMLNLINFILLFILLYFMILNYCFFLCDFCFLVF 168

 Score = 94 (33.1 bits), Expect = 0.14, P = 0.13
 Identities = 51/168 (30%), Positives = 74/168 (44%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIM- 178
             F IF+     I +   N  +IY+   + +III+YF   Y I F F      F+   I   
Sbjct:   274 FLIFISTKNYIFYLYLNFHLIYSISLVLLIIIYYFFIIYNI-FDFKYNENYFLINFIFFS 332

Query:   179 -IHMFVDRTFHSIIMLYI--IEAT*FFFIFFFILISR----CIII----YIMMYILYVLS 325
               + F+     + + L I  I     FFI  F L+ +    CI I     I + I+Y+  
Sbjct:   333 FFNNFLISLLLACLFLCIGAIPIVFGFFIKVFCLLLQLSYLCICIGFFFIIWLIIIYIFY 392

Query:   326 FTKIV-IIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWF 484
             F  IV I IF    +        +  +NI N+LF   FI + V  + F  IN F
Sbjct:   393 FRLIVNIFIFSYQFLGFWVVK--LSFINIKNLLF---FICSSVYILFFDIINLF 441

 Score = 91 (32.0 bits), Expect = 0.32, P = 0.27
 Identities = 47/170 (27%), Positives = 82/170 (48%), Frame = +2

Query:     2 FFIFLIIP----FIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRD 169
             FF FL       FIII  Q     ++ FI   III   F    ++ FL +  SR F Y+ 
Sbjct:    70 FFCFLSFDTRFLFIIIIIQYIIIFLFIFINHIIIISILFEIFSLLLFLLLMSSR-FGYKI 128

Query:   170 IIMIHMFVDRTFHSIIMLYIIEAT*FFFI--FFFILISRCIIIYIMMYILYVLSFTKIVI 343
             +++ + ++    + I++  ++    +F I  + F L   C +++   + L +L     ++
Sbjct:   129 LVLWYYYMLNLINFILLFILL----YFMILNYCFFLCDFCFLVFDEEW-LGILCLFYTLL 183

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
             I+FK  I  LI     + +  +   L + IFI  +   I+F    + LI + ISFI
Sbjct:   184 ILFKLYIAFLI-----LFMEQLYIRLGVFIFIYMLTFYILFC---FILIILLISFI 231

 Score = 88 (31.0 bits), Expect = 0.73, P = 0.52
 Identities = 45/173 (26%), Positives = 87/173 (50%), Frame = +2

Query:     8 IFLIIPFIII---FFQKNG-FVIYAFI*LCIIIIFY---FINKYII*FLFMCISRPFIYR 166
             +F+++ F+I+   FF  +  F+++    L I+ +FY    + K  I FL + + + +I  
Sbjct:   145 LFILLYFMILNYCFFLCDFCFLVFDEEWLGILCLFYTLLILFKLYIAFLILFMEQLYIRL 204

Query:   167 DI-IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVI 343
              + I I+M    TF+ I+  +I+      FI+F+IL  + ++      +L  L+   IV 
Sbjct:   205 GVFIFIYML---TFY-ILFCFILIILLISFIYFYILFIKLLLFQSCTCVLIGLNSFAIVS 260

Query:   344 IIFKKDIIXLI*SHNIIILV-NILNILFMN---IFIANVVISIIFG*INWFLIYISISF 508
             ++F   +        I I   N +  L++N   I+  ++V+ II     +F+IY    F
Sbjct:   261 LLFVLSVNNFCFLFLIFISTKNYIFYLYLNFHLIYSISLVLLIII--YYFFIIYNIFDF 317

 Score = 73 (25.7 bits), Expect = 4.4, Sum P(2) = 0.99
 Identities = 22/96 (22%), Positives = 49/96 (51%), Frame = +2

Query:    80 LCIIIIFYFINKYII*FLFMCISRPFIYRDIIM--IHMFVDRTFHSIIMLYIIEAT*FFF 253
             +C I I  F+  + + F F+     F++  II+  I +F+    + II++ I+       
Sbjct:    55 ICFIFILLFLFCFTLFFCFLSFDTRFLFIIIIIQYIIIFLFIFINHIIIISILFEIFSLL 114

Query:   254 IFFFILISRC---IIIYIMMYILYVLSFTKIVIIIF 352
             +F  ++ SR    I++    Y+L +++F  + I+++
Sbjct:   115 LFLLLMSSRFGYKILVLWYYYMLNLINFILLFILLY 150

 Score = 45 (15.8 bits), Expect = 4.4, Sum P(2) = 0.99
 Identities = 16/66 (24%), Positives = 32/66 (48%), Frame = +1

Query:   310 FVCLVLHQNCHYYF*KRYHXLD------LIPQYYYFG*Y--FEYPFYEHFYC*CCHFYYF 465
             F+  +  +N  +Y    +H +       LI  YY+F  Y  F++ + E+++     F+ F
Sbjct:   274 FLIFISTKNYIFYLYLNFHLIYSISLVLLIIIYYFFIIYNIFDFKYNENYFLINFIFFSF 333

Query:   466 WLNQLV 483
             + N L+
Sbjct:   334 FNNFLI 339


>gi|436923 (U01849) ORF1 [Trypanosoma brucei]
           Length = 146

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.0027, P = 0.0027
 Identities = 28/106 (26%), Positives = 56/106 (52%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             FF+ L   F+++F+  + F ++ +  +    +F F+  +++ FLF      F+Y  +  +
Sbjct:    34 FFVVLGCDFLLVFWLYSLFFLWRYNFVYFFFLFCFVF-FVLLFLFGLFGF-FLYFLLCFV 91

Query:   182 HMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYV 319
              +F D  F    ML+ +    F F+FFF L   C+ +++++ IL V
Sbjct:    92 -LFFDLFF----MLFFVLGGFFVFVFFFCL---CLFLFVVVVILLV 129


>gi|2213862 (AF003086) PfSNF2L [Plasmodium falciparum]
            Length = 1422

  Minus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.0030, P = 0.0030
 Identities = 42/168 (25%), Positives = 81/168 (48%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  N  +    ++S+  + NDN  +KNVH+    NI  N+  V  D     +  NN +N 
Sbjct:    75 NNMNENMMNRKLNSSVEDGNDNNHDKNVHR----NIG-NDTHVSYDDKRKSYLDNNEENS 129

Query:   331 GEGQDI---QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPV-DKHMDHNNVP 164
              +  D    + ++   Y+N   D+ + + +++S   N+ +  +T  S + D + +HN+  
Sbjct:   130 EQMNDNMKKRKLNEISYDNNEEDEFRNK-KDDSMEMNDKEKGSTNMSTINDNNNNHNDDS 188

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              N      H  + NN   +   +N+D+ ++   NN     E+NN+  +N +N
Sbjct:   189 NN------HNDDSNNHNDDSNNHNDDSNNHNDDNNN--HNEDNNN--HNDDN 230

 Score = 92 (32.4 bits), Expect = 0.99, P = 0.63
 Identities = 28/88 (31%), Positives = 41/88 (46%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG 329
             KG+T +    I+   NN ND+ +N   H  D  N N ++N    D  +     +N+DN  
Sbjct:   169 KGSTNMST--INDNNNNHNDDSNN---HNDDSNNHNDDSNNHNDDSNN-----HNDDNNN 218

Query:   328 EGQDIQNIHHNVYNNTPTDQNKKEYEEE 245
               +D  N +HN  NN   D N    EE+
Sbjct:   219 HNED--NNNHNDDNNNHNDDNNYNSEEK 244

 Score = 92 (32.4 bits), Expect = 0.99, P = 0.63
 Identities = 33/114 (28%), Positives = 45/114 (39%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN--DNFGEGQDIQNIHH 299
             S  NN  D   NK   K D   +N      GS     I   NNN  D+     D  N H+
Sbjct:   145 SYDNNEEDEFRNK---KDDSMEMNDKEK--GSTNMSTINDNNNNHNDDSNNHNDDSNNHN 199

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEK 131
             +  NN   D N   + ++++  N  + +N      + H D NN    E P    EK
Sbjct:   200 DDSNNHNDDSNN--HNDDNNNHN--EDNNNHNDDNNNHNDDNNYNSEEKPNYLQEK 251

 Score = 90 (31.7 bits), Expect = 1.7, P = 0.82
 Identities = 34/150 (22%), Positives = 72/150 (48%), Frame = -2

Query:   448 NISNKNVHKKDI--QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT 275
             ++   NV   DI  +  N N N++       +  ++ NDN     D +N+H N+ N+T  
Sbjct:    59 DLKKLNVSSNDITKEGNNMNENMMNRKLNSSV--EDGNDN---NHD-KNVHRNIGNDTHV 112

Query:   274 --DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPG------DAHEKELNN 119
               D  +K Y + +   +   +DN  K  +++ + ++N   +E+        + ++KE  +
Sbjct:   113 SYDDKRKSYLDNNEENSEQMNDNMKKRKLNE-ISYDNNEEDEFRNKKDDSMEMNDKEKGS 171

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
               ++ I +NN+  +    NN       +ND+  N  ++
Sbjct:   172 TNMSTINDNNNNHNDDS-NNHNDDSNNHNDDSNNHNDD 208

 Score = 89 (31.3 bits), Expect = 2.3, P = 0.90
 Identities = 25/99 (25%), Positives = 47/99 (47%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNI--SNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN-NDNFGEGQ 320
             D    D  +N ++D++  ++K     ++  IN NNN    D  +     NN ND+     
Sbjct:   147 DNNEEDEFRNKKDDSMEMNDKEKGSTNMSTINDNNNNHNDDSNNHNDDSNNHNDDSNNHN 206

Query:   319 DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSP 197
             D  N H++  NN   D N   + ++++  N+  + N+ + P
Sbjct:   207 DDSNNHNDDNNNHNEDNNN--HNDDNNNHNDDNNYNSEEKP 245

 Score = 88 (31.0 bits), Expect = 2.9, P = 0.95
 Identities = 25/82 (30%), Positives = 39/82 (47%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             D+E   +  +  NDN +N N    +  N + NN+   S+  +D    +N+DN    +D  
Sbjct:   166 DKEKGSTNMSTINDNNNNHNDDSNN-HNDDSNNHNDDSNNHNDDSNNHNDDNNNHNED-- 222

Query:   310 NIHHNVYNNTPTDQNKKEYEEE 245
             N +HN  NN   D N    EE+
Sbjct:   223 NNNHNDDNNNHNDDNNYNSEEK 244


>sp|P54637|PTP3_DICDI PROTEIN-TYROSINE PHOSPHATASE 3
            (PROTEIN-TYROSINE-PHOSPHATE PHOSPHOHYDROLASE 3) >gi|1022910
            (U38197) protein tyrosine phosphatase [Dictyostelium discoideum]
            Length = 989

  Minus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0035, P = 0.0035
 Identities = 41/162 (25%), Positives = 65/162 (40%), Frame = -2

Query:   496 YVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             Y +  P      + N N +N N    +I N   NNN   S         + + +F    D
Sbjct:    38 YANNTPEMIQSQSENTNTNNINNSSSNINN--NNNNTPDSMSMSTSLSSSPSVSFNH-LD 94

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGF--NNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
             + +I++ + NNT T+ N          F  N ++  NTM   + K+ ++NN   N    +
Sbjct:    95 LNSINNKINNNTTTNNNNNNNNNNDDKFDTNALKLSNTM---IIKNNNNNNNNNNNNNNN 151

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
              +    NN   N   NNN+  +    NN       NN+   N E
Sbjct:   152 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNSNSNIE 192

 Score = 99 (34.8 bits), Expect = 0.092, P = 0.088
 Identities = 43/164 (26%), Positives = 66/164 (40%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNK---NVHKKD----IQNINQNNNIVGSDQXDDIFF 353
             N  N  ++     +  NN N+N  +K   N  K      I+N N NNN   ++  ++   
Sbjct:    96 NSINNKINNNTTTNNNNNNNNNNDDKFDTNALKLSNTMIIKNNNNNNNNNNNNNNNNNNN 155

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
              NNN+N     +  N ++N  NN   + N            +IQ DN     VD  +   
Sbjct:   156 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNIEINVPSIQFDNEPAMEVDS-VAPL 214

Query:   172 NVPINEWPGDA--HE-KELN--NIFVNKIKNNNDAQSYKGINNKT 53
             NVP N        H  K L+  NI +  I  N  + S   +++ T
Sbjct:   215 NVPSNHTRTTLAMHNTKSLSTSNIGLLNILPNQQSSSSSSLSSTT 259

 Score = 97 (34.1 bits), Expect = 0.074, Sum P(2) = 0.072
 Identities = 26/86 (30%), Positives = 44/86 (51%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             KNN N+N +N N +  +  N N NNN   ++  ++    NNN+N     +  N + N+  
Sbjct:   136 KNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNNNNNNNNNNNNNNSNSNIEI 193

Query:   286 NTPTDQ--NKKEYEEESSGFNNIQHDNT 209
             N P+ Q  N+   E +S    N+  ++T
Sbjct:   194 NVPSIQFDNEPAMEVDSVAPLNVPSNHT 221

 Score = 88 (31.0 bits), Expect = 2.0, P = 0.86
 Identities = 33/155 (21%), Positives = 70/155 (45%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDD--------IFFKN 347
             +T +   P  S  +   ++I+NK ++     N N NNN    D+ D         +  KN
Sbjct:    79 STSLSSSPSVSFNHLDLNSINNK-INNNTTTNNNNNNNNNNDDKFDTNALKLSNTMIIKN 137

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             NN+N     +  N ++N  NN   + N       ++  NN  ++N   +  + +++ N V
Sbjct:   138 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNS-NSNIEIN-V 195

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTI 50
             P  ++  +    E++++    + +N+   +    N K++
Sbjct:   196 PSIQFDNEP-AMEVDSVAPLNVPSNHTRTTLAMHNTKSL 233

 Score = 85 (29.9 bits), Expect = 4.4, P = 0.99
 Identities = 30/118 (25%), Positives = 50/118 (42%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEY--EEESSGFNNIQHD---NTMKSPVDK 188
             +N N N        NI++N  NNTP   +         S  FN++  +   N + +    
Sbjct:    51 ENTNTN-NINNSSSNINNN-NNNTPDSMSMSTSLSSSPSVSFNHLDLNSINNKINNNTTT 108

Query:   187 HMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             + ++NN   N+   D +  +L+N  + K  NNN+  +    NN       NN+   N  N
Sbjct:   109 NNNNNNNNNNDDKFDTNALKLSNTMIIKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 168

 Score = 41 (14.4 bits), Expect = 0.074, Sum P(2) = 0.072
 Identities = 10/29 (34%), Positives = 14/29 (48%), Frame = -2

Query:   115 FVNKIKNN-NDAQSYKGINNKTIFLEENN 32
             F+N   NN N+  S  G N   +F   N+
Sbjct:   904 FLNNNNNNDNNGSSGGGFNGSFLFNSNNS 932


>pir||B26696 hypothetical protein 1 (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6) (fragment)
            >gi|896286 (M10126) NH2 terminus uncertain [Leishmania tarentolae]
            Length = 443

  Plus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.0043, P = 0.0043
 Identities = 45/170 (26%), Positives = 91/170 (53%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVI-YAFI*LCIIIIFYFINKYI-I*FLFMCISRPF-IYRDI 172
             +++  +I FI++F      ++ Y F  LC      F  +++ I  LF  +   F +Y  I
Sbjct:   132 YYMINLINFILLFVLLYYMILNYCFY-LCDFCFLIFDEEWLGILCLFYILLILFKLY--I 188

Query:   173 IMIHMFVDRTFHSI-IMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYV--LSFTKIVI 343
              ++ +F+++ +  + + ++I   T F+ +F FILI   +I +I  YI+++  +    I  
Sbjct:   189 AILILFLEQLYIRLGVFIFIYMLT-FYVLFCFILII-LLICFIYFYIIFIKLIIIQSITC 246

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
             ++   +   ++ S   ++ VN  + LF+ IFI+     I +  +N+ LIY S+S I
Sbjct:   247 VLIGLNSFAIV-SLLFVLSVNNFSFLFL-IFISTKNY-IFYMYLNFHLIY-SLSLI 298

 Score = 103 (36.3 bits), Expect = 0.011, P = 0.011
 Identities = 33/153 (21%), Positives = 78/153 (50%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHM 187
             +++ +   I  +    +V++ FI   II++  FI  YII F+ + I +       ++I +
Sbjct:   198 LYIRLGVFIFIYMLTFYVLFCFI--LIILLICFIYFYII-FIKLIIIQSIT---CVLIGL 251

Query:   188 FVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMM--YILYVLSFTKIVIIIFKKD 361
                 +F  + +L+++    F F+F   + ++  I Y+ +  +++Y LS   ++I+ +   
Sbjct:   252 ---NSFAIVSLLFVLSVNNFSFLFLIFISTKNYIFYMYLNFHLIYSLSLIILIILYYFFI 308

Query:   362 IIXL--I*SHNIIILVNILNILFMNIFIANVVISIIF 466
             +  +  I  +    L+N +   F N  + +++I+ IF
Sbjct:   309 VYNMFDIKYNENYFLINFIFFSFFNNLLISIMIACIF 345

 Score = 93 (32.7 bits), Expect = 0.090, Sum P(2) = 0.086
 Identities = 32/115 (27%), Positives = 61/115 (53%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHM 187
             I+LII  III    + ++ + F+ L  +  F+F+      F F+     F++  IIM ++
Sbjct:    36 IWLIIINIIILTILDSYICFIFL-LLFLFCFFFL------FCFLNFDTRFVFMIIIMQYI 88

Query:   188 FVDRTFHSIIMLYI-IEAT*FFFIFFFILISRC----IIIYIMMYILYVLSFTKIVIIIF 352
              +    H I +L+I I    F  + F ILIS      I+I    Y++ +++F  + ++++
Sbjct:    89 IIFMFLHVIHILFISILFELFSLLLFLILISSRFGYKILILWYYYMINLINFILLFVLLY 148

 Score = 93 (32.7 bits), Expect = 0.18, P = 0.17
 Identities = 40/163 (24%), Positives = 79/163 (48%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDI-IMI 181
             + F +  F  + F +    I     LC+  I   + K  I  L + + + +I   + I I
Sbjct:   154 YCFYLCDFCFLIFDEEWLGI-----LCLFYILLILFKLYIAILILFLEQLYIRLGVFIFI 208

Query:   182 HMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKD 361
             +M    TF+ ++  +I+      FI+F+I+  + III  +  +L  L+   IV ++F   
Sbjct:   209 YML---TFY-VLFCFILIILLICFIYFYIIFIKLIIIQSITCVLIGLNSFAIVSLLFVLS 264

Query:   362 IIXLI*SHNIIILVNILNILF---MN---IFIANVVISIIFG*INWFLIY 493
             +     S   +I ++  N +F   +N   I+  +++I II     +F++Y
Sbjct:   265 VNNF--SFLFLIFISTKNYIFYMYLNFHLIYSLSLIILIIL--YYFFIVY 310

 Score = 90 (31.7 bits), Expect = 0.43, P = 0.35
 Identities = 41/169 (24%), Positives = 89/169 (52%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIH 184
             F+ +I+ +IIIF   +  VI+    L I I+F   +  ++ FL +  SR F Y+ +I+ +
Sbjct:    80 FMIIIMQYIIIFMFLH--VIHI---LFISILFELFS--LLLFLILISSR-FGYKILILWY 131

Query:   185 MFVDRTFHSIIMLYIIEAT*FFFI--FFFILISRCIIIYIMMYILYVLSFTKIVIIIFKK 358
              ++    + I++  ++    ++ I  + F L   C +I+   + L +L    I++I+FK 
Sbjct:   132 YYMINLINFILLFVLL----YYMILNYCFYLCDFCFLIFDEEW-LGILCLFYILLILFKL 186

Query:   359 DI-IXLI*SHNIIILVNILNILFMNIF---IANVVISIIFG*INWFLIYISISFI 511
              I I ++    + I + +   ++M  F      ++I ++   I +++I+I +  I
Sbjct:   187 YIAILILFLEQLYIRLGVFIFIYMLTFYVLFCFILIILLICFIYFYIIFIKLIII 241

 Score = 90 (31.7 bits), Expect = 0.43, P = 0.35
 Identities = 41/187 (21%), Positives = 94/187 (50%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFV------IYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYR 166
             FIFL++ F+  FF    F+      ++  I +  IIIF F+  ++I  LF+ I    ++ 
Sbjct:    55 FIFLLL-FLFCFFFLFCFLNFDTRFVFMIIIMQYIIIFMFL--HVIHILFISILFE-LFS 110

Query:   167 DIIMIHMFVDRTFHSIIML---YIIEAT*FFFIF---FFILISRCIIIYIMMYILY---- 316
              ++ + +   R  + I++L   Y+I    F  +F   ++++++ C  +    ++++    
Sbjct:   111 LLLFLILISSRFGYKILILWYYYMINLINFILLFVLLYYMILNYCFYLCDFCFLIFDEEW 170

Query:   317 --VLSFTKIVIIIFKKDI-IXLI*SHNIIILVNILNILFMNIF---IANVVISIIFG*IN 478
               +L    I++I+FK  I I ++    + I + +   ++M  F      ++I ++   I 
Sbjct:   171 LGILCLFYILLILFKLYIAILILFLEQLYIRLGVFIFIYMLTFYVLFCFILIILLICFIY 230

Query:   479 WFLIYISISFI 511
             +++I+I +  I
Sbjct:   231 FYIIFIKLIII 241

 Score = 89 (31.3 bits), Expect = 0.56, P = 0.43
 Identities = 42/173 (24%), Positives = 86/173 (49%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISR-PFIYRDIIMIH 184
             IF+ +  I I F    F +++ +   I+I   F  K +I + +  I+   FI   +++ +
Sbjct:    90 IFMFLHVIHILFISILFELFSLLLFLILISSRFGYKILILWYYYMINLINFILLFVLLYY 149

Query:   185 MFVDRTFHSIIMLYII---EAT*FFFIFFFILISRCIIIYIMMYILYVLS-FTKIVIIIF 352
             M ++  F+     ++I   E      +F+ +LI     +YI + IL++   + ++ + IF
Sbjct:   150 MILNYCFYLCDFCFLIFDEEWLGILCLFYILLI--LFKLYIAILILFLEQLYIRLGVFIF 207

Query:   353 KKDIIXLI*SHNIIILVNILNILFMNIFIANVVIS----IIFG*INWFLIYISISFI 511
                +   +    I+I++ I  I F  IFI  ++I     ++ G +N F I +S+ F+
Sbjct:   208 IYMLTFYVLFCFILIILLICFIYFYIIFIKLIIIQSITCVLIG-LNSFAI-VSLLFV 262

 Score = 83 (29.2 bits), Expect = 2.9, P = 0.94
 Identities = 42/147 (28%), Positives = 78/147 (53%), Frame = +2

Query:    71 FI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYIIEAT*FF 250
             F+ L  II+F  +  +II    +C      Y    +I + +     +II+L I+++   +
Sbjct:     4 FLYLIHIILFLLLYSFII----LCDYTSLFYLSFDLIWLIII----NIIILTILDS---Y 52

Query:   251 FIFFFILISRCIIIYIMMYILYVLSF-TKIV-IIIFKKDIIXLI*SHNI-IILVNILNIL 421
               F F+L+     ++   ++   L+F T+ V +II  + II  +  H I I+ ++IL  L
Sbjct:    53 ICFIFLLL----FLFCFFFLFCFLNFDTRFVFMIIIMQYIIIFMFLHVIHILFISILFEL 108

Query:   422 FMNIFIANVVISIIFG*---INWFLIYIS-ISFI 511
             F ++ +  ++IS  FG    I W+   I+ I+FI
Sbjct:   109 F-SLLLFLILISSRFGYKILILWYYYMINLINFI 141

 Score = 83 (29.2 bits), Expect = 2.9, P = 0.94
 Identities = 40/159 (25%), Positives = 73/159 (45%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFI---NKYII*F---LFMCISRPFIY 163
             F IF+     I +   N  +IY+   + +II++YF    N + I +    F+     F +
Sbjct:   272 FLIFISTKNYIFYMYLNFHLIYSLSLIILIILYYFFIVYNMFDIKYNENYFLINFIFFSF 331

Query:   164 RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFIL----ISRCIIIY--IMMYILYVLS 325
              + ++I + +   F  I  + I+    F  +F  +L    +  CI+ +  I + I+Y+  
Sbjct:   332 FNNLLISIMIACIFLCIGSIPIVFGF-FLKVFCLLLHLSYLGICIVFFSIIWLIIIYIFY 390

Query:   326 FTKIV-IIIFKKDIIXL-I*SHNIIILVNILNILFMNIFI 439
             F  I+ I IF    I   +   +I+   N+  IL  +IFI
Sbjct:   391 FRLIINIFIFSYQFIGFWVVRLHILGFSNLFFILSFSIFI 430

 Score = 82 (28.9 bits), Expect = 3.7, P = 0.98
 Identities = 37/164 (22%), Positives = 73/164 (44%), Frame = +2

Query:     5 FIFLIIPFI-IIFFQKNGFVIYAFI*LCIIIIFYF--INKYII*FLFMCISRPFIYRDII 175
             FI+  I FI +I  Q    V+       I+ + +   +N +   FL    ++ +I+   +
Sbjct:   228 FIYFYIIFIKLIIIQSITCVLIGLNSFAIVSLLFVLSVNNFSFLFLIFISTKNYIFYMYL 287

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFK 355
               H+    +   +I+LY      +FFI + +   +    Y ++  ++   F  ++I I  
Sbjct:   288 NFHLIYSLSLIILIILY------YFFIVYNMFDIKYNENYFLINFIFFSFFNNLLISIMI 341

Query:   356 KDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLI-YI 496
               I   I S  I+     L +  + + ++ + I I+F  I W +I YI
Sbjct:   342 ACIFLCIGSIPIVFGF-FLKVFCLLLHLSYLGICIVFFSIIWLIIIYI 388

 Score = 37 (13.0 bits), Expect = 0.090, Sum P(2) = 0.086
 Identities = 12/32 (37%), Positives = 17/32 (53%), Frame = +3

Query:   387 ILLFWLIF*ISFL*TFLLLMLSFLLFLVESIG 482
             ILLF L++ +     F L    FL+F  E +G
Sbjct:   141 ILLFVLLYYMILNYCFYLCDFCFLIFDEEWLG 172


>sp|Q03100|CYAA_DICDI ADENYLATE CYCLASE, AGGREGATION SPECIFIC (ATP
            PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >pir||B42239 adenylate
            cyclase (EC 4.6.1.1) aggregation stage - slime mold (Dictyostelium
            discoideum) >gi|457431 (L05499) adenylyl cyclase aggregation
            protein [Dictyostelium discoideum]
            Length = 1407

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 7.3, Sum P(2) = 1.0
 Identities = 35/141 (24%), Positives = 58/141 (41%), Frame = -2

Query:   424 KKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEE 245
             KKD+      N ++ ++  +    K+NN+N+       N ++N YNN   + N      E
Sbjct:   730 KKDLSCDFSINKVLNAETIES---KSNNNNYNNNNYNNNNYNNNYNNNNLNNNSNNNNNE 786

Query:   244 SSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGI 65
                 ++    + +   V + +D NN   N  P   H+K   +I  N   N ND  S    
Sbjct:   787 YGSSSS--SSSVLGEAVTEQIDCNNT--N--PPLQHKKS-QSILTN---NENDIVSPSLT 836

Query:    64 NNKTIF---LEENNDERYNQENEK 2
             +N  I    +  NN+      N K
Sbjct:   837 SNSPILDTTVNNNNNNNNTNNNNK 860

 Score = 81 (28.5 bits), Expect = 0.0047, Sum P(2) = 0.0047
 Identities = 31/117 (26%), Positives = 48/117 (41%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             K+NN+N+       N ++N YNN   + N      E    ++    + +   V + +D N
Sbjct:   751 KSNNNNYNNNNYNNNNYNNNYNNNNLNNNSNNNNNEYGSSSS--SSSVLGEAVTEQIDCN 808

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIF---LEENNDERYNQENEK 2
             N   N  P   H+K   +I  N   N ND  S    +N  I    +  NN+      N K
Sbjct:   809 NT--N--PPLQHKKS-QSILTN---NENDIVSPSLTSNSPILDTTVNNNNNNNNTNNNNK 860

 Score = 76 (26.8 bits), Expect = 0.0047, Sum P(2) = 0.0047
 Identities = 22/66 (33%), Positives = 31/66 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGE 326
             N  +D++  D+  NN N+  SN N   K+  NI  NNN   S+   +    NNN    G 
Sbjct:   525 NIDLDKDNKDNNNNNNNNKNSNNNFKNKN--NIINNNNNSNSNNTTNNNSNNNNITTSGN 582

Query:   325 GQDIQNI 305
               D + I
Sbjct:   583 DDDDEEI 589

 Score = 72 (25.3 bits), Expect = 0.012, Sum P(2) = 0.012
 Identities = 21/72 (29%), Positives = 35/72 (48%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNV-HKKDI----QNINQNNNIVGSDQXDDIFFKNNND 338
             N  +D++  D+  NN N+  SN N  +K +I     N N NN    +   ++I    N+D
Sbjct:   525 NIDLDKDNKDNNNNNNNNKNSNNNFKNKNNIINNNNNSNSNNTTNNNSNNNNITTSGNDD 584

Query:   337 NFGEGQDIQNIH 302
             +  E +D +  H
Sbjct:   585 DDEEIEDSELEH 596

 Score = 60 (21.1 bits), Expect = 0.19, Sum P(2) = 0.18
 Identities = 17/53 (32%), Positives = 26/53 (49%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRN-DNI--SNKNVHKKDIQNINQNNNIVGSDQXDD 362
             NK N   +    +S  N +N +NI  +N N +  +  N N NNN + +   DD
Sbjct:   532 NKDNNNNNNNNKNSNNNFKNKNNIINNNNNSNSNNTTNNNSNNNNITTSGNDD 584

 Score = 59 (20.8 bits), Expect = 0.25, Sum P(2) = 0.22
 Identities = 19/54 (35%), Positives = 26/54 (48%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRN-DNI--SNKNVHKKDIQNINQNNN-IVGSDQXDD 362
             NK N   +    +S  N +N +NI  +N N +  +  N N NNN I  S   DD
Sbjct:   532 NKDNNNNNNNNKNSNNNFKNKNNIINNNNNSNSNNTTNNNSNNNNITTSGNDDD 585

 Score = 49 (17.2 bits), Expect = 9.3, Sum P(2) = 1.0
 Identities = 24/99 (24%), Positives = 41/99 (41%), Frame = -2

Query:   304 HHNVYNNTPTDQNKKEYE-EESSG------FNNIQHDNTMKSPVDKHMDHN-NVPINEWP 149
             ++N+ +N+     + +YE  ++ G      F + + D   K   D   D + N  +N   
Sbjct:   688 NYNIVSNSECKDQEHDYEFHKAHGECITSYFVDWKDDYREKKKKDLSCDFSINKVLNA-- 745

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
                  K  NN + N   NNN+  +    NN       NN+E
Sbjct:   746 ETIESKSNNNNYNNNNYNNNNYNNNYNNNNLNNNSNNNNNE 786

 Score = 37 (13.0 bits), Expect = 7.3, Sum P(2) = 1.0
 Identities = 9/30 (30%), Positives = 15/30 (50%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNN 389
             ++S  NN N++ ++         N N NNN
Sbjct:    83 LNSITNNHNNHHNHHPNTLSTPHNNNHNNN 112


>gi|9857 (X17490) Plasmodium falciparum mRNA for asparagine-rich antigen (clone
         53C6) [Plasmodium falciparum]
         Length = 144

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.0050, P = 0.0050
 Identities = 36/143 (25%), Positives = 67/143 (46%), Frame = -2

Query:   439 NKNVHKKDIQNINQNNNIVGSDQXDDIF-FKNNNDNFGEGQDIQNIHHNVYN-NTPTDQN 266
             NKN +   + +  +N NI   D+ +D   +KN        QDIQN  +N  N N   +QN
Sbjct:    15 NKNSNMSLLLSSMENKNITSMDKVNDSHGYKNK-------QDIQNDGNNQNNQNNQNNQN 67

Query:   265 KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNND 86
              +  +   S  N+  H+  +K  ++ H  ++N   N  P  +H+   ++   +    ++D
Sbjct:    68 NQNNQNNDSHNNHYNHEKDLKLDIN-HRHNSNQNSN--PDYSHDDNYSDS--SDDDEDDD 122

Query:    85 AQSYKGINNKTIFLEENNDERYNQE 11
              Q  +  + K    +E N+ RY ++
Sbjct:   123 DQQKEQKDEK----QEENEPRYKKK 143

 Score = 86 (30.3 bits), Expect = 0.11, P = 0.10
 Identities = 27/100 (27%), Positives = 47/100 (47%), Frame = -2

Query:   472 STKNNRNDNISN--KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             S + N+N N+S    ++  K+I ++++ N+  G     DI    NN N    Q+ QN  +
Sbjct:    11 SQEENKNSNMSLLLSSMENKNITSMDKVNDSHGYKNKQDIQNDGNNQNNQNNQNNQNNQN 70

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             N   N  +  N   +E++     N +H++   S  D   D N
Sbjct:    71 N--QNNDSHNNHYNHEKDLKLDINHRHNSNQNSNPDYSHDDN 110

 Score = 74 (26.0 bits), Expect = 4.1, P = 0.98
 Identities = 25/95 (26%), Positives = 40/95 (42%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT 275
             ND+   KN  K+DIQN   N N    +Q +     N N+   +  D  N H+N   +   
Sbjct:    39 NDSHGYKN--KQDIQNDGNNQN----NQNNQ---NNQNNQNNQNNDSHNNHYNHEKDLKL 89

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             D N +    ++S   +  HD+      D   D ++
Sbjct:    90 DINHRHNSNQNSN-PDYSHDDNYSDSSDDDEDDDD 123

 Score = 71 (25.0 bits), Expect = 9.8, P = 1.0
 Identities = 18/100 (18%), Positives = 50/100 (50%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  + Y +++ I +  NN+N+  +  N + ++ QN + +NN    ++   +   N+  N 
Sbjct:    39 NDSHGYKNKQDIQNDGNNQNNQNNQNNQNNQNNQNNDSHNNHYNHEKDLKLDI-NHRHNS 97

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
              +  +    H + Y+++ +D ++ + +++    +  Q +N
Sbjct:    98 NQNSNPDYSHDDNYSDS-SDDDEDDDDQQKEQKDEKQEEN 136


>gi|2078309 (U67264) HOAR [Helicoverpa zea nuclear polyhedrosis virus]
            Length = 712

  Minus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0059, P = 0.0059
 Identities = 43/146 (29%), Positives = 71/146 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             S   NT VD++  D   ++ ND+++ N +V+  D+ ++N N N    +Q  +    N+ND
Sbjct:   353 SVNNNTNVDDQNNDDDDDDVNDDVNDNDDVNDDDVNDVNTNVN--SDNQITNT--TNDND 408

Query:   337 -----NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
                  N        NI+ NV  N   D N    +++ +  N+  +DN   + VD   + N
Sbjct:   409 TNVDANVCNTNANVNINANVDTNANVDTNANVDDDDVA--NSAANDNVQHT-VD---NDN 462

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQS 77
             NV  N     +H+   +N   N  KN+ND  S
Sbjct:   463 NVN-NNVSQTSHDNINSNQVNNNSKNDNDKNS 493

 Score = 92 (32.4 bits), Expect = 0.45, P = 0.36
 Identities = 41/165 (24%), Positives = 79/165 (47%), Frame = -2

Query:   499 TYVDEEPIDSTKNNRNDNI-SNKNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNFGE 326
             T  +E+  +   N  N++I +N +    +  N++ QNN+    D  DD+   N+ND+  +
Sbjct:   328 TIHNEDTAELNTNTVNNDIETNNDASVNNNTNVDDQNNDDDDDDVNDDV---NDNDDVND 384

Query:   325 GQDIQNIHHNVYNNTP----TDQNKKEYEEESSGFN---NIQHDNTMKSPVDKH--MDHN 173
               D+ +++ NV ++      T+ N    +      N   NI  +    + VD +  +D +
Sbjct:   385 -DDVNDVNTNVNSDNQITNTTNDNDTNVDANVCNTNANVNINANVDTNANVDTNANVDDD 443

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +V  N    D  +  ++N   N + NN    S+  IN+  +    NN +  N +N
Sbjct:   444 DVA-NSAANDNVQHTVDND--NNVNNNVSQTSHDNINSNQV---NNNSKNDNDKN 492

 Score = 91 (32.0 bits), Expect = 0.59, P = 0.44
 Identities = 42/150 (28%), Positives = 65/150 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRND-----NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN 347
             N  NT V+ +   +   N ND     N+ N N +     N++ N N+  +   DD    N
Sbjct:   388 NDVNTNVNSDNQITNTTNDNDTNVDANVCNTNANVNINANVDTNANVDTNANVDDDDVAN 447

Query:   346 N--NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             +  NDN     D  N   NV NN    Q   +    +   NN ++DN   S  D  + + 
Sbjct:   448 SAANDNVQHTVDNDN---NVNNNV--SQTSHDNINSNQVNNNSKNDNDKNSVDDDDISNL 502

Query:   172 NVPI----NEWPG--DAH-EKELNNIFVNKIKNNN 89
             ++PI    N +    D H +   +N+F +   NNN
Sbjct:   503 SLPIVNITNLYRTVIDNHCDNASDNVFPSSNSNNN 537

 Score = 85 (29.9 bits), Expect = 3.0, P = 0.95
 Identities = 34/141 (24%), Positives = 61/141 (43%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKD-IQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             S +N+  DN  N +    D + N+N  NN   ++  +D    +NN N  +   I N    
Sbjct:   278 SDRNSDGDNSDNSDSEVYDEVVNVNNTNNNDDNNSTNDSD-DDNNSNCDDAT-IHN-EDT 334

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
                NT T  N  E   ++S  NN   D+      D   D  N  +N+   D ++ ++N++
Sbjct:   335 AELNTNTVNNDIETNNDASVNNNTNVDDQNNDDDD---DDVNDDVND-NDDVNDDDVNDV 390

Query:   115 FVNKIKNNNDAQSYKGINNKTI 50
               N + ++N   +    N+  +
Sbjct:   391 NTN-VNSDNQITNTTNDNDTNV 411

 Score = 85 (29.9 bits), Expect = 3.0, P = 0.95
 Identities = 31/166 (18%), Positives = 70/166 (42%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNND 338
             N  N   D    + + ++ N N  +  +H +D   +N N  NN + ++    +    N D
Sbjct:   302 NNTNNNDDNNSTNDSDDDNNSNCDDATIHNEDTAELNTNTVNNDIETNNDASVNNNTNVD 361

Query:   337 NFGEGQDIQNIHHNVYNNTPT-DQNKKEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVP 164
             +     D  +++ +V +N    D +  +     +  N I +  N   + VD ++ + N  
Sbjct:   362 DQNNDDDDDDVNDDVNDNDDVNDDDVNDVNTNVNSDNQITNTTNDNDTNVDANVCNTNAN 421

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             +N    +A+     N+  N   +++D  +    +N    ++ +N+   N
Sbjct:   422 VNI---NANVDTNANVDTNANVDDDDVANSAANDNVQHTVDNDNNVNNN 467

 Score = 83 (29.2 bits), Expect = 5.2, P = 0.99
 Identities = 35/156 (22%), Positives = 63/156 (40%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKD-IQNINQNNNIVGSDQXDDIFFKNNN---DNFGEGQDIQNI 305
             S +N+  DN  N +    D + N+N  NN   ++  +D    NN+   D     +D   +
Sbjct:   278 SDRNSDGDNSDNSDSEVYDEVVNVNNTNNNDDNNSTNDSDDDNNSNCDDATIHNEDTAEL 337

Query:   304 HHNVYNNTPTDQNKKEYEEESS--GFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH-E 134
             + N  NN     N       ++    NN   D+ +   V+ + D N+  +N+   + + +
Sbjct:   338 NTNTVNNDIETNNDASVNNNTNVDDQNNDDDDDDVNDDVNDNDDVNDDDVNDVNTNVNSD 397

Query:   133 KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
              ++ N   N    N DA       N  + +  N D   N
Sbjct:   398 NQITNT-TNDNDTNVDANVCN--TNANVNINANVDTNAN 433

 Score = 81 (28.5 bits), Expect = 9.0, P = 1.0
 Identities = 26/91 (28%), Positives = 43/91 (47%), Frame = -2

Query:   277 TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN-NIFVNKI 101
             +D +  E  +E    NN  +++   S  D   D+N+   +    +    ELN N   N I
Sbjct:   287 SDNSDSEVYDEVVNVNNTNNNDDNNSTNDSDDDNNSNCDDATIHNEDTAELNTNTVNNDI 346

Query:   100 KNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             + NNDA     +NN T   ++NND+  +  N+
Sbjct:   347 ETNNDAS----VNNNTNVDDQNNDDDDDDVND 374


>gi|414322 (L11172) [Plasmodium falciparum RNA polymerase I gene, complete
           cds.], gene product [Plasmodium falciparum]
           Length = 2910

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.0064, Sum P(2) = 0.0064
 Identities = 32/93 (34%), Positives = 49/93 (52%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             DE  ++S ++ RN+N  NK + K++ + I  NNN+  +D+   I   NN D+  +     
Sbjct:   415 DESQLNSIQS-RNEN--NKLMIKRESKKIEYNNNV--NDESIKIEEDNNEDDDKQMDRES 469

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSG----FNNIQHDN 212
             +  HN  NN   D N+  Y + S G    FN I  DN
Sbjct:   470 SYPHNNNNNNNNDNNEN-YNKLSGGYENSFNEISTDN 505

 Score = 91 (32.0 bits), Expect = 2.8, P = 0.94
 Identities = 43/178 (24%), Positives = 72/178 (40%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNK-NVHKKDIQNINQNNNIVGSDQXDDIFFKNNND- 338
             N  +T       DS   + ND ISNK N+   D       +     D   DI  K+N++ 
Sbjct:  2337 NASHTIASHMEDDSPMKSYND-ISNKENMSPYDDGKGKDGDR--DQDDMSDIELKDNSEK 2393

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNK---------KEYEEESSGFNNIQHDNTMKSPVDKH 185
             N    Q  +N   +       D+ K         KEY+EE     N + D+  KS  D  
Sbjct:  2394 NSNSDQASKNADSDTDEEEEDDELKSEKEKEEDEKEYDEEGGSDTNSKIDSDHKSDSDNK 2453

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIF-LEENNDERYNQEN 8
              D +N   ++   D+  K  ++   +   N ND+ +    +NK    ++ +++      N
Sbjct:  2454 SDSDNKSDSDHKSDSDHKS-DSDHKSDSDNKNDSDNKNDSDNKNDSDIDSDSESEMVSSN 2512

Query:     7 EK 2
             +K
Sbjct:  2513 KK 2514

 Score = 87 (30.6 bits), Expect = 8.4, P = 1.0
 Identities = 41/177 (23%), Positives = 77/177 (43%), Frame = -2

Query:   493 VDEEPIDSTKNNRN---DNISNKNVHKKDIQ-NINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             + +EP +  KNN N   +N +N N +  D+  +++ NNN V      DI   NNN+ F  
Sbjct:   206 IKDEPDEKNKNNNNKNNNNNNNNNNYNNDVDIDVDNNNNNV------DINVDNNNNYFNS 259

Query:   325 GQDIQNIHHN--VYNN-TPTDQNKKEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVPIN 158
               D+ ++  N  +Y   T   ++    +E    +N ++      K   +K    +N    
Sbjct:   260 --DLVDLAPNEEIYEEETDAGRSDDNNKENKPDYNKLKERIKKYKFDANKLAFQSNYNYE 317

Query:   157 EW-----PGDAHEKELNNI-FVN-------KIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             E+         H K+ +   F         K+    D  ++ G++   +FL+     +  
Sbjct:   318 EYLILSKTIKLHMKKSSKCKFCKFQRNISTKVSQRRDTINFIGVHTNNLFLKSICQRKKQ 377

Query:    16 QENEK 2
             ++NEK
Sbjct:   378 KKNEK 382

 Score = 79 (27.8 bits), Expect = 3.5, Sum P(2) = 0.97
 Identities = 25/105 (23%), Positives = 46/105 (43%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N  V++E I   ++N  D+  +K + ++     N NNN             NNNDN    
Sbjct:   443 NNNVNDESIKIEEDNNEDD--DKQMDRESSYPHNNNNN-------------NNNDNNENY 487

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDK 188
               +   + N +N   TD  + +  + S+  + + H N  ++P +K
Sbjct:   488 NKLSGGYENSFNEISTDNIRNDKNKNSTFADMVNHYNRTQAPKEK 532

 Score = 77 (27.1 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 28/97 (28%), Positives = 48/97 (49%), Frame = -2

Query:   277 TDQN-KKEYEEESSGF-NNIQHDNTMKSPVDKHMDHNNVPINEWPG---DAHEKELNNIF 113
             T+ N   EY+  S    ++++ D+ MKS  D     N  P ++  G   D  + ++++I 
Sbjct:  2327 TNNNISGEYQNASHTIASHMEDDSPMKSYNDISNKENMSPYDDGKGKDGDRDQDDMSDIE 2386

Query:   112 V--NKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             +  N  KN+N  Q+ K  ++ T   EE  D+    E EK
Sbjct:  2387 LKDNSEKNSNSDQASKNADSDTD--EEEEDDELKSEKEK 2423

 Score = 77 (27.1 bits), Expect = 6.1, Sum P(2) = 1.0
 Identities = 22/90 (24%), Positives = 44/90 (48%), Frame = -2

Query:   439 NKNVHKKDIQNINQNNNIVGSDQXD-DIFFKNNNDNFGEGQDIQNI------HHNVYNNT 281
             N NV+ + I+ I ++NN     Q D +  + +NN+N     + +N       + N +N  
Sbjct:   443 NNNVNDESIK-IEEDNNEDDDKQMDRESSYPHNNNNNNNNDNNENYNKLSGGYENSFNEI 501

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDK 188
              TD  + +  + S+  + + H N  ++P +K
Sbjct:   502 STDNIRNDKNKNSTFADMVNHYNRTQAPKEK 532

 Score = 60 (21.1 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 17/65 (26%), Positives = 30/65 (46%), Frame = -2

Query:   448 NISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTD 272
             N  + N H  D QN N +  + V      D+F  N  + +  G++ +   H +YNN   D
Sbjct:  1400 NYKHNNSHVDDEQNCNSSLYSCVQYVLNKDLF--NLYEKYLNGKNEEGNKHILYNNCQID 1457

Query:   271 QNKKEY 254
             +   ++
Sbjct:  1458 ERNNDF 1463

 Score = 56 (19.7 bits), Expect = 0.0064, Sum P(2) = 0.0064
 Identities = 11/36 (30%), Positives = 18/36 (50%), Frame = -2

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             N+ F+ K KNNN+    K  N     ++   + +YN
Sbjct:   962 NSFFIKK-KNNNNNNKKKNTNRTNSVMKNTRNSQYN 996

 Score = 55 (19.4 bits), Expect = 0.0081, Sum P(2) = 0.0081
 Identities = 15/47 (31%), Positives = 27/47 (57%), Frame = -2

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFL--EENNDERYNQE 11
             D  +  L+N  ++  K  N+    K +NN+ +FL  E++ND + N+E
Sbjct:  1948 DLSKDLLHNYHLSFSKYLNNNMHSKILNNQELFLKHEKDNDTKDNEE 1994

 Score = 42 (14.8 bits), Expect = 0.17, Sum P(2) = 0.15
 Identities = 8/16 (50%), Positives = 10/16 (62%), Frame = -2

Query:   109 NKIKNNNDAQSYKGIN 62
             NK  +N    +YKGIN
Sbjct:  1133 NKYNDNEFMNTYKGIN 1148

 Score = 40 (14.1 bits), Expect = 0.26, Sum P(2) = 0.23
 Identities = 14/39 (35%), Positives = 18/39 (46%), Frame = -2

Query:   133 KELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
             K LNN   +KI NN +       +N T   EE    +YN
Sbjct:  1963 KYLNNNMHSKILNNQELFLKHEKDNDTKDNEEPLISKYN 2001

 Score = 39 (13.7 bits), Expect = 0.33, Sum P(2) = 0.28
 Identities = 15/43 (34%), Positives = 18/43 (41%), Frame = -2

Query:   133 KELNNIFVNKIKNNNDAQSY-KGINNKTIFLEENNDERYNQENE 5
             K+ NN   NK KN N   S  K   N    + +N D   N   E
Sbjct:   967 KKKNNNNNNKKKNTNRTNSVMKNTRNSQYNIIQN-DLNNNDSKE 1009

 Score = 38 (13.4 bits), Expect = 0.42, Sum P(2) = 0.34
 Identities = 14/63 (22%), Positives = 29/63 (46%), Frame = -2

Query:   187 HMDHNNVPI-NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
             H D +N  I      + + KE +   ++ I NNN+    +   N+ I ++ + +     +
Sbjct:  1540 HFDVSNEEIIKNVINNIYFKEEDESPISSINNNNNNNKVEDDCNQDIKIKGDQETNEFID 1599

Query:    10 NEK 2
             +EK
Sbjct:  1600 DEK 1602


>bbs|137318 DNA polymerase alpha, DNAPol alpha [Plasmodium falciparum, K1,
            Peptide, 1855 aa]
            Length = 1855

  Minus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0072, P = 0.0072
 Identities = 41/178 (23%), Positives = 77/178 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             NK + Y+  +  +    N  D       +KK I+N N NNN    +  +D+ F N +  +
Sbjct:    98 NKSSCYIRSKDYEY---NIYDMKHTNEYNKKIIENNNNNNNYYYYNNYNDMSFSNKDLEY 154

Query:   331 GEGQDIQNIHHNVYNNTPTD---------QNKKEY--EEESSGFNNIQHDNTMKSPVDK- 188
              +   ++N   ++  + P D         + K+ Y  +EE S   N+ +D+ +    +K 
Sbjct:   155 SKYTKVKNEKEDIDKHQPYDIHRDMGSSLKKKENYVKQEEQSNMINVGNDDDINEKKNKI 214

Query:   187 HMDHNNVPIN-EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
             H+  N + +  E     +E+ +  +     KNNN+  +    NN     +  ND   N+ 
Sbjct:   215 HLMKNELVLKKEIQIKENEENIKEVKEQGSKNNNNKNNNDNNNNNNNVDDFYNDYILNEM 274

Query:    10 N 8
             N
Sbjct:   275 N 275

 Score = 67 (23.6 bits), Expect = 3.7, Sum P(2) = 0.98
 Identities = 16/64 (25%), Positives = 33/64 (51%), Frame = -2

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             N N     + +NIH +   N  +D +K  + ++   ++N +  N ++   D ++  NNV 
Sbjct:  1085 NGNINNDYE-KNIHSDAEKNIHSDDDKNIHSDDEKNYDNDKSYNKLE---DDNLLENNVE 1140

Query:   163 INEW 152
             I+E+
Sbjct:  1141 IDEF 1144

 Score = 66 (23.2 bits), Expect = 3.7, Sum P(2) = 0.98
 Identities = 12/30 (40%), Positives = 18/30 (60%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNN 389
             ++S  NN N+N +N N +  +  N N NNN
Sbjct:   548 VNSNNNNNNNNNNNNNNNNNNNNNNNNNNN 577

 Score = 65 (22.9 bits), Expect = 6.0, Sum P(2) = 1.0
 Identities = 20/74 (27%), Positives = 37/74 (50%), Frame = -2

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP-INEWPGDAH-EKELNNIFVNKI 101
             ++NK E   E+   NN ++D T     +    + ++  I++   + H EK  +NI+    
Sbjct:  1661 EKNKSEQLNETQDTNN-ENDITSNQKEEAKDPNGSISNIHDDINNEHSEKNNHNIYKKNN 1719

Query:   100 KNNNDAQSYKGINNK 56
              NNN+  + K I N+
Sbjct:  1720 SNNNNNNNNKDIENE 1734


>pir||S41649 DNA polymerase - Plasmodium falciparum
            Length = 1855

  Minus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0072, P = 0.0072
 Identities = 41/178 (23%), Positives = 77/178 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             NK + Y+  +  +    N  D       +KK I+N N NNN    +  +D+ F N +  +
Sbjct:    98 NKSSCYIRSKDYEY---NIYDMKHTNEYNKKIIENNNNNNNYYYYNNYNDMSFSNKDLEY 154

Query:   331 GEGQDIQNIHHNVYNNTPTD---------QNKKEY--EEESSGFNNIQHDNTMKSPVDK- 188
              +   ++N   ++  + P D         + K+ Y  +EE S   N+ +D+ +    +K 
Sbjct:   155 SKYTKVKNEKEDIDKHQPYDIHRDMGSSLKKKENYVKQEEQSNMINVGNDDDINEKKNKI 214

Query:   187 HMDHNNVPIN-EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
             H+  N + +  E     +E+ +  +     KNNN+  +    NN     +  ND   N+ 
Sbjct:   215 HLMKNELVLKKEIQIKENEENIKEVKEQGSKNNNNKNNNDNNNNNNNVDDFYNDYILNEM 274

Query:    10 N 8
             N
Sbjct:   275 N 275

 Score = 67 (23.6 bits), Expect = 3.7, Sum P(2) = 0.98
 Identities = 16/64 (25%), Positives = 33/64 (51%), Frame = -2

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
             N N     + +NIH +   N  +D +K  + ++   ++N +  N ++   D ++  NNV 
Sbjct:  1085 NGNINNDYE-KNIHSDAEKNIHSDDDKNIHSDDEKNYDNDKSYNKLE---DDNLLENNVE 1140

Query:   163 INEW 152
             I+E+
Sbjct:  1141 IDEF 1144

 Score = 66 (23.2 bits), Expect = 3.7, Sum P(2) = 0.98
 Identities = 12/30 (40%), Positives = 18/30 (60%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNN 389
             ++S  NN N+N +N N +  +  N N NNN
Sbjct:   548 VNSNNNNNNNNNNNNNNNNNNNNNNNNNNN 577

 Score = 65 (22.9 bits), Expect = 6.0, Sum P(2) = 1.0
 Identities = 20/74 (27%), Positives = 37/74 (50%), Frame = -2

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP-INEWPGDAH-EKELNNIFVNKI 101
             ++NK E   E+   NN ++D T     +    + ++  I++   + H EK  +NI+    
Sbjct:  1661 EKNKSEQLNETQDTNN-ENDITSNQKEEAKDPNGSISNIHDDINNEHSEKNNHNIYKKNN 1719

Query:   100 KNNNDAQSYKGINNK 56
              NNN+  + K I N+
Sbjct:  1720 SNNNNNNNNKDIENE 1734


>gi|535260 (Z30339) STARP antigen [Plasmodium reichenowi]
           Length = 655

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.0099, P = 0.0098
 Identities = 40/170 (23%), Positives = 71/170 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISN-KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             S + N  ++     +  +N N N+++     KK   NIN   N+  S     +   NNN+
Sbjct:   215 STEHNNNINTNTNSTDNSNTNTNLTDITTTTKKWTDNINTTQNLTTSTNTTTVSTDNNNN 274

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             N               N  PTD N    +  +  +N    +   K+   K  D+NN+ I 
Sbjct:   275 NI--------------NTKPTDNNNTNIKS-TDNYNTGTKETDNKNTDIKATDNNNITIT 319

Query:   157 EWPGDAHEKELNNIFVNKI-KNNNDAQSYKGINNKT--IFLEENNDERYNQENE 5
                 + +    +N   N I K+N++  +    N+KT  I  + NN +  + +N+
Sbjct:   320 TDNTNTNVISTDNSKTNVISKDNSNTHTISTDNSKTNVISTDNNNTDTISTDND 373

 Score = 98 (34.5 bits), Expect = 0.076, P = 0.073
 Identities = 38/165 (23%), Positives = 62/165 (37%), Frame = -2

Query:   502 NTYVDEEPIDSTKNN---RNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N   D +  D + N      DN  N N   K   N N N     S+  +     NNN N 
Sbjct:   403 NNNTDTKATDKSNNTDTKATDN--NNNTDTKATDNNNTNTKATDSNNTNTKATDNNNTNT 460

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
              +  D  N +    +N  T  N K  +  ++      ++NT     D +  +     N  
Sbjct:   461 -KATDNNNTNTKATDNNNT--NTKATDNNNTNTKATDNNNTNTKATDNNNTNTKATDNN- 516

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               +    + NN       NNN+   Y   NN   + E  +D++ N+++
Sbjct:   517 NTNTKATDNNNTNTKATDNNNNTNQYVFANN---YDETTSDDKLNKDS 561

 Score = 97 (34.1 bits), Expect = 0.10, P = 0.095
 Identities = 39/162 (24%), Positives = 72/162 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQ--XDDIFFKNNNDNFGEGQDIQNI 305
             +++    N+NI N N +  D  N N N  +I  + +   D+I   N   N     +   +
Sbjct:   212 NTSSTEHNNNI-NTNTNSTDNSNTNTNLTDITTTTKKWTDNI---NTTQNLTTSTNTTTV 267

Query:   304 ----HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
                 ++N  N  PTD N    +  +  +N    +   K+   K  D+NN+ I     + +
Sbjct:   268 STDNNNNNINTKPTDNNNTNIKS-TDNYNTGTKETDNKNTDIKATDNNNITITTDNTNTN 326

Query:   136 EKELNNIFVNKI-KNNNDAQSYKGINNKT--IFLEENNDERYNQENE 5
                 +N   N I K+N++  +    N+KT  I  + NN +  + +N+
Sbjct:   327 VISTDNSKTNVISKDNSNTHTISTDNSKTNVISTDNNNTDTISTDND 373

 Score = 91 (32.0 bits), Expect = 0.53, P = 0.41
 Identities = 39/167 (23%), Positives = 61/167 (36%), Frame = -2

Query:   502 NTYVDEEPIDSTKNN---RNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N   D +  D + N      DN  N N   K   N N N     S+  +     NNN N 
Sbjct:   403 NNNTDTKATDKSNNTDTKATDN--NNNTDTKATDNNNTNTKATDSNNTNTKATDNNNTNT 460

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
              +  D  N +    +N  T  N K  +  ++      ++NT     D +  +     N  
Sbjct:   461 -KATDNNNTNTKATDNNNT--NTKATDNNNTNTKATDNNNTNTKATDNNNTNTKATDNN- 516

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGINN--KTIFLEENNDERYNQENEK 2
               +    + NN       NNN+   Y   NN  +T   ++ N +  +   EK
Sbjct:   517 NTNTKATDNNNTNTKATDNNNNTNQYVFANNYDETTSDDKLNKDSCDNSEEK 568

 Score = 86 (30.3 bits), Expect = 2.1, P = 0.88
 Identities = 37/150 (24%), Positives = 61/150 (40%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG-EGQDIQNIHHN 296
             ST N++ + IS  N +   I   N   N++ +D  +      +NDN   +  D  N    
Sbjct:   329 STDNSKTNVISKDNSNTHTISTDNSKTNVISTDNNNTDTISTDNDNTDTKATDNDNTDTK 388

Query:   295 VY---NNTPT---DQNKKEYE--EESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGD- 143
                  NNT T   D N  + +  ++S+  +    DN   +   K  D+NN        + 
Sbjct:   389 ATDNNNNTDTKATDNNNTDTKATDKSNNTDTKATDNNNNTDT-KATDNNNTNTKATDSNN 447

Query:   142 AHEKELNNIFVN-KIKNNNDAQSYKGINNKT 53
              + K  +N   N K  +NN+  +    NN T
Sbjct:   448 TNTKATDNNNTNTKATDNNNTNTKATDNNNT 478

 Score = 84 (29.6 bits), Expect = 3.6, P = 0.97
 Identities = 37/148 (25%), Positives = 59/148 (39%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             ST N++ + IS  N +   I   N   N++ +D  +      +NDN     D +   ++ 
Sbjct:   329 STDNSKTNVISKDNSNTHTISTDNSKTNVISTDNNNTDTISTDNDN----TDTKATDNDN 384

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSP-VD-KHMDHNNVPINEWPGDAHEKELNN 119
              +   TD N    + +++  NN     T KS   D K  D+NN   N    D    + NN
Sbjct:   385 TDTKATDNNNNT-DTKATDNNNTDTKATDKSNNTDTKATDNNN---NT---DTKATDNNN 437

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENND 29
                    +NN        NN      +NN+
Sbjct:   438 TNTKATDSNNTNTKATDNNNTNTKATDNNN 467

 Score = 82 (28.9 bits), Expect = 6.2, P = 1.0
 Identities = 36/140 (25%), Positives = 61/140 (43%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNI-VGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             ST NN N+NI+ K     +  NI   +N   G+ + D+   KN +    +  +I     N
Sbjct:   268 STDNN-NNNINTKPTDNNNT-NIKSTDNYNTGTKETDN---KNTDIKATDNNNITITTDN 322

Query:   295 VYNNT-PTDQNKKEY-EEESSGFNNIQHDNTMKSPVDKHMDHNN---VPINEWPGDAHEK 131
                N   TD +K     +++S  + I  DN+  + +    D+NN   +  +    D    
Sbjct:   323 TNTNVISTDNSKTNVISKDNSNTHTISTDNSKTNVIST--DNNNTDTISTDNDNTDTKAT 380

Query:   130 ELNNIFVNKIKNNNDAQSYKGINNKT 53
             + +N       NNN+  +    NN T
Sbjct:   381 DNDNTDTKATDNNNNTDTKATDNNNT 406

 Score = 82 (28.9 bits), Expect = 6.2, P = 1.0
 Identities = 37/163 (22%), Positives = 61/163 (37%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFK---NNNDNF 332
             N   D +  D+  N       N N   K     N N +   +D  ++   K   NNN N 
Sbjct:   382 NDNTDTKATDNNNNTDTKATDNNNTDTKATDKSN-NTDTKATDNNNNTDTKATDNNNTNT 440

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
              +  D  N +    +N  T  N K  +  ++      ++NT     D +  +     N  
Sbjct:   441 -KATDSNNTNTKATDNNNT--NTKATDNNNTNTKATDNNNTNTKATDNNNTNTKATDNN- 496

Query:   151 PGDAHEKELNNIFVN-KIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
               + + K  +N   N K  +NN+  +    NN T     +N+   NQ
Sbjct:   497 --NTNTKATDNNNTNTKATDNNNTNTKATDNNNTNTKATDNNNNTNQ 541

 Score = 82 (28.9 bits), Expect = 6.2, P = 1.0
 Identities = 44/176 (25%), Positives = 69/176 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKN-NRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXDDIFFK--- 350
             +   NT  +    +   N N N N + N +  KK  +NI  N  + G++           
Sbjct:   159 TGNNNTTTNTSSTEHNNNINTNTNSTGNTSTTKKLTENIITNQILTGNNNTTTNTSSTEH 218

Query:   349 NNNDNFGEGQ-DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             NNN N      D  N + N+ + T T    K++ +     N  Q+  T  +      D+N
Sbjct:   219 NNNINTNTNSTDNSNTNTNLTDITTTT---KKWTDN---INTTQNLTTSTNTTTVSTDNN 272

Query:   172 NVPINEWPGDAHE---KELNNIFVNKIKNNNDAQSYKGI--NNKTIFLEENNDERYNQEN 8
             N  IN  P D +    K  +N      + +N     K    NN TI  +  N    + +N
Sbjct:   273 NNNINTKPTDNNNTNIKSTDNYNTGTKETDNKNTDIKATDNNNITITTDNTNTNVISTDN 332

Query:     7 EK 2
              K
Sbjct:   333 SK 334

 Score = 81 (28.5 bits), Expect = 8.2, P = 1.0
 Identities = 37/140 (26%), Positives = 57/140 (40%), Frame = -2

Query:   472 STKNNRNDNIS--NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ST NN  D IS  N N   K   N N +     ++   D    +NN+   +  D  N   
Sbjct:   359 STDNNNTDTISTDNDNTDTKATDNDNTDTKATDNNNNTDTKATDNNNTDTKATDKSN--- 415

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVD-KHMDHNNVPINEWPGD-AHEKEL 125
             N  +   TD N    + +++  NN     T  +  + K  D+NN        +  + K  
Sbjct:   416 NT-DTKATDNNNNT-DTKATDNNNTNTKATDSNNTNTKATDNNNTNTKATDNNNTNTKAT 473

Query:   124 NNIFVN-KIKNNNDAQSYKGINNKT 53
             +N   N K  +NN+  +    NN T
Sbjct:   474 DNNNTNTKATDNNNTNTKATDNNNT 498

 Score = 81 (28.5 bits), Expect = 8.2, P = 1.0
 Identities = 35/158 (22%), Positives = 61/158 (38%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNI-----NQNNNIVGSDQXD-DIFF 353
             ++  NT +      +T     DN  N ++   D  NI     N N N++ +D    ++  
Sbjct:   281 TDNNNTNIKSTDNYNTGTKETDN-KNTDIKATDNNNITITTDNTNTNVISTDNSKTNVIS 339

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH--MD 179
             K+N++      D  N   NV +    + +    + +++      +DNT     D +   D
Sbjct:   340 KDNSNTHTISTD--NSKTNVISTDNNNTDTISTDNDNTDTKATDNDNTDTKATDNNNNTD 397

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKT 53
                   N     A +K  NN       NNN+  +    NN T
Sbjct:   398 TKATDNNNTDTKATDKS-NNTDTKATDNNNNTDTKATDNNNT 438


>gi|1763000 (U67261) RING-finger protein [Helicoverpa armigera
            nucleopolyhedrovirus]
            Length = 354

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.0099, P = 0.0098
 Identities = 38/158 (24%), Positives = 73/158 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQ-------NINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             D+T +N +    N N    DI+       ++N N N+   D  DD     N+D+  +  D
Sbjct:   142 DATIHNEDTAELNTNTVNNDIETTVDNDASVNNNTNVDNVDDDDDDDDDVNDDDVNDNDD 201

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNT---MKSPVDKHMDHNNVPINEWPG 146
             + +++ NV  N+    N    + +++   N+ + N      + VD + D ++V  N    
Sbjct:   202 VNDVNTNV--NSDNQINNTTNDNDTNVDANVCNTNANVDTNANVDTNADDDDVA-NSAAN 258

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             D  +  +++   N + NN    S+  IN+  +    NN +  N +N
Sbjct:   259 DNVQHTVDSD--NNVNNNVSQTSHDTINSNQV---NNNSKNDNDKN 299

 Score = 100 (35.2 bits), Expect = 0.018, P = 0.018
 Identities = 42/146 (28%), Positives = 74/146 (50%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRN-DNISNKNVHKKDIQN--INQNNNI--VGSDQXDDIFFK 350
             +N   T VD +   S  NN N DN+ + +    D+ +  +N N+++  V ++   D    
Sbjct:   159 NNDIETTVDNDA--SVNNNTNVDNVDDDDDDDDDVNDDDVNDNDDVNDVNTNVNSDNQIN 216

Query:   349 NN-NDN-FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFN-NIQHDNTMKSPVDKHMD 179
             N  NDN      ++ N + NV  N   D N  + +  +S  N N+QH  T+ S  D +++
Sbjct:   217 NTTNDNDTNVDANVCNTNANVDTNANVDTNADDDDVANSAANDNVQH--TVDS--DNNVN 272

Query:   178 HNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQS 77
             +N   +++    +H+   +N   N  KN+ND  S
Sbjct:   273 NN---VSQ---TSHDTINSNQVNNNSKNDNDKNS 300

 Score = 97 (34.1 bits), Expect = 0.042, P = 0.042
 Identities = 37/167 (22%), Positives = 74/167 (44%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNR-NDNISNKNVHKKDIQN---INQNNNIVGSDQXDDIFFKNNNDN 335
             N+  D+  I +      N N  N ++ +  + N   +N N N+   D  DD     N+D+
Sbjct:   137 NSNCDDATIHNEDTAELNTNTVNNDI-ETTVDNDASVNNNTNVDNVDDDDDDDDDVNDDD 195

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNT---MKSPVDKHMDHNNVP 164
               +  D+ +++ NV  N+    N    + +++   N+ + N      + VD + D ++V 
Sbjct:   196 VNDNDDVNDVNTNV--NSDNQINNTTNDNDTNVDANVCNTNANVDTNANVDTNADDDDVA 253

Query:   163 INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              N    D  +  +++   N + NN    S+  IN+  +     ND   N  ++
Sbjct:   254 -NSAANDNVQHTVDSD--NNVNNNVSQTSHDTINSNQVNNNSKNDNDKNSVDD 303

 Score = 93 (32.7 bits), Expect = 0.13, P = 0.12
 Identities = 35/140 (25%), Positives = 73/140 (52%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             S   NT VD   +D   ++ +D++++ +V+  D  N + N N+   +Q ++    N+ND 
Sbjct:   171 SVNNNTNVDN--VDDDDDD-DDDVNDDDVNDNDDVN-DVNTNVNSDNQINNT--TNDNDT 224

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFN-NIQH----DNTMKSPVDKHMDHNN 170
               +  ++ N + NV  N   D N  + +  +S  N N+QH    DN + + V +   H+ 
Sbjct:   225 NVDA-NVCNTNANVDTNANVDTNADDDDVANSAANDNVQHTVDSDNNVNNNVSQ-TSHDT 282

Query:   169 VPINEWPGDA-HEKELNNIFVNKIKN 95
             +  N+   ++ ++ + N++  + I N
Sbjct:   283 INSNQVNNNSKNDNDKNSVDDDDISN 308


>pir||S23689 hypothetical protein 6 - Plasmodium falciparum
            Length = 78

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.011, P = 0.011
 Identities = 18/49 (36%), Positives = 29/49 (59%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG 329
             ++ KNN N+N +N N +  +  N N NNN   +++ ++    NNND FG
Sbjct:     9 NNNKNNNNNNKNNNNNNNNNNNNKNNNNN--NNNKNNNNNNNNNNDCFG 55

 Score = 80 (28.2 bits), Expect = 0.019, P = 0.019
 Identities = 18/49 (36%), Positives = 27/49 (55%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             NN N+N +N N +K +  N N NNN   ++  ++   KNNN+N     D
Sbjct:     6 NNNNNNKNNNNNNKNNNNNNNNNNNNKNNNNNNNN--KNNNNNNNNNND 52

 Score = 69 (24.3 bits), Expect = 0.35, P = 0.30
 Identities = 14/42 (33%), Positives = 23/42 (54%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNN 389
             +NK N   ++   ++  NN N+  +N N + K+  N N NNN
Sbjct:    10 NNKNNNNNNKNNNNNNNNNNNNKNNNNNNNNKNNNNNNNNNN 51

 Score = 69 (24.3 bits), Expect = 0.35, P = 0.30
 Identities = 19/58 (32%), Positives = 30/58 (51%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             +NK N   ++   ++  NN N+ N +N N +K +  N N NN+  G       FFK+ N
Sbjct:    10 NNKNNNNNNKNNNNNNNNNNNNKNNNNNNNNKNNNNNNNNNNDCFGRRPIH--FFKHLN 66

 Score = 67 (23.6 bits), Expect = 0.60, P = 0.45
 Identities = 20/60 (33%), Positives = 30/60 (50%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             +S  NN N+N  N N + K+  N N NNN       ++   KNNN+N     +  N ++N
Sbjct:     1 NSGNNNNNNNNKNNNNNNKNNNNNNNNNN-------NN---KNNNNNNNNKNNNNNNNNN 50

 Score = 63 (22.2 bits), Expect = 1.7, P = 0.82
 Identities = 15/65 (23%), Positives = 30/65 (46%), Frame = -2

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVD--KHMDH 176
             NNN+      +  N ++N  NN   + N     + ++  NN  +D   + P+   KH++ 
Sbjct:     8 NNNNKNNNNNNKNNNNNNNNNNNNKNNNNNNNNKNNNNNNNNNNDCFGRRPIHFFKHLNK 67

Query:   175 NNVPI 161
             + V +
Sbjct:    68 HKVDV 72

 Score = 63 (22.2 bits), Expect = 1.7, P = 0.82
 Identities = 23/68 (33%), Positives = 32/68 (47%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             +S  NN N+N  N N + K+  N N NNN       ++   KNNN+N        N ++N
Sbjct:     1 NSGNNNNNNNNKNNNNNNKNNNNNNNNNN-------NN---KNNNNNNN------NKNNN 44

Query:   295 VYNNTPTD 272
               NN   D
Sbjct:    45 NNNNNNND 52

 Score = 58 (20.4 bits), Expect = 6.2, P = 1.0
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             N+ N+N +N N   K+  N N+NNN             NNN+N    ++  N ++N  NN
Sbjct:     1 NSGNNNNNNNN---KNNNNNNKNNN-------------NNNNNNNNNKNNNNNNNNKNNN 44

Query:   283 TPTDQN 266
                + N
Sbjct:    45 NNNNNN 50


>pir||B45600 asparagine-rich blood stage antigen (clone Pfa55-6) - Plasmodium
            falciparum (fragment) >gi|552186 (M59472) asparagine-rich antigen
            Pfa55-6 [Plasmodium falciparum]
            Length = 480

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.012, P = 0.012
 Identities = 33/119 (27%), Positives = 63/119 (52%), Frame = -2

Query:   511 NK-GNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             NK  +  +  E I+   NN N+ NI N N ++ +I N N N++ + ++  ++    NNN 
Sbjct:   330 NKESHKIIQNEHIED--NNHNEANIYNNNHNEANIYNNNHNDDNIYNNNHNEANIYNNNH 387

Query:   337 NFGEGQDIQNIHHN---VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSP-VDKHMDHNN 170
             N     +I N +HN   +YNN   + N   Y     G +N    +++++  +  ++ +N+
Sbjct:   388 N---DDNIYNNNHNNDNIYNNNHNNDNI--YNNNHIGSSNFLKKSSLETNLISPNLINNS 442

Query:   169 VPINE 155
               IN+
Sbjct:   443 TIINQ 447

 Score = 101 (35.6 bits), Expect = 0.021, P = 0.021
 Identities = 45/158 (28%), Positives = 75/158 (47%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNN-NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             +S K  +N++I + N ++ +I N N N  NI  ++  DD  + NNN N  E     N H+
Sbjct:   332 ESHKIIQNEHIEDNNHNEANIYNNNHNEANIYNNNHNDDNIY-NNNHN--EANIYNNNHN 388

Query:   298 --NVYNNTPTDQNKKEYEEESSGFNNIQH---DNTMK-SPVDKHMDHNNVPINEWPGDAH 137
               N+YNN   + N       +    N  H    N +K S ++ ++   N+ IN       
Sbjct:   389 DDNIYNNNHNNDNIYNNNHNNDNIYNNNHIGSSNFLKKSSLETNLISPNL-IN------- 440

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                 N+  +N+I N    ++ K   NK + L+ +    YN  N+K
Sbjct:   441 ----NSTIINQINNMTSLKNMK--YNKMLPLKPD----YNVGNDK 475

 Score = 100 (35.2 bits), Expect = 0.028, P = 0.028
 Identities = 32/107 (29%), Positives = 55/107 (51%), Frame = -2

Query:   463 NNRND-NISNKNVHKKDIQNINQNN-NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN-- 296
             NN N+ NI N N +  +I N N N  NI  ++  DD  + NN++N     +I N +HN  
Sbjct:   355 NNHNEANIYNNNHNDDNIYNNNHNEANIYNNNHNDDNIYNNNHNN----DNIYNNNHNND 410

Query:   295 -VYNNTPTDQN---KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
              +YNN     +   KK   E +    N+ +++T+ + ++      N+  N+
Sbjct:   411 NIYNNNHIGSSNFLKKSSLETNLISPNLINNSTIINQINNMTSLKNMKYNK 461

 Score = 89 (31.3 bits), Expect = 0.62, P = 0.46
 Identities = 27/85 (31%), Positives = 43/85 (50%), Frame = -2

Query:   511 NKGNTYVDEEPIDST-KNNRND-NISNKNVHKKDIQNINQNN-NIVGSDQXDDIFFKNNN 341
             N+ N Y +    D+   NN N+ NI N N +  +I N N NN NI  ++  +D  + NN+
Sbjct:   358 NEANIYNNNHNDDNIYNNNHNEANIYNNNHNDDNIYNNNHNNDNIYNNNHNNDNIYNNNH 417

Query:   340 ---DNFGEGQDIQN--IHHNVYNNT 281
                 NF +   ++   I  N+ NN+
Sbjct:   418 IGSSNFLKKSSLETNLISPNLINNS 442


>gi|897642 (M14820) ORF2 bases 1807-2850; first start codon at 2032; putative
           [Trypanosoma brucei]
           Length = 272

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.015, P = 0.015
 Identities = 46/184 (25%), Positives = 82/184 (44%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKN-GFVIYA---FI*LCIIIIFYFIN--KYI-----I*FLFMCIS 148
             ++I+++  FI  FF     F+IY    FI +   I F FI+   YI     I ++F  + 
Sbjct:     9 YYIYILYNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMFNVMF 68

Query:   149 RPFIY-RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIF-FFILISRCIIIYIMMYILYVL 322
               +++     +I+      F  I  L+I+     FF F  F+ I  C I+Y+    L +L
Sbjct:    69 CAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLL 128

Query:   323 SFTKIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INW-FLIYIS 499
              F  I   I+      +I     ++L  ++N+ F   F+   +  I+   + W ++IY  
Sbjct:   129 YFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSR 188

Query:   500 ISFI 511
               +I
Sbjct:   189 SCYI 192

 Score = 90 (31.7 bits), Expect = 0.20, P = 0.18
 Identities = 37/152 (24%), Positives = 73/152 (48%), Frame = +2

Query:    56 FVIYAFI*LCIIIIF--YFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYI 229
             +++Y FI  C    F   F+  YI  F+F+      I+ D I    ++   F  + M  +
Sbjct:    12 YILYNFI--CFFFAFGINFLIYYIEFFIFITFH---IFFDFISFSNYIYNYFGILYMFNV 66

Query:   230 IEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVI---IIFKKDIIXLI*SHNIIIL 400
             +     F +F+F+      I ++  +I +V+    IVI   + F  DI   I   +I+ L
Sbjct:    67 MFCAYLFCLFYFV------IYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYL 120

Query:   401 VNILNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
              + +++L +     N + + I+G  + F+I + + F+
Sbjct:   121 -DFISLLLLYF---NFIFNFIYGFFS-FVIILGLLFL 152

 Score = 85 (29.9 bits), Expect = 0.79, P = 0.55
 Identities = 48/171 (28%), Positives = 88/171 (51%), Frame = +2

Query:     5 FIFLIIP--FIIIF-FQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDII 175
             FIF +I   FI+I  F    F I+  I LC I+   FI+  ++ F F+     FIY    
Sbjct:    86 FIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIF---NFIYGFFS 142

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIM-MYILYVLSFTKIV--II 346
              + + +   F   ++L+++    F F F    I   ++ Y+  +Y++Y  S   ++  I+
Sbjct:   143 FV-IILGLLF---LLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAIL 198

Query:   347 IFKKDIIXLI*SHNIIILVNILNILFMNIFIANVV-ISI---IFG*I-NWFLIYISISF 508
             IF K I   +    + IL+  + I F + F+ + + +S+   IFG + N+ ++  SI +
Sbjct:   199 IFFKFIYFDVFFVFVFILILFI-ISFFSFFLKDFLFLSLYFDIFGSLYNYDILSYSIFY 256

 Score = 78 (27.5 bits), Expect = 5.5, P = 1.0
 Identities = 36/114 (31%), Positives = 59/114 (51%), Frame = +2

Query:     2 FFIFLIIP---FIIIFFQKNGFVIYAFI*--LCIIIIFYFINKYII*FLFMC-ISRPFIY 163
             FF F+II    F+++F   N F  + F+   + II+++Y    Y+I +   C I  P I 
Sbjct:   140 FFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMI-YSRSCYILMPAIL 198

Query:   164 RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFF---FILISRCIIIYIMMYILYVLSFT 331
                  I+  V   F  I++L+II     FF FF   F+ +S    I+  +Y   +LS++
Sbjct:   199 IFFKFIYFDVFFVFVFILILFIIS----FFSFFLKDFLFLSLYFDIFGSLYNYDILSYS 253


>gi|160383 (M63276) malaria antigen [Plasmodium falciparum]
           Length = 163

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.015, P = 0.015
 Identities = 43/150 (28%), Positives = 77/150 (51%), Frame = -2

Query:   463 NNRND---NISNKNVHKKDIQNINQNNNIVGSDQXDDIFF-KNNNDNFGEGQDIQNIHHN 296
             NN+ND     S+K+ + ++ QN+N NN     ++  D++F KN+ DN  + +D   I + 
Sbjct:    25 NNKNDIDKEQSDKHNNVQEFQNLNMNN-----EKSKDLYFNKNDIDN-NDNKD--KIINE 76

Query:   295 VYNNTPTDQNKKE--YEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN 122
               + T   QN KE  YE+  + F+N+  D  +    D  ++ N V       D +  + +
Sbjct:    77 TSSGTFM-QNLKETFYEKTKAMFSNLLSDTKISK--DDELN-NEV-------DQNCVKTS 125

Query:   121 NIFVNKIKNNNDAQSYKGINNKTIFLEENNDE-RYNQ 14
             +  +NK +NN      K  ++ T   ++N D   YN+
Sbjct:   126 SGILNKEENNKKEDDEKHFDDNTNEQKKNVDNGEYNE 162

 Score = 78 (27.5 bits), Expect = 1.9, P = 0.85
 Identities = 38/139 (27%), Positives = 66/139 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKN-----NRN-DNISNKNVH--KKDIQNINQNNNIVGSDQXDDI 359
             +NK +  +D+E  D   N     N N +N  +K+++  K DI N N N + + ++     
Sbjct:    25 NNKND--IDKEQSDKHNNVQEFQNLNMNNEKSKDLYFNKNDIDN-NDNKDKIINETSSGT 81

Query:   358 FFKNNNDNFGEGQDIQNIHHNVYNNTPT---DQNKKEYEEE----SSGFNNIQHDNTMKS 200
             F +N  + F E    + +  N+ ++T     D+   E ++     SSG  N + +N  K 
Sbjct:    82 FMQNLKETFYE--KTKAMFSNLLSDTKISKDDELNNEVDQNCVKTSSGILN-KEENNKKE 138

Query:   199 PVDKHMDHNNVPINEWPGDAHEKELNNI 116
               +KH D N    NE   +    E N +
Sbjct:   139 DDEKHFDDNT---NEQKKNVDNGEYNEM 163


>pir||A05235 hypothetical protein A-288 - Trypanosoma brucei mitochondrion
            (SGC6)
            Length = 288

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.017, P = 0.016
 Identities = 46/184 (25%), Positives = 82/184 (44%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKN-GFVIYA---FI*LCIIIIFYFIN--KYI-----I*FLFMCIS 148
             ++I+++  FI  FF     F+IY    FI +   I F FI+   YI     I ++F  + 
Sbjct:    25 YYIYILYNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMFNVMF 84

Query:   149 RPFIY-RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIF-FFILISRCIIIYIMMYILYVL 322
               +++     +I+      F  I  L+I+     FF F  F+ I  C I+Y+    L +L
Sbjct:    85 CAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLL 144

Query:   323 SFTKIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INW-FLIYIS 499
              F  I   I+      +I     ++L  ++N+ F   F+   +  I+   + W ++IY  
Sbjct:   145 YFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSR 204

Query:   500 ISFI 511
               +I
Sbjct:   205 SCYI 208

 Score = 90 (31.7 bits), Expect = 0.22, P = 0.20
 Identities = 37/152 (24%), Positives = 73/152 (48%), Frame = +2

Query:    56 FVIYAFI*LCIIIIF--YFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYI 229
             +++Y FI  C    F   F+  YI  F+F+      I+ D I    ++   F  + M  +
Sbjct:    28 YILYNFI--CFFFAFGINFLIYYIEFFIFITFH---IFFDFISFSNYIYNYFGILYMFNV 82

Query:   230 IEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVI---IIFKKDIIXLI*SHNIIIL 400
             +     F +F+F+      I ++  +I +V+    IVI   + F  DI   I   +I+ L
Sbjct:    83 MFCAYLFCLFYFV------IYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYL 136

Query:   401 VNILNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
              + +++L +     N + + I+G  + F+I + + F+
Sbjct:   137 -DFISLLLLYF---NFIFNFIYGFFS-FVIILGLLFL 168

 Score = 85 (29.9 bits), Expect = 0.87, P = 0.58
 Identities = 48/171 (28%), Positives = 88/171 (51%), Frame = +2

Query:     5 FIFLIIP--FIIIF-FQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDII 175
             FIF +I   FI+I  F    F I+  I LC I+   FI+  ++ F F+     FIY    
Sbjct:   102 FIFFVIRCLFIVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIF---NFIYGFFS 158

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIM-MYILYVLSFTKIV--II 346
              + + +   F   ++L+++    F F F    I   ++ Y+  +Y++Y  S   ++  I+
Sbjct:   159 FV-IILGLLF---LLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAIL 214

Query:   347 IFKKDIIXLI*SHNIIILVNILNILFMNIFIANVV-ISI---IFG*I-NWFLIYISISF 508
             IF K I   +    + IL+  + I F + F+ + + +S+   IFG + N+ ++  SI +
Sbjct:   215 IFFKFIYFDVFFVFVFILILFI-ISFFSFFLKDFLFLSLYFDIFGSLYNYDILSYSIFY 272

 Score = 78 (27.5 bits), Expect = 6.0, P = 1.0
 Identities = 36/114 (31%), Positives = 59/114 (51%), Frame = +2

Query:     2 FFIFLIIP---FIIIFFQKNGFVIYAFI*--LCIIIIFYFINKYII*FLFMC-ISRPFIY 163
             FF F+II    F+++F   N F  + F+   + II+++Y    Y+I +   C I  P I 
Sbjct:   156 FFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYWLYMI-YSRSCYILMPAIL 214

Query:   164 RDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFF---FILISRCIIIYIMMYILYVLSFT 331
                  I+  V   F  I++L+II     FF FF   F+ +S    I+  +Y   +LS++
Sbjct:   215 IFFKFIYFDVFFVFVFILILFIIS----FFSFFLKDFLFLSLYFDIFGSLYNYDILSYS 269


>sp|P09547|ADR6_YEAST TRANSCRIPTION REGULATORY PROTEIN ADR6 (SWI/SNF COMPLEX
            COMPONENT ADR6) (REGULATORY PROTEIN SWI1) (REGULATORY PROTEIN GAM3)
            >pir||TNBYR6 transcriptional regulatory protein ADR6 - yeast
            (Saccharomyces cerevisiae) >gi|3347 (X12493) put. transcription
            factor (AA 1 - 1314); pid:g3347 [Saccharomyces cerevisiae]
            >gi|965077 (U33335) Adr6p [Saccharomyces cerevisiae]
            Length = 1314

  Minus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.017, P = 0.017
 Identities = 45/163 (27%), Positives = 67/163 (41%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  N   +     +T NN N N +N N +     N N NNN  G     +    NNN N 
Sbjct:     7 NNNNNNNNTTTTTTTTNNNNTNNNNTNNNNNPANNTN-NNNSTGHSSNTNNNTNNNNTNT 65

Query:   331 GEG--QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHD-NTMKSPVD----KHMDHN 173
             G     D QN     ++  P DQN       S+  NN  ++ NT+ S  +      + +N
Sbjct:    66 GASGVDDFQNF----FDPKPFDQNLDSNNNNSNSNNNDNNNSNTVASSTNFTSPTAVVNN 121

Query:   172 NVPINEWPGDAHEKELNNI--FVNKIKNNNDAQSYKGINNKTIFLEENN 32
               P N   G A     N    F +   +NN   +   ++ + I L +N+
Sbjct:   122 AAPANVTGGKAANFIQNQSPQFNSPYDSNNSNTNLNSLSPQAI-LAKNS 169

 Score = 92 (32.4 bits), Expect = 0.61, Sum P(2) = 0.46
 Identities = 33/131 (25%), Positives = 54/131 (41%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDI--FF--K 350
             +N  NT  +  P ++T NN +  + SN N       N N NN   G+   DD   FF  K
Sbjct:    27 TNNNNTNNNNNPANNTNNNNSTGHSSNTN------NNTNNNNTNTGASGVDDFQNFFDPK 80

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
               + N     +  N ++N  NN+ T  +   +   ++  NN    N         + + +
Sbjct:    81 PFDQNLDSNNNNSNSNNNDNNNSNTVASSTNFTSPTAVVNNAAPANVTGGKAANFIQNQS 140

Query:   169 VPINEWPGDAHEKELN 122
                N  P D++    N
Sbjct:   141 PQFNS-PYDSNNSNTN 155

 Score = 41 (14.4 bits), Expect = 0.61, Sum P(2) = 0.46
 Identities = 11/41 (26%), Positives = 21/41 (51%), Frame = -2

Query:   124 NNIFVNKIKNNN-DAQSYKGINNKTIFLEENNDERYNQENE 5
             NN++     NN+ D +  + + N      +NN+ R+N  N+
Sbjct:  1068 NNLYDRNSNNNHKDKKLLRRLLNLYNDNNKNNNNRHNLLND 1108


>sp|P27625|RPC1_PLAFA DNA-DIRECTED RNA POLYMERASE III LARGEST SUBUNIT
            >gi|160596 (M73770) RNA polymerase III largest subunit [Plasmodium
            falciparum]
            Length = 2339

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.017, P = 0.017
 Identities = 34/142 (23%), Positives = 66/142 (46%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N+  N++N   +  +I N + N +I+ ++  +     NN+ N     +  +  +N++NN 
Sbjct:  1066 NKTSNMNNIYNNMNNINNNDSNRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNN- 1124

Query:   280 PTDQNKKEYEEESSGFNNIQH-DNTMKSPVDKHMDHNNVPINEWPGDA-HEKELNNIFVN 107
               D N+       S  N+I + D+ M S  + + + NN+  N+      H  + N   +N
Sbjct:  1125 --DSNRSIIHNNDSNMNSIHNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSN---MN 1179

Query:   106 KIKNN--NDAQSYKGINNKTIFLEEN 35
              I NN  N+  +YK   +      E+
Sbjct:  1180 SIHNNDSNNNNNYKDCTHNPYICNES 1205

 Score = 108 (38.0 bits), Expect = 0.017, P = 0.017
 Identities = 43/170 (25%), Positives = 76/170 (44%), Frame = -2

Query:   511 NKGNTYVDE--EPIDSTKNNRNDNI----SNKNVHKKDIQNINQNNNIVGSDQXDDIFFK 350
             +  NTY+D+  +  D   +  + ++     NK  +   +Q+ N+ +N+  ++  +++   
Sbjct:  1024 DNNNTYLDQFDKVFDHIVSISSSHLLLSYKNKIPYLPHVQHQNKTSNM--NNIYNNMNNI 1081

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NNND+      I N   N+ N    D N       +S  NNI H+N     +  + D N 
Sbjct:  1082 NNNDS--NRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNI-HNNDSNRSIIHNNDSNM 1138

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
               I+    + +    NN  +N I NN+  +S    N+  +    NND   N  N K
Sbjct:  1139 NSIHNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSN-NNNNYK 1193

 Score = 106 (37.3 bits), Expect = 0.032, P = 0.031
 Identities = 41/150 (27%), Positives = 67/150 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             DS  NN N+N SN N     I N N N NNI  +D    I   NN+ N     +  +  +
Sbjct:  1095 DSNMNNINNNDSNMN----SIHNNNSNMNNIHNNDSNRSIIH-NNDSNMNSIHNNDSNMN 1149

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             +++NN     N    +   S  +N  +D+ M S +  +  +NN   N +    H   + N
Sbjct:  1150 SIHNNNSNMNNIHNNDSNRSIIHN--NDSNMNS-IHNNDSNNN---NNYKDCTHNPYICN 1203

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
               +  I+N  +   Y+ I  + +F+   +DE
Sbjct:  1204 ESLI-IRNIMNRLIYQNIAQEDLFIPLEHDE 1233

 Score = 105 (37.0 bits), Expect = 0.042, P = 0.041
 Identities = 28/120 (23%), Positives = 58/120 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             SN+   Y ++  +++  NN ++  +I N N +  +I N + N +I+ ++  +     NN+
Sbjct:  1086 SNRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNND 1145

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
              N     +  +  +N++NN   D N+       S  N+I ++++  +   K   HN    
Sbjct:  1146 SNMNSIHNNNSNMNNIHNN---DSNRSIIHNNDSNMNSIHNNDSNNNNNYKDCTHNPYIC 1202

Query:   160 NE 155
             NE
Sbjct:  1203 NE 1204

 Score = 92 (32.4 bits), Expect = 1.7, P = 0.82
 Identities = 30/120 (25%), Positives = 50/120 (41%), Frame = -2

Query:   451 DNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTD 272
             +N    N       N N NNN    +  +D    NNN+N        N+H +V N   T+
Sbjct:  1514 ENFDRNNYKMITDNNNNDNNNNNNDNNNNDN--NNNNNNSNNNNYYYNLHDDVNNLGVTN 1571

Query:   271 QNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL--NNIFVNKIK 98
              N   Y  + +G    + +N   +      D NN   +E+  + +E +L  +N +  +I 
Sbjct:  1572 YNTNIYPNDCNGIYEKETNNNELTTNSNMCDKNNDFSDEFFNNINENDLLYDNKYYRQIF 1631

Query:    97 NN 92
              N
Sbjct:  1632 KN 1633

 Score = 89 (31.3 bits), Expect = 3.8, P = 0.98
 Identities = 27/111 (24%), Positives = 49/111 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             SN+   Y ++  +++  NN ++  +I N N +  +I N + N +I+ ++  +     NN+
Sbjct:  1086 SNRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNND 1145

Query:   340 DNFGE----GQDIQNIHHNVYNNT---PTDQNKKEYEEESSGFNNIQHDNT 209
              N         ++ NIH+N  N +     D N        S  NN   D T
Sbjct:  1146 SNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSNNNNNYKDCT 1196

 Score = 89 (31.3 bits), Expect = 3.8, P = 0.98
 Identities = 46/170 (27%), Positives = 74/170 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             NK    V +E ID     + +NI    V +KD  ++NQ  +    D  DD    NN+DN 
Sbjct:  2005 NKNAIRVKKEEIDDNLE-KEENIIY--VSEKD--SVNQLKSEKKKDINDDN--NNNDDNN 2057

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI-QHDNTMKSPVDKHMDHNNVPINE 155
                 D   I+  ++N+   D ++   +E  S   N+ +H   +   +   M   NV    
Sbjct:  2058 NNNDDDNKINDTIFNDD-IDSDRNNLKENGSKLENVGEH---IIERLSYKMKEKNVKKEH 2113

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN--QENEK 2
                + +   L+ I ++ +  N D  +   INN+ I   E  DE  N  Q N+K
Sbjct:  2114 IKKEPNLINLDTINLDTL--NFDEINVHNINNEKI---EFYDEHLNICQGNKK 2161

 Score = 88 (31.0 bits), Expect = 5.0, P = 0.99
 Identities = 36/123 (29%), Positives = 58/123 (47%), Frame = -2

Query:   469 TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             T NN NDN +N N +     N N NNN   ++  ++ ++ N +D+      + N + N+Y
Sbjct:  1525 TDNNNNDNNNNNNDNNN---NDNNNNN---NNSNNNNYYYNLHDDVNN-LGVTNYNTNIY 1577

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH--NNVPINEWPGDAHEKELNNI 116
                P D N   YE+E++  N +  ++ M    +   D   NN+  N+   D   K    I
Sbjct:  1578 ---PNDCNGI-YEKETNN-NELTTNSNMCDKNNDFSDEFFNNINENDLLYD--NKYYRQI 1630

Query:   115 FVNKI 101
             F N I
Sbjct:  1631 FKNVI 1635

 Score = 82 (28.9 bits), Expect = 6.4, Sum P(2) = 1.0
 Identities = 27/116 (23%), Positives = 50/116 (43%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             K   +NF +  + + I  N  NN   + N  +     +  NN  + N      + H D N
Sbjct:  1510 KEEKENF-DRNNYKMITDN--NNNDNNNNNNDNNNNDNNNNN-NNSNNNNYYYNLHDDVN 1565

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             N+ +  +  + +  + N I+  K  NNN+  +   + +K     + +DE +N  NE
Sbjct:  1566 NLGVTNYNTNIYPNDCNGIY-EKETNNNELTTNSNMCDKN---NDFSDEFFNNINE 1617

 Score = 73 (25.7 bits), Expect = 1.2, Sum P(2) = 0.70
 Identities = 21/70 (30%), Positives = 36/70 (51%), Frame = -2

Query:   478 IDSTKNNRNDNISN--KNVHKKDIQNINQ---NNNIVGSDQXDDIFFKNNNDNFGE-GQD 317
             I++  N+ N+NI+N  KN  + ++ N+N    NNNI  ++Q  D   +  N  F +    
Sbjct:   486 INNMNNDINNNINNIYKNTSETNLCNVNNHNNNNNIYCNNQTQDNEEERKNSQFNKISLK 545

Query:   316 IQNIHHNVYN 287
               N +H + N
Sbjct:   546 YANKNHVIQN 555

 Score = 71 (25.0 bits), Expect = 1.6, Sum P(2) = 0.80
 Identities = 21/63 (33%), Positives = 32/63 (50%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNK--NVHKKDIQNI---NQNNNIVGSDQXDDIFFK 350
             ++  N   D    D+  NN N N +N   N+H  D+ N+   N N NI  +D  + I+ K
Sbjct:  1530 NDNNNNNNDNNNNDNNNNNNNSNNNNYYYNLHD-DVNNLGVTNYNTNIYPND-CNGIYEK 1587

Query:   349 NNNDN 335
               N+N
Sbjct:  1588 ETNNN 1592

 Score = 67 (23.6 bits), Expect = 1.6, Sum P(2) = 0.80
 Identities = 30/120 (25%), Positives = 57/120 (47%), Frame = -2

Query:   367 DDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQH----DNTMKS 200
             +DI   +N D   +  D    ++NV   T   + K   +EE+     ++     DN  K 
Sbjct:  1967 EDIEVTDNEDEICDDMDE---YYNVSQGTELYERKCNSKEENKNAIRVKKEEIDDNLEKE 2023

Query:   199 PVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERY 20
                 ++   +  +N+   +  +K++N+   N   NNN+      IN+ TIF ++ + +R 
Sbjct:  2024 ENIIYVSEKD-SVNQLKSEK-KKDINDDNNNNDDNNNNNDDDNKIND-TIFNDDIDSDRN 2080

Query:    19 N-QEN 8
             N +EN
Sbjct:  2081 NLKEN 2085

 Score = 66 (23.2 bits), Expect = 1.2, Sum P(2) = 0.70
 Identities = 31/103 (30%), Positives = 44/103 (42%), Frame = -2

Query:   325 GQDIQNIHHNVYNNTPTDQNKKEYEEE---SSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             G D  N  +   NNT  DQ  K ++     SS    + + N  K P   H+ H N   N 
Sbjct:  1014 GDDALNPSYIDNNNTYLDQFDKVFDHIVSISSSHLLLSYKN--KIPYLPHVQHQNKTSN- 1070

Query:   154 WPGDAHEKELNNIF--VNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
                      +NNI+  +N I NN+  +S    N+  +    NND   N
Sbjct:  1071 ---------MNNIYNNMNNINNNDSNRSIIYNNDSNMNNINNNDSNMN 1109

 Score = 48 (16.9 bits), Expect = 6.4, Sum P(2) = 1.0
 Identities = 14/42 (33%), Positives = 23/42 (54%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST---KNNRNDNISNKNVHKKD-IQNIN 401
             +N  N Y + +  D+    KN++ + IS K  +K   IQN+N
Sbjct:   516 NNNNNIYCNNQTQDNEEERKNSQFNKISLKYANKNHVIQNLN 557


>pir||A45597 DNA-directed RNA polymerase (EC 2.7.7.6) III largest chain -
            Plasmodium falciparum
            Length = 2339

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.017, P = 0.017
 Identities = 34/142 (23%), Positives = 66/142 (46%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N+  N++N   +  +I N + N +I+ ++  +     NN+ N     +  +  +N++NN 
Sbjct:  1066 NKTSNMNNIYNNMNNINNNDSNRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNN- 1124

Query:   280 PTDQNKKEYEEESSGFNNIQH-DNTMKSPVDKHMDHNNVPINEWPGDA-HEKELNNIFVN 107
               D N+       S  N+I + D+ M S  + + + NN+  N+      H  + N   +N
Sbjct:  1125 --DSNRSIIHNNDSNMNSIHNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSN---MN 1179

Query:   106 KIKNN--NDAQSYKGINNKTIFLEEN 35
              I NN  N+  +YK   +      E+
Sbjct:  1180 SIHNNDSNNNNNYKDCTHNPYICNES 1205

 Score = 108 (38.0 bits), Expect = 0.017, P = 0.017
 Identities = 43/170 (25%), Positives = 76/170 (44%), Frame = -2

Query:   511 NKGNTYVDE--EPIDSTKNNRNDNI----SNKNVHKKDIQNINQNNNIVGSDQXDDIFFK 350
             +  NTY+D+  +  D   +  + ++     NK  +   +Q+ N+ +N+  ++  +++   
Sbjct:  1024 DNNNTYLDQFDKVFDHIVSISSSHLLLSYKNKIPYLPHVQHQNKTSNM--NNIYNNMNNI 1081

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NNND+      I N   N+ N    D N       +S  NNI H+N     +  + D N 
Sbjct:  1082 NNNDS--NRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNI-HNNDSNRSIIHNNDSNM 1138

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
               I+    + +    NN  +N I NN+  +S    N+  +    NND   N  N K
Sbjct:  1139 NSIHNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSN-NNNNYK 1193

 Score = 106 (37.3 bits), Expect = 0.032, P = 0.031
 Identities = 41/150 (27%), Positives = 67/150 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             DS  NN N+N SN N     I N N N NNI  +D    I   NN+ N     +  +  +
Sbjct:  1095 DSNMNNINNNDSNMN----SIHNNNSNMNNIHNNDSNRSIIH-NNDSNMNSIHNNDSNMN 1149

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             +++NN     N    +   S  +N  +D+ M S +  +  +NN   N +    H   + N
Sbjct:  1150 SIHNNNSNMNNIHNNDSNRSIIHN--NDSNMNS-IHNNDSNNN---NNYKDCTHNPYICN 1203

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
               +  I+N  +   Y+ I  + +F+   +DE
Sbjct:  1204 ESLI-IRNIMNRLIYQNIAQEDLFIPLEHDE 1233

 Score = 105 (37.0 bits), Expect = 0.042, P = 0.041
 Identities = 28/120 (23%), Positives = 58/120 (48%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             SN+   Y ++  +++  NN ++  +I N N +  +I N + N +I+ ++  +     NN+
Sbjct:  1086 SNRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNND 1145

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
              N     +  +  +N++NN   D N+       S  N+I ++++  +   K   HN    
Sbjct:  1146 SNMNSIHNNNSNMNNIHNN---DSNRSIIHNNDSNMNSIHNNDSNNNNNYKDCTHNPYIC 1202

Query:   160 NE 155
             NE
Sbjct:  1203 NE 1204

 Score = 92 (32.4 bits), Expect = 1.7, P = 0.82
 Identities = 30/120 (25%), Positives = 50/120 (41%), Frame = -2

Query:   451 DNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTD 272
             +N    N       N N NNN    +  +D    NNN+N        N+H +V N   T+
Sbjct:  1514 ENFDRNNYKMITDNNNNDNNNNNNDNNNNDN--NNNNNNSNNNNYYYNLHDDVNNLGVTN 1571

Query:   271 QNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL--NNIFVNKIK 98
              N   Y  + +G    + +N   +      D NN   +E+  + +E +L  +N +  +I 
Sbjct:  1572 YNTNIYPNDCNGIYEKETNNNELTTNSNMCDKNNDFSDEFFNNINENDLLYDNKYYRQIF 1631

Query:    97 NN 92
              N
Sbjct:  1632 KN 1633

 Score = 89 (31.3 bits), Expect = 3.8, P = 0.98
 Identities = 27/111 (24%), Positives = 49/111 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             SN+   Y ++  +++  NN ++  +I N N +  +I N + N +I+ ++  +     NN+
Sbjct:  1086 SNRSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNND 1145

Query:   340 DNFGE----GQDIQNIHHNVYNNT---PTDQNKKEYEEESSGFNNIQHDNT 209
              N         ++ NIH+N  N +     D N        S  NN   D T
Sbjct:  1146 SNMNSIHNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSNNNNNYKDCT 1196

 Score = 89 (31.3 bits), Expect = 3.8, P = 0.98
 Identities = 46/170 (27%), Positives = 74/170 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             NK    V +E ID     + +NI    V +KD  ++NQ  +    D  DD    NN+DN 
Sbjct:  2005 NKNAIRVKKEEIDDNLE-KEENIIY--VSEKD--SVNQLKSEKKKDINDDN--NNNDDNN 2057

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI-QHDNTMKSPVDKHMDHNNVPINE 155
                 D   I+  ++N+   D ++   +E  S   N+ +H   +   +   M   NV    
Sbjct:  2058 NNNDDDNKINDTIFNDD-IDSDRNNLKENGSKLENVGEH---IIERLSYKMKEKNVKKEH 2113

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN--QENEK 2
                + +   L+ I ++ +  N D  +   INN+ I   E  DE  N  Q N+K
Sbjct:  2114 IKKEPNLINLDTINLDTL--NFDEINVHNINNEKI---EFYDEHLNICQGNKK 2161

 Score = 88 (31.0 bits), Expect = 5.0, P = 0.99
 Identities = 36/123 (29%), Positives = 58/123 (47%), Frame = -2

Query:   469 TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             T NN NDN +N N +     N N NNN   ++  ++ ++ N +D+      + N + N+Y
Sbjct:  1525 TDNNNNDNNNNNNDNNN---NDNNNNN---NNSNNNNYYYNLHDDVNN-LGVTNYNTNIY 1577

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH--NNVPINEWPGDAHEKELNNI 116
                P D N   YE+E++  N +  ++ M    +   D   NN+  N+   D   K    I
Sbjct:  1578 ---PNDCNGI-YEKETNN-NELTTNSNMCDKNNDFSDEFFNNINENDLLYD--NKYYRQI 1630

Query:   115 FVNKI 101
             F N I
Sbjct:  1631 FKNVI 1635

 Score = 82 (28.9 bits), Expect = 6.4, Sum P(2) = 1.0
 Identities = 27/116 (23%), Positives = 50/116 (43%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             K   +NF +  + + I  N  NN   + N  +     +  NN  + N      + H D N
Sbjct:  1510 KEEKENF-DRNNYKMITDN--NNNDNNNNNNDNNNNDNNNNN-NNSNNNNYYYNLHDDVN 1565

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             N+ +  +  + +  + N I+  K  NNN+  +   + +K     + +DE +N  NE
Sbjct:  1566 NLGVTNYNTNIYPNDCNGIY-EKETNNNELTTNSNMCDKN---NDFSDEFFNNINE 1617

 Score = 73 (25.7 bits), Expect = 1.2, Sum P(2) = 0.70
 Identities = 21/70 (30%), Positives = 36/70 (51%), Frame = -2

Query:   478 IDSTKNNRNDNISN--KNVHKKDIQNINQ---NNNIVGSDQXDDIFFKNNNDNFGE-GQD 317
             I++  N+ N+NI+N  KN  + ++ N+N    NNNI  ++Q  D   +  N  F +    
Sbjct:   486 INNMNNDINNNINNIYKNTSETNLCNVNNHNNNNNIYCNNQTQDNEEERKNSQFNKISLK 545

Query:   316 IQNIHHNVYN 287
               N +H + N
Sbjct:   546 YANKNHVIQN 555

 Score = 71 (25.0 bits), Expect = 1.6, Sum P(2) = 0.80
 Identities = 21/63 (33%), Positives = 32/63 (50%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNK--NVHKKDIQNI---NQNNNIVGSDQXDDIFFK 350
             ++  N   D    D+  NN N N +N   N+H  D+ N+   N N NI  +D  + I+ K
Sbjct:  1530 NDNNNNNNDNNNNDNNNNNNNSNNNNYYYNLHD-DVNNLGVTNYNTNIYPND-CNGIYEK 1587

Query:   349 NNNDN 335
               N+N
Sbjct:  1588 ETNNN 1592

 Score = 67 (23.6 bits), Expect = 1.6, Sum P(2) = 0.80
 Identities = 30/120 (25%), Positives = 57/120 (47%), Frame = -2

Query:   367 DDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQH----DNTMKS 200
             +DI   +N D   +  D    ++NV   T   + K   +EE+     ++     DN  K 
Sbjct:  1967 EDIEVTDNEDEICDDMDE---YYNVSQGTELYERKCNSKEENKNAIRVKKEEIDDNLEKE 2023

Query:   199 PVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERY 20
                 ++   +  +N+   +  +K++N+   N   NNN+      IN+ TIF ++ + +R 
Sbjct:  2024 ENIIYVSEKD-SVNQLKSEK-KKDINDDNNNNDDNNNNNDDDNKIND-TIFNDDIDSDRN 2080

Query:    19 N-QEN 8
             N +EN
Sbjct:  2081 NLKEN 2085

 Score = 66 (23.2 bits), Expect = 1.2, Sum P(2) = 0.70
 Identities = 31/103 (30%), Positives = 44/103 (42%), Frame = -2

Query:   325 GQDIQNIHHNVYNNTPTDQNKKEYEEE---SSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
             G D  N  +   NNT  DQ  K ++     SS    + + N  K P   H+ H N   N 
Sbjct:  1014 GDDALNPSYIDNNNTYLDQFDKVFDHIVSISSSHLLLSYKN--KIPYLPHVQHQNKTSN- 1070

Query:   154 WPGDAHEKELNNIF--VNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
                      +NNI+  +N I NN+  +S    N+  +    NND   N
Sbjct:  1071 ---------MNNIYNNMNNINNNDSNRSIIYNNDSNMNNINNNDSNMN 1109

 Score = 48 (16.9 bits), Expect = 6.4, Sum P(2) = 1.0
 Identities = 14/42 (33%), Positives = 23/42 (54%), Frame = -2

Query:   514 SNKGNTYVDEEPIDST---KNNRNDNISNKNVHKKD-IQNIN 401
             +N  N Y + +  D+    KN++ + IS K  +K   IQN+N
Sbjct:   516 NNNNNIYCNNQTQDNEEERKNSQFNKISLKYANKNHVIQNLN 557


>gnl|PID|e276379 (Y08924) AARP2 protein [Plasmodium falciparum]
            Length = 1360

  Minus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.018, P = 0.018
 Identities = 39/164 (23%), Positives = 73/164 (44%), Frame = -2

Query:   472 STKNNRNDNISNKNVHK--KDIQNINQNNNIVGSDQXDD-IFFKNNNDNFGEGQDIQNIH 302
             S+ +N+  N + K +    K I+ + ++N +    Q D+ I F   NDN+G     +   
Sbjct:   463 SSHHNKQSNDNEKYITDSIKMIRELQKSNGVFSKQQKDNLILFNETNDNYGASNIRRKAP 522

Query:   301 HNVYNNTPTDQNKKE--Y-EEESSGFNNIQHDNTMKSPVDK-HMDHNNVPINEWPGDAHE 134
              NVY +    + K++  Y  E++  +N ++     K   D+ +   NNV I+    D  E
Sbjct:   523 SNVYISEKQKKKKQQDSYVNEKAEEYNKLESILYEKKNNDEEYYCANNVTISS-DDDKEE 581

Query:   133 KELN-NIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              + +   F  K   N D     G N+  I+  + ++E+     +K
Sbjct:   582 NDASFREFYRKYGLNADMSDDGGNNDINIYNGQESEEKLKDTYDK 626

 Score = 94 (33.1 bits), Expect = 0.54, P = 0.42
 Identities = 28/102 (27%), Positives = 49/102 (48%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNF 332
             +GN  ++ E  D+  NN +D+    N++  D  N + +NN    D   +    N+N D+ 
Sbjct:   891 RGNMGINSEGDDNNNNNSDDD---NNINSDDNNNYSDDNNSNSDDNNSNSDDNNSNSDDN 947

Query:   331 GEGQDIQNIHHNVYN-NTPTDQNKKEYEEESSGFNNIQHDNTMK 203
                 D  NI+ +  N N+  D N K+ ++ + G N I     +K
Sbjct:   948 NSNSDDNNINSDDNNINSGDDNNLKDKDKGNIG-NEINIKENLK 990

 Score = 90 (31.7 bits), Expect = 0.046, Sum P(2) = 0.045
 Identities = 29/93 (31%), Positives = 46/93 (49%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNR--NDNISNK--NVHKKDIQNINQNNNIVGSDQXDDIFFKNN 344
             N  N   D+  I+S  NN   +DN SN   N    D  N N ++N   SD  ++I   +N
Sbjct:   903 NNNNNSDDDNNINSDDNNNYSDDNNSNSDDNNSNSDDNNSNSDDNNSNSDD-NNINSDDN 961

Query:   343 NDNFGEGQDIQNIHH-NVYNNTPTDQNKKEYEEE 245
             N N G+  ++++    N+ N     +N K+ +EE
Sbjct:   962 NINSGDDNNLKDKDKGNIGNEINIKENLKKLKEE 995

 Score = 87 (30.6 bits), Expect = 3.7, P = 0.98
 Identities = 38/154 (24%), Positives = 75/154 (48%), Frame = -2

Query:   490 DEEPIDSTKN--NRNDNISNKNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNFGEGQ 320
             DE+  D  +N  + ND+  + + +  D +N + +N++   +D  DD   +N++D+  +  
Sbjct:   633 DEDDYDDDENVGDENDDDDDDDENDDDKENDDDENDDDEENDDDDDDDDENDDDDENDDD 692

Query:   319 DIQNIHHNVYNNTPT----DQNKKEYEEESSGFNN--IQHDNTMKSPVDKHMDHNNVPIN 158
             D +N+  +  N+       D+N  + +++ + +NN  ++H NT+        D N   +N
Sbjct:   693 D-ENVGDDDENDDDDENVGDENIDDDDDDYNNYNNKELKHKNTL--------DPNKSTVN 743

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
                 +AH+      F NKI  +     +  IN K   L    D
Sbjct:   744 RM--EAHDIADILSFDNKISLDTFIYDFSYINRKNNLLYFRGD 784

 Score = 86 (30.3 bits), Expect = 4.8, P = 0.99
 Identities = 34/153 (22%), Positives = 60/153 (39%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI----QNIHHN 296
             N  NDN    N+ +K   N+  +       Q D  +     + + + + I    +N    
Sbjct:   506 NETNDNYGASNIRRKAPSNVYISEKQKKKKQQDS-YVNEKAEEYNKLESILYEKKNNDEE 564

Query:   295 VY-NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
              Y  N  T  +  + EE  + F        + +  D   D  N  IN + G   E++L +
Sbjct:   565 YYCANNVTISSDDDKEENDASFREFYRKYGLNA--DMSDDGGNNDINIYNGQESEEKLKD 622

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              +   I   +D   Y    N     +EN+D+  + EN+
Sbjct:   623 TYDKLIDGGDDEDDYDDDENVG---DENDDDDDDDEND 657

 Score = 55 (19.4 bits), Expect = 0.046, Sum P(2) = 0.045
 Identities = 24/93 (25%), Positives = 41/93 (44%), Frame = -2

Query:   271 QNK-KEYEEESSGFN-NIQHDNTMKSPVDKHMDHNNVPI-NEWPGDAHEKELNNIFVNKI 101
             +NK K   E    +N  + H+N  +S   +H  H  + I ++   D   K    +F  K+
Sbjct:  1252 ENKIKSINELRYLYNIYVNHNNNYRSIPFRHFYHTKIQIKSKLLKDLPFKSKPKLF-KKL 1310

Query:   100 KNN---NDAQSYKGINNKTIFLEENNDERYNQEN 8
             +N+   N+ Q    INNK    ++ N      +N
Sbjct:  1311 QNHANLNNKQLTNNINNKKTKTDQINFNALPNQN 1344

 Score = 51 (18.0 bits), Expect = 0.12, Sum P(2) = 0.11
 Identities = 22/80 (27%), Positives = 36/80 (45%), Frame = -2

Query:   271 QNK-KEYEEESSGFN-NIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI-FVNKI 101
             +NK K   E    +N  + H+N  +S   +H  H  + I         K L ++ F +K 
Sbjct:  1252 ENKIKSINELRYLYNIYVNHNNNYRSIPFRHFYHTKIQIKS-------KLLKDLPFKSKP 1304

Query:   100 KNNNDAQSYKGINNKTIFLEENN 32
             K     Q++  +NNK +    NN
Sbjct:  1305 KLFKKLQNHANLNNKQLTNNINN 1327

 Score = 41 (14.4 bits), Expect = 1.2, Sum P(2) = 0.69
 Identities = 8/21 (38%), Positives = 16/21 (76%), Frame = -3

Query:   273 IRIKKNMKKNQVASIIYNMII 211
             +RI+ N++K ++A +  N+II
Sbjct:  1026 VRIELNIEKKKLAILKNNLII 1046


>gi|476024 (L32150) carbamoyl phosphate synthetase II [Plasmodium falciparum]
           Length = 2391

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.018, P = 0.018
 Identities = 42/170 (24%), Positives = 72/170 (42%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             S   + Y+D       +   N N+      +K I N N  N+    D   +  +K N   
Sbjct:  1526 STNDHLYLDNFNTSDEEIGNNKNMDMYLSKEKSISNKNPGNSYYVVDSVYNNEYKINK-- 1583

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI-QHDNTMKSPVDKHMDHNNVPIN 158
               E  D +N++   YNN   + N   Y   S+  N   ++DN     ++K+MDH     N
Sbjct:  1584 MKELIDNENLNDE-YNNN-VNMNCSNYNNASAFVNGKDRNDNLENDCIEKNMDHTYKHYN 1641

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYK--GIN--NKTIFLEENNDERYNQEN 8
                      E   + VN  K +N  + ++  G+N  NK   +E+N  +  +++N
Sbjct:  1642 RLNNRRSTNERMMLMVNNEKESNHEKGHRRNGLNKKNKEKNMEKNKGKNKDKKN 1695

 Score = 101 (35.6 bits), Expect = 0.14, P = 0.13
 Identities = 43/178 (24%), Positives = 76/178 (42%), Frame = -2

Query:   511 NKGNTYV---DEEPIDST----KNNRNDNISNKNVHKKDI--QNINQNNNIVGSDQXDDI 359
             NK N+ +   DEE I       +NN N  I+N +  KKD+  +NIN        ++  D+
Sbjct:  1450 NKENSSLLKGDEEDIVMVNLKKENNYNSVINNVDCRKKDMDGKNINDECKTYKKNKYKDM 1509

Query:   358 FFKNNN-DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM 182
                NN  D    G       H   +N  T   +    +    + + +   + K+P + + 
Sbjct:  1510 GLNNNIVDELSNGTSHSTNDHLYLDNFNTSDEEIGNNKNMDMYLSKEKSISNKNPGNSYY 1569

Query:   181 DHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
               ++V  NE+  +  ++ ++N  +N   NNN   +    NN + F+    D   N EN+
Sbjct:  1570 VVDSVYNNEYKINKMKELIDNENLNDEYNNNVNMNCSNYNNASAFVN-GKDRNDNLEND 1627

 Score = 99 (34.8 bits), Expect = 0.24, P = 0.22
 Identities = 40/158 (25%), Positives = 81/158 (51%), Frame = -2

Query:   460 NRNDNISNKNVHKK-D--IQNINQNNNIVGSDQXDDIFFKNNNDNFGE------GQDIQN 308
             +RNDN+ N  + K  D   ++ N+ NN   +++   +   N  ++  E      G + +N
Sbjct:  1619 DRNDNLENDCIEKNMDHTYKHYNRLNNRRSTNERMMLMVNNEKESNHEKGHRRNGLNKKN 1678

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKE 128
                N+  N   +++KK Y   +   NN  + N ++S  + ++D     IN+   + +E E
Sbjct:  1679 KEKNMEKNKGKNKDKKNYHYVNHKRNNEYNSNNIESKFNNYVDD----INK--KEYYEDE 1732

Query:   127 LNNI--FVNKIKNNNDAQSYKG-INNKTIFLEENNDERYNQENEK 2
              N+I  F +  + NND  S    ++++ +  +E +D+ Y  E+E+
Sbjct:  1733 -NDIYYFTHSSQGNNDDLSNDNYLSSEELNTDEYDDDYYYDEDEE 1776

 Score = 96 (33.8 bits), Expect = 0.57, P = 0.43
 Identities = 49/172 (28%), Positives = 83/172 (48%), Frame = -2

Query:   511 NKGNTY--VDEEPIDSTKNNR-NDNISNKNVHKKDIQNINQN----NN----IVGSDQXD 365
             N GN+Y  VD    +  K N+  + I N+N++ +   N+N N    NN    + G D+ D
Sbjct:  1563 NPGNSYYVVDSVYNNEYKINKMKELIDNENLNDEYNNNVNMNCSNYNNASAFVNGKDRND 1622

Query:   364 DIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKK----EYEEESSGFNNIQHDNTMKSP 197
             ++     ND   +  D    H+N  NN  +   +       E+ES+     + +   K  
Sbjct:  1623 NL----ENDCIEKNMDHTYKHYNRLNNRRSTNERMMLMVNNEKESNHEKGHRRNGLNKKN 1678

Query:   196 VDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNK-TIFLEE-NNDER 23
              +K+M+ N        G   +K+ N  +VN  K NN+  S   I +K   ++++ N  E 
Sbjct:  1679 KEKNMEKNK-------GKNKDKK-NYHYVNH-KRNNEYNS-NNIESKFNNYVDDINKKEY 1728

Query:    22 YNQENE 5
             Y  EN+
Sbjct:  1729 YEDEND 1734

 Score = 90 (31.7 bits), Expect = 3.0, P = 0.95
 Identities = 44/173 (25%), Positives = 77/173 (44%), Frame = -2

Query:   502 NTYVDEEPIDSTK-NNRNDNISNKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNN--ND 338
             N  VD++     K NN N+N+++ NV  K   N      NN       ++I  +NN  +D
Sbjct:  1281 NEVVDDKDTQLHKENNNNNNMNSGNVENKCKLNKESYGYNNSSNCINTNNINIENNICHD 1340

Query:   337 ---NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI--QHDNTMKSPVDKHMDHN 173
                N      I N ++++ NN   + N     E + G ++I  + + ++ S     +   
Sbjct:  1341 ISINKNIKVTINNSNNSISNNENVETNLNCVSERA-GSHHIYGKEEKSIGSDDTNILSAQ 1399

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND--ERYNQEN 8
             N   N +  +       N+ VN ++N  D +  + IN  T+F+E  N      N+EN
Sbjct:  1400 NSN-NNFSCNNENMNKANVDVNVLEN--DTKKREDINTTTVFMEGQNSVINNKNKEN 1453

 Score = 89 (31.3 bits), Expect = 3.9, P = 0.98
 Identities = 37/170 (21%), Positives = 77/170 (45%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N+  + E +++  N  ++   + +++ K+ ++I  ++  + S Q  +  F  NN+N
Sbjct:  1352 NNSNNSISNNENVETNLNCVSERAGSHHIYGKEEKSIGSDDTNILSAQNSNNNFSCNNEN 1411

Query:   334 FGEGQ-DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
               +   D+  + ++       +      E ++S  NN   +N   S + K  + + V +N
Sbjct:  1412 MNKANVDVNVLENDTKKREDINTTTVFMEGQNSVINNKNKEN---SSLLKGDEEDIVMVN 1468

Query:   157 EWPGDAHEKELNNIFVNKI----KNNND-AQSYKGINNKTIFLEENN-DERYN 17
                 + +   +NN+   K     KN ND  ++YK    K + L  N  DE  N
Sbjct:  1469 LKKENNYNSVINNVDCRKKDMDGKNINDECKTYKKNKYKDMGLNNNIVDELSN 1521

 Score = 89 (31.3 bits), Expect = 3.9, P = 0.98
 Identities = 36/170 (21%), Positives = 72/170 (42%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             NKG    D++      + RN+  ++ N+  K    ++  N     +  +DI++  ++   
Sbjct:  1686 NKGKNK-DKKNYHYVNHKRNNEYNSNNIESKFNNYVDDINKKEYYEDENDIYYFTHSSQ- 1743

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
             G   D+ N ++       TD+   +Y  +    ++   DN      D   D  +   N++
Sbjct:  1744 GNNDDLSNDNYLSSEELNTDEYDDDYYYDEDEEDDYDDDNDDDDDDDD--DGEDEEDNDY 1801

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERY---NQENEK 2
               D      N++  ++I + +    Y G  N+ IF E+ ND  +   +  NEK
Sbjct:  1802 YNDDGYDSYNSLSSSRISDVSSV-IYSG--NENIFNEKYNDIGFKIIDNRNEK 1851


>sp|P34127|MYBH_DICDI MYB-LIKE PROTEIN
            Length = 451

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.020, P = 0.019
 Identities = 34/130 (26%), Positives = 65/130 (50%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDI-QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             +++  N  +DN SN + ++ D  QN N NNN   ++  ++   ++++D+     D Q   
Sbjct:    24 LNAANNTNSDNSSNNSDNENDDNQNNNNNNNNNNNNNNEEEEEEDDDDD----DDSQQNR 79

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             HN+  + P   NK      ++  NNI ++ N M + ++ + ++NN+  N          +
Sbjct:    80 HNI--SIPFTINKNSINNNNNLINNINNNINNMNNNMNNNNNNNNMNNN----------I 127

Query:   124 NNIFVNKIKNNN 89
             NN   + I NNN
Sbjct:   128 NNNGNSNISNNN 139

 Score = 100 (35.2 bits), Expect = 0.026, P = 0.026
 Identities = 28/107 (26%), Positives = 57/107 (53%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDI-QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             +++  N  +DN SN + ++ D  QN N NNN   ++  ++   ++++D+     D Q   
Sbjct:    24 LNAANNTNSDNSSNNSDNENDDNQNNNNNNNNNNNNNNEEEEEEDDDDD----DDSQQNR 79

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVPIN 158
             HN+  + P   NK      ++  NNI ++ N M + ++ + ++NN+  N
Sbjct:    80 HNI--SIPFTINKNSINNNNNLINNINNNINNMNNNMNNNNNNNNMNNN 126

 Score = 100 (35.2 bits), Expect = 0.026, P = 0.026
 Identities = 37/135 (27%), Positives = 64/135 (47%), Frame = -2

Query:   406 INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNN 227
             +N  NN   SD        NN+DN  E  D QN ++N  NN   +  ++E E++    ++
Sbjct:    24 LNAANN-TNSDNSS-----NNSDN--ENDDNQNNNNNNNNNNNNNNEEEEEEDDDDDDDS 75

Query:   226 IQHDNTMKSP--VDKH-MDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNK 56
              Q+ + +  P  ++K+ +++NN  IN          +NN+  N   NNN+      INN 
Sbjct:    76 QQNRHNISIPFTINKNSINNNNNLINNI-----NNNINNMNNNMNNNNNNNNMNNNINNN 130

Query:    55 -TIFLEENNDERYNQENEK 2
                 +  NN  +  ++  K
Sbjct:   131 GNSNISNNNTPKVEKKKTK 149

 Score = 88 (31.0 bits), Expect = 0.75, P = 0.53
 Identities = 27/107 (25%), Positives = 53/107 (49%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNIN---QNNNIVGSDQXDDIFFKNN 344
             SN  +   D+   ++  NN N+N +N+   ++D  + +   QN + +      +    NN
Sbjct:    36 SNNSDNENDDNQNNNNNNNNNNNNNNEEEEEEDDDDDDDSQQNRHNISIPFTINKNSINN 95

Query:   343 NDNF--GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMK 203
             N+N       +I N+++N+ NN   + N       ++G +NI ++NT K
Sbjct:    96 NNNLINNINNNINNMNNNMNNNN--NNNNMNNNINNNGNSNISNNNTPK 142

 Score = 86 (30.3 bits), Expect = 1.3, P = 0.73
 Identities = 27/114 (23%), Positives = 54/114 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N+     D++  D ++ NR+ NIS      K+  +IN NNN++ +   +     NN +N
Sbjct:    60 NNEEEEEEDDDDDDDSQQNRH-NISIPFTINKN--SINNNNNLINNINNNINNMNNNMNN 116

Query:   334 FGEGQDIQN-IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
                  ++ N I++N  +N   +   K  ++++ G    + D  +   V+ H   N
Sbjct:   117 NNNNNNMNNNINNNGNSNISNNNTPKVEKKKTKGKWTSEEDQILIKAVNLHNQKN 171


>pir||S14577 asparagine-rich protein (clone 14C1) - Plasmodium falciparum
            >gi|9843 (X17483) Plasmodium falciparum mRNA for asparagine-rich
            antigen (clone 14C1) [Plasmodium falciparum]
            Length = 391

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.021, P = 0.021
 Identities = 48/170 (28%), Positives = 73/170 (42%), Frame = -2

Query:   511 NKGNTYVDEEPIDST---KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDI-FFKNN 344
             N G T  D     +T    NN N+N +N N +  +  N N NNN   S+  + +  F ++
Sbjct:   146 NNGTTLRDSHHYVTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNPSSSNLINTLNTFLSD 205

Query:   343 NDNFGEGQD---IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
              DN     +   + N   N   NT   QNKKE        NN  ++  + + +  HM+H 
Sbjct:   206 KDNSLHAVNPSVLLNDKLNYLTNTLL-QNKKE--NILLNLNNNMNEIDILNFL--HMEHK 260

Query:   172 -NVPIN-EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
              N+ +  E     +EK+  N   NK   N+   +Y    N       NN+   NQ
Sbjct:   261 KNMSLTQENITPQNEKDTYNESANKSLYNDMDLNYNNNQNNNNNNNNNNNNNNNQ 315

 Score = 86 (30.3 bits), Expect = 1.1, P = 0.66
 Identities = 39/165 (23%), Positives = 68/165 (41%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN----ND--NFGEGQDI 314
             ++  NN N+N +N N +     N+    N   SD+ + +   N     ND  N+     +
Sbjct:   172 NNNNNNNNNNNNNNNNNNPSSSNLINTLNTFLSDKDNSLHAVNPSVLLNDKLNYLTNTLL 231

Query:   313 QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI-NEWPGDAH 137
             QN   N+  N   + N    E +   F +++H   M    +     N     NE    + 
Sbjct:   232 QNKKENILLNLNNNMN----EIDILNFLHMEHKKNMSLTQENITPQNEKDTYNESANKSL 287

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTI--FLEE--NNDERYNQENEK 2
               +++  + N   NNN+  +    NN  I   L +   N++  + ENEK
Sbjct:   288 YNDMDLNYNNNQNNNNNNNNNNNNNNNQIDNLLHKFITNNDAIHLENEK 336

 Score = 86 (30.3 bits), Expect = 1.1, P = 0.66
 Identities = 43/174 (24%), Positives = 73/174 (41%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN----ND--NFGEGQDI 314
             ++  NN N+N +N N +     N+    N   SD+ + +   N     ND  N+     +
Sbjct:   172 NNNNNNNNNNNNNNNNNNPSSSNLINTLNTFLSDKDNSLHAVNPSVLLNDKLNYLTNTLL 231

Query:   313 QNIHHNVYNNTPTDQNKKE-----YEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI-NEW 152
             QN   N+  N   + N+ +     + E     +  Q + T ++  D + +  N  + N+ 
Sbjct:   232 QNKKENILLNLNNNMNEIDILNFLHMEHKKNMSLTQENITPQNEKDTYNESANKSLYNDM 291

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQS----YKGI-NNKTIFLE-ENNDERYNQEN 8
               + +  + NN   N   NNN+ Q     +K I NN  I LE E N  +   EN
Sbjct:   292 DLNYNNNQNNNNNNNNNNNNNNNQIDNLLHKFITNNDAIHLENEKNTLKIINEN 345

 Score = 85 (29.9 bits), Expect = 1.4, P = 0.75
 Identities = 40/155 (25%), Positives = 67/155 (43%), Frame = -2

Query:   472 STKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             S  NN N+ NI N      ++ N+N  NN+   +  ++I   +NN  +    +I+N  H 
Sbjct:    38 SNINNMNNMNIMNNMNIMNNVNNMNSVNNMNNMNNMNNI---HNNVQYMNNIEIENTTHP 94

Query:   295 VYNNTPTDQNKKEY------EEESSGFNNIQHDNT-MKSPVDKHMDHNNVPINEWPGDAH 137
              Y  T   +NKK+       +  S    N+  D   M +P     ++ ++ I E  G   
Sbjct:    95 -Y--TTVGENKKDCFDILNNQMRSENLKNVLKDVLKMNTPGSTMTNNYHMNIKENNGTTL 151

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                 ++ +V    NNN+  +    NN       NN+   N  N
Sbjct:   152 RD--SHHYVTTTTNNNNNNNNNNNNNNN---NNNNNNNNNNNN 189

 Score = 84 (29.6 bits), Expect = 1.9, P = 0.84
 Identities = 43/157 (27%), Positives = 71/157 (45%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ++  K  R  NI+N N +   + N+N  NN+   +  +++   NN +N      + NIH+
Sbjct:    29 VEQEKFLRMSNINNMN-NMNIMNNMNIMNNVNNMNSVNNM---NNMNN------MNNIHN 78

Query:   298 NV-Y-NNTPTDQNKKEY----EEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
             NV Y NN   +     Y    E +   F+ +  +N M+S   K++  + + +N  PG   
Sbjct:    79 NVQYMNNIEIENTTHPYTTVGENKKDCFDIL--NNQMRSENLKNVLKDVLKMNT-PGSTM 135

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                 NN  +N IK NN        +  T     NN+   N  N
Sbjct:   136 T---NNYHMN-IKENNGTTLRDSHHYVTTTTNNNNNNNNNNNN 174


>gi|1816500 (L06303) 8b2 protein [Plasmodium falciparum]
            Length = 286

  Minus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.022, P = 0.022
 Identities = 40/159 (25%), Positives = 72/159 (45%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG---EGQDIQNIHHN 296
             KN+   N  NKN++ K   N+N +N+ V  ++ + + F N N+ F    +     N   +
Sbjct:   117 KNSFIYNDKNKNINYKGENNMNIHNSNVYENKYE-MNFDNKNEKFNIPNKRYIYLNGDDS 175

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE-----WPGDAHEK 131
              Y       NKK+ +  S+  NNI   +++  P    + H N+ +       +  D   +
Sbjct:   176 NYKKKKQRTNKKKIQNNSNISNNIYTSSSVGCPHCTCITHKNISMTRGKTYSYYSDESNQ 235

Query:   130 ELNNI--FVNK--IKNNNDAQSYKGINNKTIFLEENNDERY 20
               NN+  F+N   I +N    ++  I+   IF+   N +RY
Sbjct:   236 HTNNLIKFMNPKTIMSNKLISNFIDIDRNPIFVPAYN-QRY 275

 Score = 78 (27.5 bits), Expect = 6.0, P = 1.0
 Identities = 32/115 (27%), Positives = 57/115 (49%), Frame = -2

Query:   502 NTYV-DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE 326
             N Y+ DE  ID+  N + D+IS+     K +  IN++N  + +   +++    N DN   
Sbjct:    59 NKYINDENDIDNLTNIQ-DSISSFG---KKLNYINESNETIRNYSINNLCKIMNEDN--- 111

Query:   325 GQDIQNIHHNVYNNTPTDQNKK-EYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
              Q   N +  +YN    D+NK   Y+ E++   NI + N  ++  + + D+ N   N
Sbjct:   112 -QKGFNKNSFIYN----DKNKNINYKGENN--MNIHNSNVYENKYEMNFDNKNEKFN 161


>sp|P10961|HSF_YEAST HEAT SHOCK FACTOR PROTEIN (HSF) (HEAT SHOCK TRANSCRIPTION
            FACTOR) (HSTF) >pir||A31593 heat shock transcription factor - yeast
            (Saccharomyces cerevisiae) >gi|171708 (J03139) heat shock factor
            protein [Saccharomyces cerevisiae] >gnl|PID|e243960 (Z72596) ORF
            YGL073w [Saccharomyces cerevisiae]
            Length = 833

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.025, Sum P(2) = 0.025
 Identities = 39/156 (25%), Positives = 79/156 (50%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDI-QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             D++ +  + N +N+   KK+I +NI  NN+I+     +DI F  N  N     ++ N + 
Sbjct:   476 DNSIDTASTNTTNR---KKNIDENIKNNNDII-----NDIIFNTNLAN-----NLSNYNS 522

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
             N    +P    K+ Y  ++   ++   +N   +P D    +N+  I+E P D  E+E  +
Sbjct:   523 NNNAGSPIRPYKQRYLLKNRANSSTSSENPSLTPFDIE-SNNDRKISEIPFDDEEEEETD 581

Query:   118 I--FVNKIKNNNDAQSYKGINNKTIFLEEN-------NDERYNQEN 8
                F ++  NN  +++    N  T+  +++       ND ++N+ +
Sbjct:   582 FRPFTSRDPNNQTSENTFDPNRFTMLSDDDLKKDSHTNDNKHNESD 627

 Score = 91 (32.0 bits), Expect = 0.15, Sum P(2) = 0.14
 Identities = 38/167 (22%), Positives = 74/167 (44%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-------NFGEGQD 317
             ++T N RN+   N + +  D  + N  N     D+      KNNND       N     +
Sbjct:   461 NATTNARNNMSPNNDDNSIDTASTNTTNRKKNIDEN----IKNNNDIINDIIFNTNLANN 516

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
             + N + N    +P    K+ Y  ++   ++   +N   +P D    +N+  I+E P D  
Sbjct:   517 LSNYNSNNNAGSPIRPYKQRYLLKNRANSSTSSENPSLTPFDIE-SNNDRKISEIPFDDE 575

Query:   136 EKELNNI--FVNKIKNNNDAQSYKGINNKTIFLEEN-------NDERYNQEN 8
             E+E  +   F ++  NN  +++    N  T+  +++       ND ++N+ +
Sbjct:   576 EEEETDFRPFTSRDPNNQTSENTFDPNRFTMLSDDDLKKDSHTNDNKHNESD 627

 Score = 44 (15.5 bits), Expect = 0.025, Sum P(2) = 0.025
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -2

Query:   481 PIDST--KNNRNDNISNKN 431
             P+D+    NN N+NIS+ N
Sbjct:   298 PLDNAAGSNNSNNNISSSN 316


>pir||S29870 DNA-binding protein BAF1 - yeast (Saccharomyces cerevisiae)
            >gi|486187 (Z28111) ORF YKL112w [Saccharomyces cerevisiae]
            >gb||S93804_2 (S93804) ARS-binding factor I [Saccharomyces
            cerevisiae]
            Length = 731

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.027, P = 0.027
 Identities = 42/186 (22%), Positives = 82/186 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRN-----DNISN--KNVHKKDIQNINQNNNIVGSDQ----- 371
             S  GN    E    S  NN N     D+I +   N++ +D  N N +NN V +D      
Sbjct:    78 SYAGNAASSETSSPSANNNTNPPGTPDHIHHHSNNMNNEDNDNNNGSNNKVSNDSKLDFV 137

Query:   370 XDDIFFKNNNDNFGEGQD-IQNIHHNVYNNTPTDQNKKE-YEEESSGFNNIQHDNTM-KS 200
              DD+ +   N +  +  D +++  + V  N   D +    ++++     N   D+++ K+
Sbjct:   138 TDDLEYHLANTHPDDTNDKVESRSNEVNGNNDDDADANNIFKQQGVTIKNDTEDDSINKA 197

Query:   199 PVDKHMDHNNVPI--NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
              +D+ +D  + P   N+     H +E +++     KN +D  + + IN        N D 
Sbjct:   198 SIDRGLDDESGPTHGNDSGNHRHNEE-DDVHTQMTKNYSDVVNDEDINVAIANAVANVDS 256

Query:    25 RYNQENE 5
             + N +++
Sbjct:   257 QSNNKHD 263

 Score = 87 (30.6 bits), Expect = 0.29, Sum P(2) = 0.25
 Identities = 22/95 (23%), Positives = 46/95 (48%), Frame = -2

Query:   418 DIQNINQNNNIVGSD-QXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEES 242
             D+Q  + +NN   +D +      ++N+ ++ + Q+I +   +       + NK +  +++
Sbjct:   441 DLQPSSSSNNNNNNDGELSGTNLRSNSIDYAKHQEISSAGTSSNTTKNVNNNKNDSNDDN 500

Query:   241 SGFNNIQHDNTMKSPVDKHMDHNNVP-----INEW 152
             +G NN    N M+S +DK   H   P     +N+W
Sbjct:   501 NGNNNNDASNLMESVLDKTSSHRYQPKKMPSVNKW 535

 Score = 45 (15.8 bits), Expect = 0.29, Sum P(2) = 0.25
 Identities = 11/34 (32%), Positives = 19/34 (55%), Frame = -2

Query:   478 IDSTKNNRND----NISNKNVHKKDIQNINQNNN 389
             +DS  NN++D    + +N N  + +  N + NNN
Sbjct:   254 VDSQSNNKHDGKDDDATNNNDGQDNNTNNDHNNN 287

 Score = 38 (13.4 bits), Expect = 1.4, Sum P(2) = 0.76
 Identities = 7/22 (31%), Positives = 13/22 (59%), Frame = -2

Query:   475 DSTKNN-RNDNISNKNVHKKDI 413
             D   NN  ND+ +N N++  ++
Sbjct:   274 DGQDNNTNNDHNNNSNINNNNV 295


>sp|P29126|XYNA_RUMFL BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE XYLA PRECURSOR
            >pir||S20907 endo-1,4-beta-xylanase (EC 3.2.1.8) precursor,
            bifunctional - Ruminococcus flavefaciens >gi|581505 (Z11127) XYLA
            of Ruminococcus flavefaciens [Ruminococcus flavefaciens]
            Length = 954

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.028, P = 0.028
 Identities = 43/157 (27%), Positives = 79/157 (50%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             +NN  +  +N+N ++++  N  + NNN   ++Q  + +  NN +N+   Q  QN   N +
Sbjct:   369 QNNDWNQWNNQNNNQQNAWNGWDNNNNWNQNNQQQNNWDWNNQNNWNNNQQ-QNNDWNQW 427

Query:   289 NNTPTDQNKKEYEEESSGFNNI-QHDNTMKSPVDKH-MDHNNVPINEWPG-DAHEK---- 131
             NN     N ++   + + +NN  Q +N      +++  + NN   N W G D +      
Sbjct:   428 NNQNNWNNNQQQNNDWNQWNNQGQQNNDWNQWNNQNNWNQNNNQQNAWNGWDNNNNWNQW 487

Query:   130 ELNNIFVNKIKNNN-DAQSYKGINNKTIFLEENNDERYNQENEK 2
             + NN + N+ +NN  D  +    NN     ++NND  +NQ N +
Sbjct:   488 DQNNQWNNQQQNNTWDWNNQNNWNNN----QQNND--WNQWNNQ 525

 Score = 101 (35.6 bits), Expect = 0.051, P = 0.050
 Identities = 41/152 (26%), Positives = 72/152 (47%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N N +N+  +  D  N N  NN     Q +D    NN +N+   Q  QN   N +NN
Sbjct:   392 NNNNWNQNNQQQNNWDWNNQNNWNN--NQQQNNDWNQWNNQNNWNNNQQ-QNNDWNQWNN 448

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA--HEKELNNIF- 113
                 Q   ++ + ++  NN   +N  ++  +   ++NN   N+W  +   + ++ NN + 
Sbjct:   449 Q--GQQNNDWNQWNNQ-NNWNQNNNQQNAWNGWDNNNNW--NQWDQNNQWNNQQQNNTWD 503

Query:   112 ---VNKIKNNNDAQSYKGINNKTIFLEENND-ERYNQEN 8
                 N   NN     +   NN+    ++NND  ++N +N
Sbjct:   504 WNNQNNWNNNQQNNDWNQWNNQG--QQQNNDWNQWNNQN 540

 Score = 97 (34.1 bits), Expect = 0.16, P = 0.15
 Identities = 38/153 (24%), Positives = 67/153 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N+ +N +N N +++   + NQ NN     Q +D    NN +N+ +  + QN     +N  
Sbjct:   425 NQWNNQNNWNNNQQQNNDWNQWNN--QGQQNNDWNQWNNQNNWNQNNNQQN----AWNGW 478

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKI 101
               + N  ++++ +  +NN Q +NT         D NN   N W  +    + N       
Sbjct:   479 DNNNNWNQWDQNNQ-WNNQQQNNTW--------DWNNQ--NNWNNNQQNNDWNQWNNQGQ 527

Query:   100 KNNNDAQSYKGINN-KTIFLEENNDERYNQENEK 2
             + NND   +   NN +    + NN   +NQ N +
Sbjct:   528 QQNNDWNQWNNQNNNQNNGWDWNNQNNWNQNNNQ 561

 Score = 96 (33.8 bits), Expect = 0.21, P = 0.19
 Identities = 45/157 (28%), Positives = 74/157 (47%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQN----NNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             + +NN N N + +N       N N N    NN   + Q ++ +  NN +N+   Q  QN 
Sbjct:   460 NNQNNWNQNNNQQNAWNGWDNNNNWNQWDQNNQWNNQQQNNTWDWNNQNNWNNNQ--QNN 517

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
               N +NN    QN  ++ +    +NN Q++N      +   D NN   N W  + +++  
Sbjct:   518 DWNQWNNQGQQQNN-DWNQ----WNN-QNNNQ-----NNGWDWNNQ--NNWNQNNNQQ-- 562

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              N + N   NNN+   + G NN     ++NND  +NQ N +
Sbjct:   563 -NAW-NGWDNNNNWNQWGGQNNDWNNQQQNND--WNQWNNQ 599

 Score = 95 (33.4 bits), Expect = 0.28, P = 0.24
 Identities = 37/162 (22%), Positives = 76/162 (46%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  N + + +  ++  N  N N +N N +++   + NQ NN     Q +D    NN +N+
Sbjct:   409 NNQNNWNNNQQQNNDWNQWN-NQNNWNNNQQQNNDWNQWNN--QGQQNNDWNQWNNQNNW 465

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN--NVPIN 158
              +  + QN     +N    + N  ++++ +  +NN Q +NT       + ++N  N   N
Sbjct:   466 NQNNNQQN----AWNGWDNNNNWNQWDQNNQ-WNNQQQNNTWDWNNQNNWNNNQQNNDWN 520

Query:   157 EWPGDAHEKELN-NIFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
             +W     ++  + N + N+  N N+   +   NN+  + + NN +
Sbjct:   521 QWNNQGQQQNNDWNQWNNQNNNQNNGWDW---NNQNNWNQNNNQQ 562

 Score = 94 (33.1 bits), Expect = 0.36, P = 0.30
 Identities = 36/155 (23%), Positives = 71/155 (45%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-DNFGEGQDIQNIHHNVY 290
             +NN  +  +N      D  N  Q NN    +Q ++   +NN+ +N+G+    QN   N +
Sbjct:   251 QNNDWNQQNNNQQQNNDWNNWGQQNN--DWNQWNNQGQQNNDWNNWGQ----QNNDWNQW 304

Query:   289 NNTPTDQNK--KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNI 116
             NN    QN     + ++++ +N   +    ++    +    N   N+W     ++  NN 
Sbjct:   305 NNQGQQQNNDWNNWGQQNNDWNQWNNQGQQQNNDWNNWGQQNNDWNQWNNQGQQQ--NND 362

Query:   115 FVNKIKNNNDAQSYKGINN--KTIFLEENNDERYNQENEK 2
             + N  + NND   +   NN  +  +   +N+  +NQ N++
Sbjct:   363 WNNWGQQNNDWNQWNNQNNNQQNAWNGWDNNNNWNQNNQQ 402

 Score = 92 (32.4 bits), Expect = 0.63, P = 0.47
 Identities = 35/154 (22%), Positives = 59/154 (38%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN+N N +N      D    N  NN   + Q ++ + + NN         Q  + N +N 
Sbjct:   409 NNQN-NWNNNQQQNNDWNQWNNQNNWNNNQQQNNDWNQWNNQGQQNNDWNQWNNQNNWNQ 467

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM-DHNNVPINEWPGDAHEKELNNIFVN 107
                 QN     + ++ +N    +N   +    +  D NN   N W  +    + N     
Sbjct:   468 NNNQQNAWNGWDNNNNWNQWDQNNQWNNQQQNNTWDWNNQ--NNWNNNQQNNDWNQWNNQ 525

Query:   106 KIKNNNDAQSYKGINN-KTIFLEENNDERYNQENEK 2
               + NND   +   NN +    + NN   +NQ N +
Sbjct:   526 GQQQNNDWNQWNNQNNNQNNGWDWNNQNNWNQNNNQ 561

 Score = 85 (29.9 bits), Expect = 4.3, P = 0.99
 Identities = 38/151 (25%), Positives = 70/151 (46%), Frame = -2

Query:   454 NDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTP 278
             N N  N+N ++++  N  + NNN    DQ +   + N   N     + QN  +N   N  
Sbjct:   461 NQNNWNQNNNQQNAWNGWDNNNNWNQWDQNNQ--WNNQQQNNTWDWNNQNNWNNNQQNND 518

Query:   277 TDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIK 98
              +Q   + +++++ +N   + N  ++      D NN   N W  + +++   N + N   
Sbjct:   519 WNQWNNQGQQQNNDWNQWNNQNNNQN---NGWDWNNQ--NNWNQNNNQQ---NAW-NGWD 569

Query:    97 NNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             NNN+   + G NN     ++NND  +NQ N +
Sbjct:   570 NNNNWNQWGGQNNDWNNQQQNND--WNQWNNQ 599

 Score = 85 (29.9 bits), Expect = 4.3, P = 0.99
 Identities = 41/163 (25%), Positives = 72/163 (44%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-NFGEGQDIQNI--- 305
             + +NN N+N   +N       N  Q NN        + + +NNN  N   G D  N    
Sbjct:   428 NNQNNWNNN-QQQNNDWNQWNNQGQQNNDWNQWNNQNNWNQNNNQQNAWNGWDNNNNWNQ 486

Query:   304 --HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEK 131
                +N +NN   + N  ++  +++ +NN Q +N      ++    NN   N+W    + +
Sbjct:   487 WDQNNQWNNQQQN-NTWDWNNQNN-WNNNQQNNDWNQWNNQGQQQNN-DWNQWNNQNNNQ 543

Query:   130 ----ELNNIFVNKIKNNNDAQSYKGINNKTIFLE---ENNDERYNQEN 8
                 + NN   N  +NNN   ++ G +N   + +   +NND    Q+N
Sbjct:   544 NNGWDWNNQN-NWNQNNNQQNAWNGWDNNNNWNQWGGQNNDWNNQQQN 590


>gi|1762996 (U67259) RING-finger protein [Helicoverpa armigera
            nucleopolyhedrovirus]
            Length = 348

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.041, P = 0.040
 Identities = 41/146 (28%), Positives = 73/146 (50%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRN-DNISNKNVHKKDIQNINQNNNIVGSDQXDDI---FFKN 347
             +N   T VD +   S  NN N D+ ++ NV   D  ++N ++++  +D  +D+      N
Sbjct:   159 NNDIETTVDNDA--SVNNNTNVDDQNDDNVDDDDDDDVN-DDDVNDNDDVNDVNTNVNSN 215

Query:   346 NNDNFGEGQDIQNIHHNVYN-NTPTDQNKKEYEEESSGFN-NIQHDNTMKSPVDKHMDHN 173
             N  N     +  N+  NV N N   D N    +  +S  N N+QH  T+ S  D ++++N
Sbjct:   216 NQINNTTNDNDTNVDANVCNTNANVDTNANVDDVANSAANDNVQH--TVDS--DNNVNNN 271

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQS 77
                +++    +H+   +N   N  K++ND  S
Sbjct:   272 ---VSQ---TSHDNINSNQVTNNSKSDNDKNS 297

 Score = 94 (33.1 bits), Expect = 0.097, P = 0.092
 Identities = 32/147 (21%), Positives = 67/147 (45%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKK--DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             S +N+ +DN S+  V+ +  D+ N N N++   ++  DD    N +D     +D   ++ 
Sbjct:    97 SDRNSDSDN-SDSEVYDEIVDVNNSNNNDDNNSTNDNDDDNTSNCDDATIHNEDTAELNT 155

Query:   298 NVYNNT-PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN 122
             N  NN   T  +       ++  ++ Q+D+ +    D  ++ ++V  N+   D +    +
Sbjct:   156 NTVNNDIETTVDNDASVNNNTNVDD-QNDDNVDDDDDDDVNDDDVNDNDDVNDVNTNVNS 214

Query:   121 NIFVNKIKNNNDAQSYKGINNKTIFLEEN 35
             N  +N   N+ND      + N    ++ N
Sbjct:   215 NNQINNTTNDNDTNVDANVCNTNANVDTN 243

 Score = 92 (32.4 bits), Expect = 0.17, P = 0.16
 Identities = 39/165 (23%), Positives = 75/165 (45%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             NT      I++T +N  D   N N +  D     QN++ V  D  DD+    N+D+  + 
Sbjct:   154 NTNTVNNDIETTVDN--DASVNNNTNVDD-----QNDDNVDDDDDDDV----NDDDVNDN 202

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
              D+ +++ NV +N     N    + +++   N+ + N   + VD + + ++V  N    D
Sbjct:   203 DDVNDVNTNVNSNNQI--NNTTNDNDTNVDANVCNTN---ANVDTNANVDDVA-NSAAND 256

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
               +  +++   N + NN    S+  IN+  +    NN +  N +N
Sbjct:   257 NVQHTVDSD--NNVNNNVSQTSHDNINSNQV---TNNSKSDNDKN 296

 Score = 91 (32.0 bits), Expect = 0.22, P = 0.20
 Identities = 31/114 (27%), Positives = 47/114 (41%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N  V++   +   NN+ +N +N N    D    N N N+  +   DD+     NDN    
Sbjct:   202 NDDVNDVNTNVNSNNQINNTTNDNDTNVDANVCNTNANVDTNANVDDVANSAANDNVQHT 261

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
              D  N   NV NN    Q   +    +   NN + DN   S  D  + + ++PI
Sbjct:   262 VDSDN---NVNNNV--SQTSHDNINSNQVTNNSKSDNDKNSVDDDDISNLSLPI 310

 Score = 87 (30.6 bits), Expect = 0.69, P = 0.50
 Identities = 28/123 (22%), Positives = 54/123 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDI-----QNINQNNNIVGSDQXDDIFFK 350
             S   NT VD++  D+  ++ +D++++ +V+  D       N+N NN I  +   +D    
Sbjct:   171 SVNNNTNVDDQNDDNVDDDDDDDVNDDDVNDNDDVNDVNTNVNSNNQINNTTNDNDTNVD 230

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQ---HDNTMKSPVDKHMD 179
              N  N     D      +V N+   D  +   + +++  NN+    HDN   + V  +  
Sbjct:   231 ANVCNTNANVDTNANVDDVANSAANDNVQHTVDSDNNVNNNVSQTSHDNINSNQVTNNSK 290

Query:   178 HNN 170
              +N
Sbjct:   291 SDN 293

 Score = 84 (29.6 bits), Expect = 1.6, P = 0.79
 Identities = 34/155 (21%), Positives = 68/155 (43%), Frame = -2

Query:   475 DSTKNNRNDNISN---KNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             +ST +N +DN SN     +H +D   +N N  NN + +   +D    NNN N  +  D  
Sbjct:   127 NSTNDNDDDNTSNCDDATIHNEDTAELNTNTVNNDIETTVDNDASV-NNNTNVDDQND-D 184

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEK 131
             N+  +  ++   D +  + ++ +    N+  +N + +  + +    NV  N    +A+  
Sbjct:   185 NVDDDDDDDV-NDDDVNDNDDVNDVNTNVNSNNQINNTTNDN--DTNVDANVCNTNANVD 241

Query:   130 ELNNI--FVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
                N+    N   N+N   +    NN    + + + +  N
Sbjct:   242 TNANVDDVANSAANDNVQHTVDSDNNVNNNVSQTSHDNIN 281


>gnl|PID|e213552 (Z26318) royal jelly protein RJP57-1 [Apis mellifera]
            Length = 544

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.044, P = 0.043
 Identities = 35/116 (30%), Positives = 56/116 (48%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKD--IQNIN-QNNNIVGSDQXDDIFFKNN- 344
             N GN   D +  D+ +N  N N  N+N +K++   QN N QN+N    ++ +D     N 
Sbjct:   426 NAGNQNADNQNADN-QNANNQNADNQNANKQNGNRQNDNRQNDNKQNGNRQNDNKQNGNR 484

Query:   343 -NDNFGEG--QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
              NDN   G  Q+    + N  N    + NK+    ++   NN Q+DN      D  + H+
Sbjct:   485 QNDNKQNGNRQNGNKQNDNKQNGNRQNDNKRNGNRQNDNQNN-QNDNNRN---DNQVHHS 540

Query:   172 N 170
             +
Sbjct:   541 S 541

 Score = 85 (29.9 bits), Expect = 2.2, P = 0.89
 Identities = 28/100 (28%), Positives = 45/100 (45%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNR-NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             N  N   D +  +    NR NDN  N N    + QN N+ N   G+ Q D+   +N N  
Sbjct:   441 NANNQNADNQNANKQNGNRQNDNRQNDNKQNGNRQNDNKQN---GNRQNDNK--QNGNRQ 495

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
              G  Q+    + N  N+   + N++   + +   NN ++DN
Sbjct:   496 NGNKQNDNKQNGNRQNDNKRNGNRQNDNQNNQNDNN-RNDN 535

 Score = 82 (28.9 bits), Expect = 4.9, P = 0.99
 Identities = 34/114 (29%), Positives = 52/114 (45%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N GN   D +  D+ +N  N N  N+N +K   QN N+ N+   +D   +      NDN 
Sbjct:   426 NAGNQNADNQNADN-QNANNQNADNQNANK---QNGNRQNDNRQNDNKQN--GNRQNDNK 479

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
               G   QN   N  N    + NK+  + + +G  N Q+DN  K   ++  D+ N
Sbjct:   480 QNGNR-QN--DNKQNGNRQNGNKQN-DNKQNG--NRQNDN--KRNGNRQNDNQN 525


>gi|160385 (M63277) malaria antigen [Plasmodium falciparum]
           Length = 232

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.046, P = 0.045
 Identities = 32/113 (28%), Positives = 54/113 (47%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKN-VHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             D + I+ T  N+ND+ISN + V  KDI N  +N+N   S++ +    K   +++ E    
Sbjct:    11 DNDKIEDT--NKNDDISNNSEVTNKDIINGERNSN--DSEEKE----KEEKEDYNE---- 58

Query:   313 QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
                  N YNN  TD N     +++    N ++D  +    ++     N  INE+
Sbjct:    59 -----NTYNNMNTDNNTSNSNDDNEQIINNENDYILNKTNNEINKEINTSINEF 107

 Score = 91 (32.0 bits), Expect = 0.11, P = 0.10
 Identities = 25/103 (24%), Positives = 50/103 (48%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG-EGQDIQNIHHNVYNN 284
             N  DN   ++ +K D  +I+ N+ +   D  +    +N+ND+   E ++ ++ + N YNN
Sbjct:     8 NEGDNDKIEDTNKND--DISNNSEVTNKDIINGE--RNSNDSEEKEKEEKEDYNENTYNN 63

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
               TD N     +++    N ++D  +    ++     N  INE+
Sbjct:    64 MNTDNNTSNSNDDNEQIINNENDYILNKTNNEINKEINTSINEF 107

 Score = 88 (31.0 bits), Expect = 0.25, P = 0.22
 Identities = 28/107 (26%), Positives = 48/107 (44%), Frame = -2

Query:   397 NNNIVGSDQXDDIFFKNNNDNFGEGQDIQN--IHHNVYNNTPTDQNKKEYEEE--SSGFN 230
             NN ++     D I   N ND+     ++ N  I +   N+  +++ +KE +E+   + +N
Sbjct:     3 NNGMINEGDNDKIEDTNKNDDISNNSEVTNKDIINGERNSNDSEEKEKEEKEDYNENTYN 62

Query:   229 NIQHDN-TMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNND 86
             N+  DN T  S  D     NN   N++  +    E+N      I   ND
Sbjct:    63 NMNTDNNTSNSNDDNEQIINNE--NDYILNKTNNEINKEINTSINEFND 109


>pir||S34960 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Crithidia
            oncopelti mitochondrion (SGC6) >gi|12882 (X56015) NADH
            dehydrogenase subunit 5 [Crithidia oncopelti]
            Length = 590

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.049, P = 0.048
 Identities = 31/113 (27%), Positives = 54/113 (47%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFY--FINKY-II*F-LFMCISRPFIYRDI 172
             F+ L + FI+IFF  +   I+ F   C+   FY  + N + I  F +F+ IS  FIY   
Sbjct:   460 FLGLYMCFILIFFVIDFLYIFVFSSYCMFWSFYLYYFNFFDIASFTVFVMISLAFIYYGC 519

Query:   173 IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYIL-YVLSF 328
             ++ + F          +++I    F F  F      C  IY+++++  +V+ F
Sbjct:   520 VLFYFFNVDCIMLFWRIFLIICVTFMFGLFSCWYFACFFIYLLLFVWNFVIYF 572

 Score = 85 (29.9 bits), Expect = 2.4, P = 0.91
 Identities = 40/154 (25%), Positives = 73/154 (47%), Frame = +2

Query:    62 IYAFI*LCIIIIFY-FINKYII*FLFMC-ISRPFIYRD-IIMIHMFVDRTFHSIIMLYII 232
             I  F+ +CI  IF+  I  Y + F F+C + + F   D + ++  F     +  + LY+ 
Sbjct:   408 ILEFLFVCIFFIFFTVIYNYFLLF-FLCFVFKCFCLADCLFLLFDFECCLIYCFLGLYMC 466

Query:   233 EAT*FF---FIFFFILISRCII--IYIMMYILY-VLSFTKIVIIIFKKDIIXLI*SHNII 394
                 FF   F++ F+  S C+    Y+  +  + + SFT  V+I     +  +     + 
Sbjct:   467 FILIFFVIDFLYIFVFSSYCMFWSFYLYYFNFFDIASFTVFVMI----SLAFIYYGCVLF 522

Query:   395 ILVNILNI-LFMNIFIANVVISIIFG*IN-W----FLIYI 496
                N+  I LF  IF+  + ++ +FG  + W    F IY+
Sbjct:   523 YFFNVDCIMLFWRIFLI-ICVTFMFGLFSCWYFACFFIYL 561


>gi|499325 (Z26314) STARP antigen [Plasmodium falciparum]
           Length = 604

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.051, P = 0.049
 Identities = 48/161 (29%), Positives = 70/161 (43%), Frame = -2

Query:   490 DEEPIDSTKNNRNDN-ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             D   I +T +N N N IS  N     I   N   N + +D  +      +NDN     DI
Sbjct:   310 DNNNITTTTDNTNTNVISTDNSKTNVISTDNSKTNTISTDNDNADTILTDNDN---NTDI 366

Query:   313 QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
               +  N  NNT T     +  +  +  NN  + NT      K  D+NN  I   P + + 
Sbjct:   367 I-LTDN--NNTDTISTDNDNADTKATDNN-NNTNT------KATDNNNTKIIS-PDNNNT 415

Query:   133 KEL---NNIFVN-KIKNNNDAQSYKGINN--KTIFLEENNDERYNQEN 8
             K     NN   N K  +NN+ ++    NN  KTI  + NN +  + +N
Sbjct:   416 KTTSTDNNNNTNTKATDNNNTKTISTDNNNTKTISTDNNNTKTISTDN 463

 Score = 95 (33.4 bits), Expect = 0.16, P = 0.15
 Identities = 40/154 (25%), Positives = 67/154 (43%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNN-NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             ST N++ + IS  N +   I   N NN +I+ +D  +      +NDN  + +   N  +N
Sbjct:   337 STDNSKTNTISTDNDNADTILTDNDNNTDIILTDNNNTDTISTDNDN-ADTKATDN--NN 393

Query:   295 VYNNTPTDQNK-KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP-INEWPGDAHEKELN 122
               N   TD N  K    +++       DN   +   K  D+NN   I+    +      +
Sbjct:   394 NTNTKATDNNNTKIISPDNNNTKTTSTDNNNNTNT-KATDNNNTKTISTDNNNTKTISTD 452

Query:   121 NIFVNKIK-NNNDAQSYKGINNKTIFLE-ENNDERYNQ 14
             N     I  +NN+ ++    NN T  +  +NN+   NQ
Sbjct:   453 NNNTKTISTDNNNTKTISNDNNNTNTISTDNNNNNTNQ 490

 Score = 95 (33.4 bits), Expect = 0.16, P = 0.15
 Identities = 43/157 (27%), Positives = 71/157 (45%), Frame = -2

Query:   475 DSTKN-NRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF----GEGQDI 314
             +ST N N N N++ N +  KK   NIN   N+  S     +   NNN N         DI
Sbjct:   227 NSTDNSNTNTNLTDNTSTTKKLTDNINTTQNLTTSTNTTTVSTDNNNINTKPIDNNNTDI 286

Query:   313 QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQH--DNTMKSPVDKHMDHNNVPINEWPGDA 140
             ++  +  YN    + + K  + +++  NNI    DNT  + +       NV I+      
Sbjct:   287 KSTDN--YNTGTKETDNKNTDIKATDNNNITTTTDNTNTNVISTDNSKTNV-ISTDNSKT 343

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND-ERYNQENE 5
             +    +N   + I  +ND       NN  I L +NN+ +  + +N+
Sbjct:   344 NTISTDNDNADTILTDND-------NNTDIILTDNNNTDTISTDND 382

 Score = 94 (33.1 bits), Expect = 0.21, P = 0.19
 Identities = 40/154 (25%), Positives = 60/154 (38%), Frame = -2

Query:   469 TKNNRNDNIS--NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             T NN  D IS  N N   K   N N N N   +D  +      +N+N    +     ++N
Sbjct:   369 TDNNNTDTISTDNDNADTKATDN-NNNTNTKATDNNNTKIISPDNNNT---KTTSTDNNN 424

Query:   295 VYNNTPTDQNK-KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
               N   TD N  K    +++    I  DN     +    D+NN        D      N 
Sbjct:   425 NTNTKATDNNNTKTISTDNNNTKTISTDNNNTKTIST--DNNNTKTIS--ND--NNNTNT 478

Query:   118 IFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             I  +   NNN+   Y   NN   + E  +D+  N+++
Sbjct:   479 ISTDN--NNNNTNQYVFANN---YNETTSDDELNKDS 510

 Score = 94 (33.1 bits), Expect = 0.21, P = 0.19
 Identities = 36/157 (22%), Positives = 60/157 (38%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIV--GSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ST N++ + IS  N     I   N N + +   +D   DI   +NN+      D  N   
Sbjct:   327 STDNSKTNVISTDNSKTNTISTDNDNADTILTDNDNNTDIILTDNNNTDTISTDNDNADT 386

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
                +N   + N K  +  ++   +  ++NT  +  D + + N    +         + NN
Sbjct:   387 KATDNN-NNTNTKATDNNNTKIISPDNNNTKTTSTDNNNNTNTKATDNNNTKTISTDNNN 445

Query:   118 IFVNKIKNNNDAQ-SYKGINNKTIFLEENNDERYNQEN 8
                    NNN    S    N KTI  + NN    + +N
Sbjct:   446 TKTISTDNNNTKTISTDNNNTKTISNDNNNTNTISTDN 483

 Score = 92 (32.4 bits), Expect = 0.37, P = 0.31
 Identities = 37/164 (22%), Positives = 66/164 (40%), Frame = -2

Query:   490 DEEPIDSTKNNRNDN-ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             D   I +T +N N N IS  N     I   N   N + +D  +      +NDN     DI
Sbjct:   310 DNNNITTTTDNTNTNVISTDNSKTNVISTDNSKTNTISTDNDNADTILTDNDN---NTDI 366

Query:   313 QNIHHNVYNNTPTDQNKKEYE--EESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA 140
                 +N  +   TD +  + +  + ++  N    DN     +    ++      +   + 
Sbjct:   367 ILTDNNNTDTISTDNDNADTKATDNNNNTNTKATDNNNTKIISPDNNNTKTTSTDNNNNT 426

Query:   139 HEKELNNIFVNKIK-NNNDAQSYKGINN--KTIFLEENNDERYNQEN 8
             + K  +N     I  +NN+ ++    NN  KTI  + NN +  + +N
Sbjct:   427 NTKATDNNNTKTISTDNNNTKTISTDNNNTKTISTDNNNTKTISNDN 473

 Score = 92 (32.4 bits), Expect = 0.37, P = 0.31
 Identities = 44/168 (26%), Positives = 67/168 (39%), Frame = -2

Query:   511 NKGNTYVDEEPID--STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             N G    D +  D  +T NN N   +  N +   I   N   N++ +D         +ND
Sbjct:   293 NTGTKETDNKNTDIKATDNN-NITTTTDNTNTNVISTDNSKTNVISTDNSKTNTISTDND 351

Query:   337 N----FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             N      +  +  +I     NNT T     +  +  +  NN  + NT      K  D+NN
Sbjct:   352 NADTILTDNDNNTDIILTDNNNTDTISTDNDNADTKATDNN-NNTNT------KATDNNN 404

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN--KTIFLEENNDERYNQEN 8
               I   P +      NN       NNN+  +    NN  KTI  + NN +  + +N
Sbjct:   405 TKIIS-PDN------NNTKTTSTDNNNNTNTKATDNNNTKTISTDNNNTKTISTDN 453

 Score = 89 (31.3 bits), Expect = 0.84, P = 0.57
 Identities = 29/83 (34%), Positives = 37/83 (44%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             ST NN    IS  N + K I N N N N + +D        NNN N       Q +  N 
Sbjct:   450 STDNNNTKTISTDNNNTKTISNDNNNTNTISTDN------NNNNTN-------QYVFANN 496

Query:   292 YNNTPTDQ--NKK--EYEEESSGFNNI 224
             YN T +D   NK   +Y EE     ++
Sbjct:   497 YNETTSDDELNKDSCDYSEEKENIKSM 523

 Score = 84 (29.6 bits), Expect = 3.3, P = 0.96
 Identities = 42/174 (24%), Positives = 66/174 (37%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKN-NRNDNIS-NKNVHKKDIQNINQNNNIVGSDQXD---DIFFK 350
             +   NT  +    +   N N N N + N +  KK  +N+  N  + G++           
Sbjct:   159 TGNNNTTTNTSTTEHNNNINTNTNSTENTSATKKVTENVITNQILTGNNNTTTNTSTTEH 218

Query:   349 NNNDNFGEGQ-DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             NNN N      D  N + N+ +NT T   KK     +   N  Q+  T  +      D+N
Sbjct:   219 NNNINTNTNSTDNSNTNTNLTDNTST--TKKL----TDNINTTQNLTTSTNTTTVSTDNN 272

Query:   172 NV---PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             N+   PI+    D    +  N    +  N N        NN T   +  N    + +N K
Sbjct:   273 NINTKPIDNNNTDIKSTDNYNTGTKETDNKNTDIKATDNNNITTTTDNTNTNVISTDNSK 332

 Score = 81 (28.5 bits), Expect = 7.4, P = 1.0
 Identities = 34/152 (22%), Positives = 62/152 (40%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +T +  N+NI+ K +   +    + +N   G+ + D+   KN +    +  +I     N 
Sbjct:   265 TTVSTDNNNINTKPIDNNNTDIKSTDNYNTGTKETDN---KNTDIKATDNNNITTTTDNT 321

Query:   292 YNNT-PTDQNKKEY-EEESSGFNNIQHDNTMKSPVDKHMDHNN--VPINEWPGDAHEKEL 125
               N   TD +K      ++S  N I  DN     +    D+N   +  +    D    + 
Sbjct:   322 NTNVISTDNSKTNVISTDNSKTNTISTDNDNADTILTDNDNNTDIILTDNNNTDTISTDN 381

Query:   124 NNIFVNKIKNNNDAQSYKGINNKT-IFLEENNDER 23
             +N       NNN+  +    NN T I   +NN+ +
Sbjct:   382 DNADTKATDNNNNTNTKATDNNNTKIISPDNNNTK 416

 Score = 80 (28.2 bits), Expect = 9.6, P = 1.0
 Identities = 34/158 (21%), Positives = 64/158 (40%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +T +  N+NI+ K +   +    + +N   G+ + D+   KN +    +  +I     N 
Sbjct:   265 TTVSTDNNNINTKPIDNNNTDIKSTDNYNTGTKETDN---KNTDIKATDNNNITTTTDNT 321

Query:   292 YNNT-PTDQNKKEY-EEESSGFNNIQHDNTMKSPVDKHMDHNN--VPINEWPGDAHEKEL 125
               N   TD +K      ++S  N I  DN     +    D+N   +  +    D    + 
Sbjct:   322 NTNVISTDNSKTNVISTDNSKTNTISTDNDNADTILTDNDNNTDIILTDNNNTDTISTDN 381

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFL--EENNDERYNQEN 8
             +N       NNN+  +    NN T  +  + NN +  + +N
Sbjct:   382 DNADTKATDNNNNTNTKATDNNNTKIISPDNNNTKTTSTDN 422


>pir||S23686 hypothetical protein 3 - Plasmodium falciparum
            Length = 100

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.056, P = 0.054
 Identities = 23/77 (29%), Positives = 34/77 (44%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +   N++V E+  D   NN N+N +N  V   +I N  + +N V       I  KN NDN
Sbjct:    31 AQNNNSFV-EDKADIHNNNNNNNNNNTKVLTNNITNEQKESNYV-------ILNKNKNDN 82

Query:   334 FGEGQDIQNIHHNVYNN 284
                  +  +I  N   N
Sbjct:    83 INNTHEENHITTNCLTN 99

 Score = 73 (25.7 bits), Expect = 0.12, P = 0.12
 Identities = 23/92 (25%), Positives = 39/92 (42%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             E+P  + K   +    +K+V   +  N+ QNNN    D+ D I   NNN+N    + + N
Sbjct:     4 EDPFRNRKT-LSSRAPSKHVDDYEASNVAQNNNSFVEDKAD-IHNNNNNNNNNNTKVLTN 61

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
                N+ N           + ++   NN   +N
Sbjct:    62 ---NITNEQKESNYVILNKNKNDNINNTHEEN 90

 Score = 69 (24.3 bits), Expect = 2.1, P = 0.88
 Identities = 27/101 (26%), Positives = 44/101 (43%), Frame = -2

Query:   475 DSTKNNR--NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             D  +N +  +    +K+V   +  N+ QNNN    D+ D I   NNN+N        N +
Sbjct:     5 DPFRNRKTLSSRAPSKHVDDYEASNVAQNNNSFVEDKAD-IHNNNNNNN--------NNN 55

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
               V  N  T++ K   E      N  ++DN   +  + H+  N
Sbjct:    56 TKVLTNNITNEQK---ESNYVILNKNKNDNINNTHEENHITTN 95


>gi|340613 (L07545) A 'c' was inserted after nt 369 (=nt 10459 in genomic
           sequence (M10126)) to correct -1 frameshift probably due to gel
           compression [Leishmania tarentolae]
           Length = 355

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.056, P = 0.054
 Identities = 39/147 (26%), Positives = 72/147 (48%), Frame = +2

Query:    26 FIIIFFQKNGFVIYAFI*---LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVD 196
             FI+ +F  + F++Y F+    +CI  IF F+  +   FL +  S  F+   I+   +F  
Sbjct:    29 FILWWFDLD-FILYDFVFDFVVCITFIFVFVLGF---FLRIFFSFVFVLLFIVFFGLFSL 84

Query:   197 RTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI 376
                ++   +Y I    + FI +F   S  I +Y + +  Y+L F  I  I F   +I   
Sbjct:    85 SFLYTGYFIYYIYIL-YNFICYFFCFS--IALYYIEFFTYLLCFIFIDFISFSNHLI--- 138

Query:   377 *SHNIIILVNILNILFMN-IF-IANVVISIIF 466
                +   ++N+ N++F + +F +   +I  IF
Sbjct:   139 ---SYFGIINMFNVIFCSYLFCLFYFIICFIF 167

 Score = 95 (33.4 bits), Expect = 0.076, P = 0.073
 Identities = 45/182 (24%), Positives = 79/182 (43%), Frame = +2

Query:     5 FIFLIIPFIIIF---FQKNGFVIYAFI*LCIIIIFYFINKYII*FL-FMCISRPFIYRDI 172
             F+ L I F  +F   F   G+ IY    L   I ++F     + ++ F      FI+ D 
Sbjct:    71 FVLLFIVFFGLFSLSFLYTGYFIYYIYILYNFICYFFCFSIALYYIEFFTYLLCFIFIDF 130

Query:   173 IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFIL-ISRCIIIYI---MMYILY-VLSFTKI 337
             I     +   F  I M  +I  +  F +F+FI+    C I ++   +  I+Y  L F   
Sbjct:   131 ISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCFIFFVIRCLFVIIYDFLFFNFD 190

Query:   338 VIIIFKK-DIIXLI*SHNIII----LVNILNILFMNIFIANVVISIIFG*INWFLIYISI 502
             + I F   DII +     ++I    + + +   F  IF+ N V  ++F  +  F  ++ +
Sbjct:   191 IYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFL 250

Query:   503 SF 508
             S+
Sbjct:   251 SY 252

 Score = 86 (30.3 bits), Expect = 0.93, P = 0.60
 Identities = 27/125 (21%), Positives = 55/125 (44%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISR-PFIYRDIIM 178
             +  FL+I F  IF    GF  + F+   + ++ +F+      FLF+      F+      
Sbjct:   205 YICFLLIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFW 264

Query:   179 IHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKK 358
             +++   R+   ++   +I     +F  FFI +   +I++I+ +  + L     + I F  
Sbjct:   265 LYIIYSRSCFILLQSVVIFFKFLYFDVFFIFVF-LLILFIICFFGFFLKDFLFLNIFFDM 323

Query:   359 DIIXLI 376
               + LI
Sbjct:   324 FSVLLI 329

 Score = 85 (29.9 bits), Expect = 1.2, P = 0.70
 Identities = 46/170 (27%), Positives = 76/170 (44%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKN-GFVIYAFI*LCIIIIFYF--INKYII*FL--FMCISRPFIYR 166
             FF F I  + I FF     F+   FI     +I YF  IN + + F     C+     Y 
Sbjct:   106 FFCFSIALYYIEFFTYLLCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCL----FYF 161

Query:   167 DIIMIHMFVDRTFHSIIMLYIIEAT*FFFIF-FFILISRCIIIYIMMYILYVLSFTKIVI 343
              I  I  F+   F  I  L++I     FF F  +I    C IIYI  YI ++L +   + 
Sbjct:   162 IICFIFCFI---FFVIRCLFVIIYDFLFFNFDIYISFLMCDIIYID-YICFLLIYFGFIF 217

Query:   344 IIFKKDIIXL-I*SHNIIILVNILNILFMNIFIANVVISIIFG*INW-FLIYISISFI 511
                      + + ++  ++L  +L + F  +F++  + + +     W ++IY    FI
Sbjct:   218 SFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFI 275

 Score = 84 (29.6 bits), Expect = 1.6, P = 0.80
 Identities = 38/168 (22%), Positives = 76/168 (45%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFY---FINKYII*FLFMCISRPFIYRDII 175
             ++F +  FII F     F    F+  C+ +I Y   F N  I     MC     IY D I
Sbjct:   154 YLFCLFYFIICFI----FCFIFFVIRCLFVIIYDFLFFNFDIYISFLMC---DIIYIDYI 206

Query:   176 ---MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYIL-YVLSFTKIVI 343
                +I+     +F +    +I      F + FF+L      +++   +  +++ +   + 
Sbjct:   207 CFLLIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLY 266

Query:   344 IIFKKDIIXLI*SHNIIILVNIL--NILFMNIFIANVVISIIFG*INWFLIYISISF 508
             II+ +    L+   +++I    L  ++ F+ +F+  + I   FG      ++++I F
Sbjct:   267 IIYSRSCFILL--QSVVIFFKFLYFDVFFIFVFLLILFIICFFGFFLKDFLFLNIFF 321

 Score = 81 (28.5 bits), Expect = 3.7, P = 0.97
 Identities = 27/128 (21%), Positives = 55/128 (42%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISR-PFIYRDIIM 178
             +  FL+I F  IF    GF  + F+   + ++ +F+      FLF+      F+      
Sbjct:   205 YICFLLIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFW 264

Query:   179 IHMFVDRT----FHSIIMLYIIEAT*FFFIFFFILISR--CIIIYIMMYILYVLSFTKIV 340
             +++   R+      S+++ +       FFIF F+LI    C   + +   L++  F  + 
Sbjct:   265 LYIIYSRSCFILLQSVVIFFKFLYFDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMF 324

Query:   341 IIIFKKDI 364
              ++   D+
Sbjct:   325 SVLLIYDV 332


>gi|1142984 (U28773) odorant receptor [Mus musculus] >prf||2207403G odorant
            receptor [Mus musculus]
            Length = 112

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.058, P = 0.057
 Identities = 24/67 (35%), Positives = 41/67 (61%), Frame = +2

Query:   278 RCIIIYIMMYILYVLSFTKIVIIIFKKDIIX--LI*SHNIIILVNILNILFMNIFIANVV 451
             +C+ + + +YIL ++  +  V  IF+ D     LI +H    L++ILN+   NIF+ ++V
Sbjct:    13 KCLSLVLGVYILGIVCASAHVGCIFRIDFCKSDLI-NHYFCDLISILNLSCSNIFVNDLV 71

Query:   452 ISIIFG*IN 478
             I +IF  IN
Sbjct:    72 I-LIFSLIN 79


>gi|453517 (L28677) ORF3 [Tetrahymena pyriformis]
           Length = 98

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.073, P = 0.071
 Identities = 27/98 (27%), Positives = 54/98 (55%), Frame = +2

Query:   203 FHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI*S 382
             +H +I +  +    F+F FF ILI   +I+Y ++ +  V++   I +   K +   L   
Sbjct:     3 YHFLIFINFLFLLIFYF-FFEILIKFHMIVYYLLLLYVVINIMMISLNNNKNNKFNL--K 59

Query:   383 HNIIILVNILNILF---MNIFIANVVISIIFG*INWFLIYI 496
             +NI +++  + I +   MNI   ++V+S +F  +N  ++YI
Sbjct:    60 YNIFMMLFFMFIFWNMKMNIINTDLVMSNMFYYMN--IMYI 98


>pir||S47042 protein kinase (EC 2.7.1.37) cdc2-related 1 - Plasmodium
            falciparum
            Length = 670

  Minus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.078, P = 0.075
 Identities = 42/155 (27%), Positives = 70/155 (45%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             +  K NR D   + + +  +    + +    G  + +D++      + G+ +  +  H+N
Sbjct:   119 EEEKYNRYDERRDSSYYTSNYSE-DSSKREGGKKEKEDLYISRKEFS-GKKKSHKGEHNN 176

Query:   295 VYNNTPTDQN-KKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNNVPINEWPGDAHEKELN 122
               NN  TDQ+ K  Y  +    NN   D    +  + H D HNN   N    D H    N
Sbjct:   177 --NNHHTDQHIKNNYHTDQHIKNNYHTDQHNNN--NHHTDQHNN---NNHHTDQHNN--N 227

Query:   121 NIFVNKIKNNNDA--QSYKGINNK-TIFLEENN-DERYNQE 11
             N + ++  NNN    Q    I+++  IF E+N  D R N+E
Sbjct:   228 NHYTDQHNNNNHHTDQHNNTISDQINIFPEKNKRDNRINEE 268

 Score = 98 (34.5 bits), Expect = 0.078, P = 0.075
 Identities = 41/162 (25%), Positives = 69/162 (42%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNF 332
             K N Y +        +N +++ S +   KK+ +++        G  +      ++NN+N 
Sbjct:   122 KYNRYDERRDSSYYTSNYSEDSSKREGGKKEKEDLYISRKEFSGKKKSHK--GEHNNNNH 179

Query:   331 GEGQDIQNIHH---NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNNVP 164
                Q I+N +H   ++ NN  TDQ+       +   NN  H     +  + + D HNN  
Sbjct:   180 HTDQHIKNNYHTDQHIKNNYHTDQHNNN-NHHTDQHNNNNHHTDQHNNNNHYTDQHNN-- 236

Query:   163 INEWPGDAHEKELN---NIFVNKIKNNNDAQSYK-GINNKTIFLEENN 32
              N    D H   ++   NIF  K K +N     K  I    I+ +E N
Sbjct:   237 -NNHHTDQHNNTISDQINIFPEKNKRDNRINEEKYTIKEHLIYEDEQN 283

 Score = 93 (32.7 bits), Expect = 0.31, P = 0.27
 Identities = 40/149 (26%), Positives = 78/149 (52%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG 329
             K N + D+      KNN + +  N N H  D  N N N++   +DQ       NNN+++ 
Sbjct:   186 KNNYHTDQH----IKNNYHTDQHNNNNHHTDQHN-NNNHH---TDQH------NNNNHYT 231

Query:   328 EGQDIQNIHHNVYNNTPTDQ-------NKKEY---EEESSGFNNIQHDNTMKSPVDKHMD 179
             +  +  N H + +NNT +DQ       NK++    EE+ +   ++ +++      + + D
Sbjct:   232 DQHNNNNHHTDQHNNTISDQINIFPEKNKRDNRINEEKYTIKEHLIYEDEQNISYESNKD 291

Query:   178 HN---NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGIN 62
              +   N  +NE+  D  + +++ I +N  +N    ++YK +N
Sbjct:   292 SSSEENTILNEYSSDEEKNKIDCI-LNGCRN---VKNYKKLN 329

 Score = 89 (31.3 bits), Expect = 0.95, P = 0.61
 Identities = 48/168 (28%), Positives = 73/168 (43%), Frame = -2

Query:   490 DEEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             D    +  K  + D  IS K    K   +  ++NN   ++   D   KNN   +   Q I
Sbjct:   142 DSSKREGGKKEKEDLYISRKEFSGKKKSHKGEHNN---NNHHTDQHIKNN---YHTDQHI 195

Query:   313 QNIHHNVY---NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNNV---PINE 155
             +N +H      NN  TDQ+       +   NN  H     +  + H D HNN     IN 
Sbjct:   196 KNNYHTDQHNNNNHHTDQHNNN-NHHTDQHNNNNHYTDQHNNNNHHTDQHNNTISDQINI 254

Query:   154 WPGDAHEKELNNIFVNK--IKNN---NDAQSYKGINNKTIFLEENND-ERYNQENEK 2
             +P + ++++ N I   K  IK +    D Q+    +NK    EEN     Y+ + EK
Sbjct:   255 FP-EKNKRD-NRINEEKYTIKEHLIYEDEQNISYESNKDSSSEENTILNEYSSDEEK 309

 Score = 87 (30.6 bits), Expect = 1.7, P = 0.81
 Identities = 39/165 (23%), Positives = 70/165 (42%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHK-KDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             K + Y+  +     K +     +N N H  + I+N    +  + ++   D   ++NN+N 
Sbjct:   153 KEDLYISRKEFSGKKKSHKGEHNNNNHHTDQHIKNNYHTDQHIKNNYHTD---QHNNNNH 209

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI--QHDNTMKSPVDKHMDHNNVP-- 164
                Q   N HH   +N     N   Y ++ +  N+   QH+NT+   ++   + N     
Sbjct:   210 HTDQHNNNNHHTDQHN-----NNNHYTDQHNNNNHHTDQHNNTISDQINIFPEKNKRDNR 264

Query:   163 INEWPGDAHEKELNNIFVN-KIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
             INE      E  +     N   ++N D+ S       TI  E ++DE  N+
Sbjct:   265 INEEKYTIKEHLIYEDEQNISYESNKDSSS----EENTILNEYSSDEEKNK 311

 Score = 82 (28.9 bits), Expect = 6.3, P = 1.0
 Identities = 32/109 (29%), Positives = 46/109 (42%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNIN-----QNNNIVGSDQXDDIFFKN 347
             N  N + D+       NN + +  N N H  D  N N     Q+NN + SDQ +    KN
Sbjct:   205 NNNNHHTDQH----NNNNHHTDQHNNNNHYTDQHNNNNHHTDQHNNTI-SDQINIFPEKN 259

Query:   346 NNDNFGEGQDIQNIHHNVYN---NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVD 191
               DN    +      H +Y    N   + NK    EE++  N    D   K+ +D
Sbjct:   260 KRDNRINEEKYTIKEHLIYEDEQNISYESNKDSSSEENTILNEYSSDEE-KNKID 313


>sp|P34250|YKK5_YEAST HYPOTHETICAL 125.6 KD PROTEIN IN AAT1-GFA1 INTERGENIC
            REGION >pir||S37932 hypothetical protein YKL105c - yeast
            (Saccharomyces cerevisiae) >gi|431211 (X71133) glutamic rich
            protein [Saccharomyces cerevisiae] >gi|486177 (Z28105) ORF YKL105c
            [Saccharomyces cerevisiae]
            Length = 1132

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.082, P = 0.079
 Identities = 38/143 (26%), Positives = 67/143 (46%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             D EP  S K      I N  + + +  ++   NN   +D+ DD    N+ND+  +  D  
Sbjct:   557 DNEPESSEKFPSTSGIENVKL-EDETGSVMDKNNGPNNDKDDDDDKDNDNDDDDDKDDDV 615

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN---TMKSPVDKHMDHNNVPINEWPGD- 143
             N   +   N   D+N  + +++    ++  HD+    M+ PV    D ++VP  + P + 
Sbjct:   616 N-DDDKDENVDDDENVDDDDDDDDDDDDEYHDSYDVIMRDPVQIEQDISDVPSLKHPSEY 674

Query:   142 AHEKELNNIFVNKIKNNNDAQ-SYKGIN 62
             + E E N     K +N+ +A+ S  G N
Sbjct:   675 STETEDNK---KKEQNSENAEVSQSGTN 699


>gi|552199 (M63269) malaria antigen [Plasmodium falciparum]
           Length = 138

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.082, P = 0.079
 Identities = 27/73 (36%), Positives = 43/73 (58%), Frame = -2

Query:   514 SNKGN--TYVDEEPI--DSTKNNRNDNISN-KNVHKKDIQNINQNNNIVGSDQXDDIFFK 350
             +NK N  T+ + E I  D++K+ +NDN  + KN + KDI+N   NN  + +D   DI   
Sbjct:    64 NNKQNNVTHKNNEDIKNDNSKDIKNDNSKDIKNDNSKDIKN--DNNEDIKNDNSKDIKND 121

Query:   349 NNNDNFGEG-QDIQN 308
             N+ D   +  +DI+N
Sbjct:   122 NSKDIKNDNSKDIKN 136

 Score = 85 (29.9 bits), Expect = 0.11, P = 0.11
 Identities = 27/85 (31%), Positives = 52/85 (61%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH-NVY 290
             KNN+ +N+++KN   +DI+N N  +  + +D   DI  KN+N      +DI+N ++ ++ 
Sbjct:    63 KNNKQNNVTHKN--NEDIKNDNSKD--IKNDNSKDI--KNDN-----SKDIKNDNNEDIK 111

Query:   289 NNTPTD---QNKKEYEEESSGFNNIQHDN 212
             N+   D    N K+ + ++S   +I++DN
Sbjct:   112 NDNSKDIKNDNSKDIKNDNS--KDIKNDN 138

 Score = 83 (29.2 bits), Expect = 0.22, P = 0.20
 Identities = 33/133 (24%), Positives = 62/133 (46%), Frame = -2

Query:   424 KKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ--DIQNIHHNVYNNTP-TDQNKKEY 254
             KK++ NI + N     ++ D    K++N+N  + Q  D +N + N       T++    +
Sbjct:     1 KKNMNNIKEGNVNTLYEKKDKEKKKDSNENRKKKQKEDKKNPNDNKLKKIEYTNKITHFF 60

Query:   253 EEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSY 74
             + +++  NN+ H N      D   D  N    +   D + K++ N     IKN+N ++  
Sbjct:    61 KAKNNKQNNVTHKNNEDIKNDNSKDIKNDNSKDIKND-NSKDIKNDNNEDIKNDN-SKDI 118

Query:    73 KGINNKTIFLEENND 29
             K  N+K I  + + D
Sbjct:   119 KNDNSKDIKNDNSKD 133

 Score = 72 (25.3 bits), Expect = 6.5, P = 1.0
 Identities = 31/120 (25%), Positives = 50/120 (41%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIF-FKNNND 338
             +GN     E  D  K  ++ N + K   K+D +N N N    I  +++    F  KNN  
Sbjct:     9 EGNVNTLYEKKDKEKK-KDSNENRKKKQKEDKKNPNDNKLKKIEYTNKITHFFKAKNNKQ 67

Query:   337 N---FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNN--IQHDNTMKSPVDKHMDHN 173
             N       +DI+N +     N  +   K +  ++    NN  I++DN+     D   D  
Sbjct:    68 NNVTHKNNEDIKNDNSKDIKNDNSKDIKNDNSKDIKNDNNEDIKNDNSKDIKNDNSKDIK 127

Query:   172 N 170
             N
Sbjct:   128 N 128


>pir||S69691 hypothetical protein YDR409w - yeast (Saccharomyces cerevisiae)
            >gi|927340 (U32274) Ydr409wp; CAI: 0.12 [Saccharomyces cerevisiae]
            Length = 904

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.083, P = 0.080
 Identities = 31/117 (26%), Positives = 50/117 (42%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  N +V     DS +++ NDN +N ++   D  N N NNN   ++  +D    NNN   
Sbjct:   493 NGNNPHVTNNHDDSNRHS-NDN-NNNSIKNNDSHNKNNNNNNNNNNNNND----NNNSIE 546

Query:   331 GEGQDIQNIH-HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
                 +  N H H   +NTP+  + K    ++   ++   D  M      H+   N  I
Sbjct:   547 NNDSNSNNKHDHGSRSNTPSHNHTKNLMNDNDDDDD---DRLMAEITSNHLKSTNTDI 601

 Score = 98 (34.5 bits), Expect = 0.11, P = 0.11
 Identities = 33/114 (28%), Positives = 53/114 (46%), Frame = -2

Query:   403 NQNNNIVGSDQXDDIFFKN-NNDNFGEGQDI--QNIHHNVYNNTPTDQNKKEYEEESSGF 233
             N NN  V ++  D     N NN+N  +  D   +N ++N  NN   + N    E   S  
Sbjct:   493 NGNNPHVTNNHDDSNRHSNDNNNNSIKNNDSHNKNNNNNNNNNNNNNDNNNSIENNDSNS 552

Query:   232 NNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNN-DAQSYKG 68
             NN +HD+  +S    H +H    +N+   D  ++ +  I  N +K+ N D  + KG
Sbjct:   553 NN-KHDHGSRSNTPSH-NHTKNLMNDNDDDDDDRLMAEITSNHLKSTNTDILTEKG 606

 Score = 95 (33.4 bits), Expect = 0.26, P = 0.23
 Identities = 31/124 (25%), Positives = 54/124 (43%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             D   N  N +++N +       N N NN+I  +D  +    KNNN+N     +  + +++
Sbjct:   489 DDEPNGNNPHVTNNHDDSNRHSNDNNNNSIKNNDSHN----KNNNNNNNNNNNNNDNNNS 544

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN-N 119
             + NN     NK ++   S   N   H++T     D   D ++  + E   + H K  N +
Sbjct:   545 IENNDSNSNNKHDHGSRS---NTPSHNHTKNLMNDNDDDDDDRLMAEITSN-HLKSTNTD 600

Query:   118 IFVNK 104
             I   K
Sbjct:   601 ILTEK 605

 Score = 89 (31.3 bits), Expect = 1.4, P = 0.74
 Identities = 41/150 (27%), Positives = 69/150 (46%), Frame = -2

Query:   454 NDNISN--KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH--NVYN 287
             +D + N  KNV + ++ +  +   I+  D   D    + + +  +G  + + HH  + + 
Sbjct:   419 DDILQNCQKNVEQVELTSDGKWTAILEDDDDSDSDSNDGSRSPEKGTSVSD-HHCSSSHP 477

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM-DHNNVPINEWPGDAHEKELNNIFV 110
             + P   N    ++E +G NN  H        ++H  D+NN  I     D+H K  NN   
Sbjct:   478 SEPIIINLDSDDDEPNG-NN-PHVTNNHDDSNRHSNDNNNNSIKN--NDSHNKNNNNNNN 533

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             N   NNND       NN +I   ENND   N +++
Sbjct:   534 NN-NNNND-------NNNSI---ENNDSNSNNKHD 557


>gi|575365 (X80759) cdc2-related protein kinase 1 [Plasmodium falciparum]
           Length = 719

  Minus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.085, P = 0.082
 Identities = 42/155 (27%), Positives = 70/155 (45%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             +  K NR D   + + +  +    + +    G  + +D++      + G+ +  +  H+N
Sbjct:   168 EEEKYNRYDERRDSSYYTSNYSE-DSSKREGGKKEKEDLYISRKEFS-GKKKSHKGEHNN 225

Query:   295 VYNNTPTDQN-KKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNNVPINEWPGDAHEKELN 122
               NN  TDQ+ K  Y  +    NN   D    +  + H D HNN   N    D H    N
Sbjct:   226 --NNHHTDQHIKNNYHTDQHIKNNYHTDQHNNN--NHHTDQHNN---NNHHTDQHNN--N 276

Query:   121 NIFVNKIKNNNDA--QSYKGINNK-TIFLEENN-DERYNQE 11
             N + ++  NNN    Q    I+++  IF E+N  D R N+E
Sbjct:   277 NHYTDQHNNNNHHTDQHNNTISDQINIFPEKNKRDNRINEE 317

 Score = 98 (34.5 bits), Expect = 0.085, P = 0.082
 Identities = 41/162 (25%), Positives = 69/162 (42%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNF 332
             K N Y +        +N +++ S +   KK+ +++        G  +      ++NN+N 
Sbjct:   171 KYNRYDERRDSSYYTSNYSEDSSKREGGKKEKEDLYISRKEFSGKKKSHK--GEHNNNNH 228

Query:   331 GEGQDIQNIHH---NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNNVP 164
                Q I+N +H   ++ NN  TDQ+       +   NN  H     +  + + D HNN  
Sbjct:   229 HTDQHIKNNYHTDQHIKNNYHTDQHNNN-NHHTDQHNNNNHHTDQHNNNNHYTDQHNN-- 285

Query:   163 INEWPGDAHEKELN---NIFVNKIKNNNDAQSYK-GINNKTIFLEENN 32
              N    D H   ++   NIF  K K +N     K  I    I+ +E N
Sbjct:   286 -NNHHTDQHNNTISDQINIFPEKNKRDNRINEEKYTIKEHLIYEDEQN 332

 Score = 93 (32.7 bits), Expect = 0.34, P = 0.29
 Identities = 40/149 (26%), Positives = 78/149 (52%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG 329
             K N + D+      KNN + +  N N H  D  N N N++   +DQ       NNN+++ 
Sbjct:   235 KNNYHTDQH----IKNNYHTDQHNNNNHHTDQHN-NNNHH---TDQH------NNNNHYT 280

Query:   328 EGQDIQNIHHNVYNNTPTDQ-------NKKEY---EEESSGFNNIQHDNTMKSPVDKHMD 179
             +  +  N H + +NNT +DQ       NK++    EE+ +   ++ +++      + + D
Sbjct:   281 DQHNNNNHHTDQHNNTISDQINIFPEKNKRDNRINEEKYTIKEHLIYEDEQNISYESNKD 340

Query:   178 HN---NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGIN 62
              +   N  +NE+  D  + +++ I +N  +N    ++YK +N
Sbjct:   341 SSSEENTILNEYSSDEEKNKIDCI-LNGCRN---VKNYKKLN 378

 Score = 89 (31.3 bits), Expect = 1.0, P = 0.65
 Identities = 48/168 (28%), Positives = 73/168 (43%), Frame = -2

Query:   490 DEEPIDSTKNNRND-NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             D    +  K  + D  IS K    K   +  ++NN   ++   D   KNN   +   Q I
Sbjct:   191 DSSKREGGKKEKEDLYISRKEFSGKKKSHKGEHNN---NNHHTDQHIKNN---YHTDQHI 244

Query:   313 QNIHHNVY---NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNNV---PINE 155
             +N +H      NN  TDQ+       +   NN  H     +  + H D HNN     IN 
Sbjct:   245 KNNYHTDQHNNNNHHTDQHNNN-NHHTDQHNNNNHYTDQHNNNNHHTDQHNNTISDQINI 303

Query:   154 WPGDAHEKELNNIFVNK--IKNN---NDAQSYKGINNKTIFLEENND-ERYNQENEK 2
             +P + ++++ N I   K  IK +    D Q+    +NK    EEN     Y+ + EK
Sbjct:   304 FP-EKNKRD-NRINEEKYTIKEHLIYEDEQNISYESNKDSSSEENTILNEYSSDEEK 358

 Score = 87 (30.6 bits), Expect = 1.8, P = 0.83
 Identities = 39/165 (23%), Positives = 70/165 (42%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHK-KDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             K + Y+  +     K +     +N N H  + I+N    +  + ++   D   ++NN+N 
Sbjct:   202 KEDLYISRKEFSGKKKSHKGEHNNNNHHTDQHIKNNYHTDQHIKNNYHTD---QHNNNNH 258

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNI--QHDNTMKSPVDKHMDHNNVP-- 164
                Q   N HH   +N     N   Y ++ +  N+   QH+NT+   ++   + N     
Sbjct:   259 HTDQHNNNNHHTDQHN-----NNNHYTDQHNNNNHHTDQHNNTISDQINIFPEKNKRDNR 313

Query:   163 INEWPGDAHEKELNNIFVN-KIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
             INE      E  +     N   ++N D+ S       TI  E ++DE  N+
Sbjct:   314 INEEKYTIKEHLIYEDEQNISYESNKDSSS----EENTILNEYSSDEEKNK 360

 Score = 83 (29.2 bits), Expect = 5.3, P = 0.99
 Identities = 33/167 (19%), Positives = 79/167 (47%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHK--KDIQNINQNNNIVGS--DQXDDIFFKNN 344
             +K N ++  +P++  KN    + S K   K   ++ + N++     S  D+  D ++K  
Sbjct:    75 HKNNKHISIKPVN--KNKYVHSPSPKKTKKIYDELSDYNKHKKYSSSKMDKKKDSYYKEQ 132

Query:   343 NDNFGEGQDIQNIHHNVYNNTPTDQNKK---EYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             ++ + E +       + Y+     + KK   +YE E   +N  ++D    S    +  + 
Sbjct:   133 SNKYKEKRKYDESSQDTYDKKRKRKRKKKKYDYEREEEKYN--RYDERRDSSY--YTSNY 188

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGI-NNKTIFLEENNDERYNQE 11
             +   ++  G   EKE  ++++++ + +   +S+KG  NN     +++    Y+ +
Sbjct:   189 SEDSSKREGGKKEKE--DLYISRKEFSGKKKSHKGEHNNNNHHTDQHIKNNYHTD 241

 Score = 82 (28.9 bits), Expect = 6.9, P = 1.0
 Identities = 32/109 (29%), Positives = 46/109 (42%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNIN-----QNNNIVGSDQXDDIFFKN 347
             N  N + D+       NN + +  N N H  D  N N     Q+NN + SDQ +    KN
Sbjct:   254 NNNNHHTDQH----NNNNHHTDQHNNNNHYTDQHNNNNHHTDQHNNTI-SDQINIFPEKN 308

Query:   346 NNDNFGEGQDIQNIHHNVYN---NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVD 191
               DN    +      H +Y    N   + NK    EE++  N    D   K+ +D
Sbjct:   309 KRDNRINEEKYTIKEHLIYEDEQNISYESNKDSSSEENTILNEYSSDEE-KNKID 362


>sp|P54675|P3K3_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 3 (PI3-KINASE)
            (PTDINS-3-KINASE) (PI3K) >gi|733524 (U23478)
            phosphatidylinositol-4,5-diphosphate 3-kinase [Dictyostelium
            discoideum]
            Length = 1585

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.090, P = 0.087
 Identities = 43/168 (25%), Positives = 73/168 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNN---IVGSDQXDDIFFKNNN 341
             N  N Y+      +  NN N+N +N N +  +  N N NNN   I+ S   ++   K  N
Sbjct:    42 NNSNIYLTIPTTQNLINNNNNNNNNNNNNNNNNNNNNNNNNNNVIIPSASTEN---KEEN 98

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             DN     +  NI+ +  ++   D N  E +         +  +T  SP++K      +  
Sbjct:    99 DNNNSNNN-NNINLSPDSSITKDINITENKITEIKTTETKETSTGTSPLEKSPSKGFIIS 157

Query:   160 NEWPGDAHEKE---LNNIFVNKIKNNNDAQSYKGINNKTIF-LEENNDERYNQEN 8
              + P + +E E   +NNI    I N     S   +  K +  +++NN+   N  N
Sbjct:   158 PKKPEEENEIEGETINNI---AITNYTQGPSMLTLMKKKLENIKKNNNNNNNNGN 209

 Score = 101 (35.6 bits), Expect = 0.090, P = 0.087
 Identities = 45/184 (24%), Positives = 72/184 (39%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNN---IVGS-----DQXDDIF 356
             N  N Y+      +  NN N+N +N N +  +  N N NNN   I+ S      + +D  
Sbjct:    42 NNSNIYLTIPTTQNLINNNNNNNNNNNNNNNNNNNNNNNNNNNVIIPSASTENKEENDNN 101

Query:   355 FKNNNDNFGEGQDIQNIHH-NVYNNTPTDQNKKEYEEESSGFNNIQHDNTM------KSP 197
               NNN+N     D       N+  N  T+    E +E S+G + ++   +       K P
Sbjct:   102 NSNNNNNINLSPDSSITKDINITENKITEIKTTETKETSTGTSPLEKSPSKGFIISPKKP 161

Query:   196 VDKHMDH----NNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
              +++       NN+ I  +        L    +  IK NN+  +  G  N       NN+
Sbjct:   162 EEENEIEGETINNIAITNYTQGPSMLTLMKKKLENIKKNNNNNNNNGNGNNN---SNNNN 218

Query:    28 ERYNQEN 8
                N  N
Sbjct:   219 SNSNNNN 225

 Score = 92 (32.4 bits), Expect = 1.1, P = 0.67
 Identities = 23/88 (26%), Positives = 42/88 (47%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             +NN N+N +N N +  +  N N NNN   ++  +++   NNN+N  E   I+    ++  
Sbjct:   346 ENNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNEELINNNNNNNNDENYKIEETEESLKE 405

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMK 203
                 ++ + E  E+     N + DN  K
Sbjct:   406 LLEKEKLENEEREKILKERN-EIDNLKK 432

 Score = 92 (32.4 bits), Expect = 1.1, P = 0.67
 Identities = 38/165 (23%), Positives = 68/165 (41%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH- 299
             ++  NN N+N +N N +  +  N+   +    + + +D    NNN+N     D       
Sbjct:    62 NNNNNNNNNNNNNNNNNNNNNNNVIIPSASTENKEENDNNNSNNNNNINLSPDSSITKDI 121

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTM------KSPVDKHMDH----NNVPINEWP 149
             N+  N  T+    E +E S+G + ++   +       K P +++       NN+ I  + 
Sbjct:   122 NITENKITEIKTTETKETSTGTSPLEKSPSKGFIISPKKPEEENEIEGETINNIAITNYT 181

Query:   148 -GDAH----EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
              G +     +K+L NI  N   NNN+       NN       NN+
Sbjct:   182 QGPSMLTLMKKKLENIKKNNNNNNNNGNGNNNSNNNNSNSNNNNN 226

 Score = 85 (29.9 bits), Expect = 7.5, P = 1.0
 Identities = 43/165 (26%), Positives = 65/165 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNI-----SNKNVHKKDIQNINQNNNIVGSDQXDDIFFK 350
             +N  N   +    ++  NN N+N+     S +N  + D  N N NNNI  S   D    K
Sbjct:    62 NNNNNNNNNNNNNNNNNNNNNNNVIIPSASTENKEENDNNNSNNNNNINLSP--DSSITK 119

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             + N    E + I  I       T T  +  E +  S GF         ++ ++    +N 
Sbjct:   120 DIN--ITENK-ITEIKTTETKETSTGTSPLE-KSPSKGFIISPKKPEEENEIEGETINNI 175

Query:   169 VPINEWPGDAH----EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
                N   G +     +K+L NI  N   NNN+       NN       NN+
Sbjct:   176 AITNYTQGPSMLTLMKKKLENIKKNNNNNNNNGNGNNNSNNNNSNSNNNNN 226

 Score = 79 (27.8 bits), Expect = 0.33, Sum P(2) = 0.28
 Identities = 22/80 (27%), Positives = 42/80 (52%), Frame = -2

Query:   466 KNNRNDNISNKNVHKK--DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             KN + ++++N N++      QN+  NNN   ++        NNN+N     +  N ++NV
Sbjct:    34 KNIKENSLNNSNIYLTIPTTQNLINNNNNNNNN--------NNNNNNNNNNNNNNNNNNV 85

Query:   292 YNNTPTDQNKKEYEEESSGFNN 227
                + + +NK+E +  +S  NN
Sbjct:    86 IIPSASTENKEENDNNNSNNNN 107

 Score = 78 (27.5 bits), Expect = 7.1, Sum P(2) = 1.0
 Identities = 18/54 (33%), Positives = 26/54 (48%), Frame = -2

Query:   364 DIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMK 203
             DIF +NNN+N     +  N ++N  NN   + N    EE  +  NN  +D   K
Sbjct:   342 DIFNENNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNEELINNNNNNNNDENYK 395

 Score = 78 (27.5 bits), Expect = 7.1, Sum P(2) = 1.0
 Identities = 32/119 (26%), Positives = 54/119 (45%), Frame = -2

Query:   364 DIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH 185
             DIF +NNN+N     +  N ++N  NN   + N    EE  +  NN  +D   K      
Sbjct:   342 DIFNENNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNEELINNNNNNNNDENYK------ 395

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKI-KNNNDAQSYKGINN--KTIFLEE---NNDER 23
             ++     + E      +++L N    KI K  N+  + K  N+  K  F+     +ND+ 
Sbjct:   396 IEETEESLKEL---LEKEKLENEEREKILKERNEIDNLKKKNHLSKGYFMRACNASNDDG 452

Query:    22 YNQEN 8
               +E+
Sbjct:   453 LEEED 457

 Score = 61 (21.5 bits), Expect = 0.33, Sum P(2) = 0.28
 Identities = 21/82 (25%), Positives = 39/82 (47%), Frame = -2

Query:   247 ESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKG 68
             +S  FN   ++N   +  + + ++NN   N    + +    N   +N   NNN+ ++YK 
Sbjct:   340 QSDIFNENNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNEELINNNNNNNNDENYK- 395

Query:    67 INNKTIFLEE--NNDERYNQENEK 2
             I      L+E    ++  N+E EK
Sbjct:   396 IEETEESLKELLEKEKLENEEREK 419

 Score = 49 (17.2 bits), Expect = 7.1, Sum P(2) = 1.0
 Identities = 12/32 (37%), Positives = 19/32 (59%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQN 395
             +E   +++ NN N N+S  +   KDI NI +N
Sbjct:    96 EENDNNNSNNNNNINLSPDSSITKDI-NITEN 126


>gi|1763002 (U67262) RING-finger protein [Helicoverpa armigera
            nucleopolyhedrovirus]
            Length = 352

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.098, P = 0.094
 Identities = 44/170 (25%), Positives = 74/170 (43%), Frame = -2

Query:   475 DSTKNNRNDNISN---KNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNNDNFGEGQ--D 317
             +ST +N +DN SN     +H +D   +N N  NN + +   +D    NNN N  +    D
Sbjct:   127 NSTNDNDDDNTSNCDDATIHNEDTAELNTNTVNNDIETTVDNDASV-NNNTNVDDQNTDD 185

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN------NVPINE 155
             + +   +  N+   + N    +  ++  +N Q +NT     D ++D N      NV  N 
Sbjct:   186 VDDDDDDDVNDDDVNDNDDVNDVNTNVNSNNQINNTTNDN-DTNVDANVCNTNANVDTNA 244

Query:   154 WPGDAHEKELN-NI--FV---NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                D      N N+   V   N + NN    S+  +N+  +    NN +  N +N
Sbjct:   245 NVDDVANSAANDNVQHTVDSDNNVNNNVSQTSHDNVNSNQV---NNNSKSDNDKN 296

 Score = 91 (32.0 bits), Expect = 0.23, P = 0.20
 Identities = 31/114 (27%), Positives = 47/114 (41%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N  V++   +   NN+ +N +N N    D    N N N+  +   DD+     NDN    
Sbjct:   202 NDDVNDVNTNVNSNNQINNTTNDNDTNVDANVCNTNANVDTNANVDDVANSAANDNVQHT 261

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
              D  N   NV NN    Q   +    +   NN + DN   S  D  + + ++PI
Sbjct:   262 VDSDN---NVNNNV--SQTSHDNVNSNQVNNNSKSDNDKNSVDDDDISNLSLPI 310

 Score = 89 (31.3 bits), Expect = 0.40, P = 0.33
 Identities = 36/144 (25%), Positives = 64/144 (44%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             NT      I++T +N  D   N N +  D     QN + V  D  DD+    N+D+  + 
Sbjct:   154 NTNTVNNDIETTVDN--DASVNNNTNVDD-----QNTDDVDDDDDDDV----NDDDVNDN 202

Query:   322 QDIQNIHHNV-----YNNTPTDQNKKEYEEESSGFN-----NIQHDNTMKSPVDKHMDHN 173
              D+ +++ NV      NNT T+ N    +      N     N   D+   S  + ++ H 
Sbjct:   203 DDVNDVNTNVNSNNQINNT-TNDNDTNVDANVCNTNANVDTNANVDDVANSAANDNVQHT 261

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYK 71
                 N    +  +   +N+  N++ NN+ + + K
Sbjct:   262 VDSDNNVNNNVSQTSHDNVNSNQVNNNSKSDNDK 295

 Score = 89 (31.3 bits), Expect = 0.40, P = 0.33
 Identities = 41/179 (22%), Positives = 72/179 (40%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNND 338
             N  N   D    +   ++   N  +  +H +D   +N N  NN + +   +D    NNN 
Sbjct:   118 NNSNNNDDNNSTNDNDDDNTSNCDDATIHNEDTAELNTNTVNNDIETTVDNDASV-NNNT 176

Query:   337 NFGEGQ--DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN--- 173
             N  +    D+ +   +  N+   + N    +  ++  +N Q +NT     D ++D N   
Sbjct:   177 NVDDQNTDDVDDDDDDDVNDDDVNDNDDVNDVNTNVNSNNQINNTTNDN-DTNVDANVCN 235

Query:   172 ---NVPINEWPGDAHEKELN-NI--FV---NKIKNNNDAQSYKGINNKTIFLEENNDERY 20
                NV  N    D      N N+   V   N + NN    S+  +N+  +    NN +  
Sbjct:   236 TNANVDTNANVDDVANSAANDNVQHTVDSDNNVNNNVSQTSHDNVNSNQV---NNNSKSD 292

Query:    19 NQEN 8
             N +N
Sbjct:   293 NDKN 296

 Score = 86 (30.3 bits), Expect = 0.92, P = 0.60
 Identities = 33/147 (22%), Positives = 64/147 (43%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKK--DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             S +N+ +DN  ++ V+ +  D+ N N N++   ++  DD    N +D     +D   ++ 
Sbjct:    97 SDRNSDSDNCDSE-VYDEIVDVNNSNNNDDNNSTNDNDDDNTSNCDDATIHNEDTAELNT 155

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN- 122
             N  NN    +   + +   +   N+   NT     D   D N+  +N+   D ++   N 
Sbjct:   156 NTVNNDI--ETTVDNDASVNNNTNVDDQNTDDVDDDDDDDVNDDDVND-NDDVNDVNTNV 212

Query:   121 --NIFVNKIKNNNDAQSYKGINNKTIFLEEN 35
               N  +N   N+ND      + N    ++ N
Sbjct:   213 NSNNQINNTTNDNDTNVDANVCNTNANVDTN 243


>gi|1236921 (U49822) Var1p [Saccharomyces douglasii]
            Length = 373

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.11, P = 0.10
 Identities = 40/151 (26%), Positives = 77/151 (50%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG-QDIQNIH 302
             ++ T NN N+NI+NK +  K++  ++ NN  + + +      KNNN N     Q + N++
Sbjct:    13 MNKTNNNNNNNINNKKLLLKNML-LDMNNKRMNNMKT---MLKNNNMNINNKLQHLNNMN 68

Query:   301 H---NVYN--------NTPTDQ--NKKEYEEESSGFNNIQHDNT-MKSPVDKH-MDHNNV 167
             +    +YN        N   D+  NK  Y+  +   NN+  +   M   +++H ++  N+
Sbjct:    69 NWNTQIYNYNKNMEIMNIMNDKLINKLLYKMMTLKLNNMNINKIIMSKTINQHSLNKLNI 128

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN 32
                 +    +  ++NN+      NNN+   Y  + NK + +  NN
Sbjct:   129 KFYYY----YNNDINNM------NNNNNNYYMNMMNKLMNIMNNN 163

 Score = 77 (27.1 bits), Expect = 0.92, Sum P(2) = 0.60
 Identities = 37/147 (25%), Positives = 59/147 (40%), Frame = -2

Query:   448 NISNKNVHKKDIQNINQNNNIVGSDQXDDIF-FKNNNDNFGEGQDIQNIHHNVYNNTPTD 272
             NI     +  DI N+N NNN    +  + +    NNN N      + NI    YN   T 
Sbjct:   127 NIKFYYYYNNDINNMNNNNNNYYMNMMNKLMNIMNNNMN----NSLCNILSYYYNKKVTI 182

Query:   271 QN-KKEYEEESSG-FNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIK 98
             ++ K  Y   +S  F+     N M    +  + +    +N      ++  ++  ++N I 
Sbjct:   183 ESIKLSYIYLNSDIFSKYISLNDMNKYNNGILTNYQRMLNNIMPKLNDHNISMNYINNIN 242

Query:    97 NNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             N N+   Y   NN    L  NN+   N  N
Sbjct:   243 NINN-NKY---NNMINLLNNNNNNNNNNNN 268

 Score = 45 (15.8 bits), Expect = 0.92, Sum P(2) = 0.60
 Identities = 11/22 (50%), Positives = 14/22 (63%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNIN 401
             KNN N NI+NK  H  ++ N N
Sbjct:    51 KNN-NMNINNKLQHLNNMNNWN 71


>gi|2460283 (AF024654) hybrid histidine kinase DHKB [Dictyostelium discoideum]
            Length = 1969

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.11, P = 0.11
 Identities = 35/125 (28%), Positives = 58/125 (46%), Frame = -2

Query:   379 SDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKS 200
             S+Q +     NNN+N        NI  N+ NN   + NK      ++  NN  ++N +++
Sbjct:     4 SEQTNSFESSNNNNN--------NIDSNINNNLENNNNKNNNNNNNNNNNNNNNNNNIEN 55

Query:   199 PVDKHMDHNNVPINEWPG-DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLE--ENND 29
              +DK    NN   N   G ++H K    +   K K  N  ++ K I+ K + ++   N  
Sbjct:    56 SIDK----NNKEDNSLVGVNSHRKHRTRL---KSKKGNKHETKKEIDYKDLLIKLPHNAV 108

Query:    28 ERYNQ-ENE 5
               +N  ENE
Sbjct:   109 SNFNSLENE 117


>gi|1513232 (U66366) ORFveg109 [Dictyostelium discoideum]
            Length = 239

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.11, P = 0.11
 Identities = 47/145 (32%), Positives = 74/145 (51%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQ------N--NNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             +NN N N   KN+ K++IQ  N+      N  NNI      +++  K N+D   + Q+  
Sbjct:    81 ENNNNKNEKFKNIPKQEIQRRNEFLKESKNEINNIKIKLSNEEVIKKINSDKL-KNQEFN 139

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNN--IQHDNTMKSPVDKHMDH--NNVP-INEWPG 146
             N  +N  NN  T+  K + E + + F N  I++  ++    DK +D+   +V  I+E   
Sbjct:   140 N--YNKSNNY-TNYIKHQNEIKDTEFLNEQIEYKKSLMDKQDKELDYLLGDVKTIHEISL 196

Query:   145 DAHEKELNNIFVNKIKNN-NDA--QSYKGINN 59
             +  +KEL     NKI  N ND   QS   IN+
Sbjct:   197 EI-QKELE--IQNKILGNLNDRADQSLFSINS 225


>pir||A44863 trophozoite antigen R45 - Plasmodium falciparum (fragment)
            >gi|552229 (M83793) trophozoite antigen [Plasmodium falciparum]
            Length = 332

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.12, P = 0.11
 Identities = 30/118 (25%), Positives = 54/118 (45%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             EP  +  N  + N+S  N HKKD ++   +N+   S+   D   K+++++  +       
Sbjct:   210 EPECANCNEEDKNMSEDN-HKKDSKHKGDSNHKSDSNHKSDSNHKSDSNHKSDS------ 262

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEK 131
             +H   +N  +D N K      SG N+ + D+  +S  +   DHN+   N    D+  K
Sbjct:   263 NHKSGSNHKSDCNHKSGSNHKSGSNH-KSDSNHQSDCNHMSDHNHKSDNNHKSDSSHK 319


>gnl|PID|e316524 (Y13119) pleiotropic effects on cellular differentiation and
            slug behaviour [Dictyostelium discoideum]
            Length = 791

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 3.4, P = 0.97
 Identities = 24/82 (29%), Positives = 38/82 (46%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFK---NNNDNFGEGQD---- 317
             ++  NN N+N +N N +  +  N N NNN   +            NNN+N  E  +    
Sbjct:   392 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTSTTTTTTTTTSSCNNNNNNNNENTEHIVK 451

Query:   316 IQNI-----HHNVYNNTPTDQN 266
             I+N      ++N+ NNT  D+N
Sbjct:   452 IENTECNNNNNNIINNTENDEN 473

 Score = 80 (28.2 bits), Expect = 0.12, Sum P(2) = 0.11
 Identities = 25/101 (24%), Positives = 44/101 (43%), Frame = -2

Query:   409 NINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFN 230
             NIN NNNI  ++  ++    NNN+N     +  N ++N  N T T           +  N
Sbjct:   381 NINNNNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNN-NNTTSTTTTTTTTTSSCNNNN 439

Query:   229 NIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N  ++NT      ++ + NN   N      +++ +N   +N
Sbjct:   440 NNNNENTEHIVKIENTECNNNNNNIINNTENDENINKPILN 480

 Score = 66 (23.2 bits), Expect = 5.3, Sum P(2) = 0.99
 Identities = 24/107 (22%), Positives = 42/107 (39%), Frame = -2

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
             Q + N+ +N+ NN   + N       ++  NN  ++N   +    + ++NN         
Sbjct:   373 QLLNNVTNNINNNNNINNNNNNNNNNNNNNNNNNNNNNNNN---NNNNNNNTTSTTTTTT 429

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                   NN   N   NN + +    I N T     NN+   N EN++
Sbjct:   430 TTTSSCNN---NNNNNNENTEHIVKIEN-TECNNNNNNIINNTENDE 472

 Score = 65 (22.9 bits), Expect = 6.8, Sum P(2) = 1.0
 Identities = 21/78 (26%), Positives = 31/78 (39%), Frame = -2

Query:   232 NNIQHDNTMKSPVDK----HMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGI 65
             N I+H    +  + K    H   NN+ I        +++L N   N I NNN+  +    
Sbjct:   336 NRIEHQQKEQQRLLKKLCYHDKENNI-IQLIQQQQQQQQLLNNVTNNINNNNNINNNNNN 394

Query:    64 NNKTIFLEENNDERYNQEN 8
             NN       NN+   N  N
Sbjct:   395 NNNNNNNNNNNNNNNNNNN 413

 Score = 58 (20.4 bits), Expect = 0.12, Sum P(2) = 0.11
 Identities = 13/46 (28%), Positives = 25/46 (54%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGS 377
             +  G+T +    I++  NN N+N +N N +  +  N N +NN+  +
Sbjct:    77 TTNGST-MSPNCINANNNNNNNNSNNNNSNNNNNNN-NASNNLTSN 120

 Score = 55 (19.4 bits), Expect = 0.24, Sum P(2) = 0.21
 Identities = 13/42 (30%), Positives = 19/42 (45%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNN 389
             SN  N   +   +     N N+N +N N +  +  N N NNN
Sbjct:    71 SNSPNGTTNGSTMSPNCINANNNNNNNNSNNNNSNNNNNNNN 112

 Score = 44 (15.5 bits), Expect = 3.0, Sum P(2) = 0.95
 Identities = 9/29 (31%), Positives = 14/29 (48%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNN 389
             +S  NN N+N +N N       N + + N
Sbjct:    98 NSNNNNSNNNNNNNNASNNLTSNKSSSTN 126

 Score = 44 (15.5 bits), Expect = 3.0, Sum P(2) = 0.95
 Identities = 10/32 (31%), Positives = 14/32 (43%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKK 419
             +N  N   +    +S  NN N+N SN     K
Sbjct:    90 ANNNNNNNNSNNNNSNNNNNNNNASNNLTSNK 121

 Score = 43 (15.1 bits), Expect = 3.8, Sum P(2) = 0.98
 Identities = 9/30 (30%), Positives = 16/30 (53%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQN-INQNNN 389
             ++  NN N+N SN N +  +  N +  N +
Sbjct:    93 NNNNNNSNNNNSNNNNNNNNASNNLTSNKS 122


>gi|160373 (M63271) malaria antigen [Plasmodium falciparum]
           Length = 80

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.12, P = 0.12
 Identities = 22/76 (28%), Positives = 34/76 (44%), Frame = -2

Query:   286 NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVN 107
             N  +D N K     +S  N++  D+  KS  +   DHN+   N    D + K   N   +
Sbjct:     1 NHKSDNNHKSDHNHNSDSNHMS-DHNHKSDHNHKSDHNHKSDNNHKSDNNHKSDPNHKSD 59

Query:   106 KIKNNNDAQSYKGINN 59
               KNNN+ +  K  +N
Sbjct:    60 HKKNNNNNKDNKNDDN 75

 Score = 66 (23.2 bits), Expect = 0.77, P = 0.54
 Identities = 24/76 (31%), Positives = 38/76 (50%), Frame = -2

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             +HN  +N  +D N K      S  N+ + DN  KS  D +  H + P ++   D H+K  
Sbjct:    13 NHNSDSNHMSDHNHKSDHNHKSDHNH-KSDNNHKS--DNN--HKSDPNHK--SD-HKKNN 64

Query:   124 NNIFVNKIKNNNDAQS 77
             NN   NK  +N+D+ +
Sbjct:    65 NNNKDNKNDDNDDSDA 80

 Score = 62 (21.8 bits), Expect = 2.2, P = 0.89
 Identities = 19/75 (25%), Positives = 40/75 (53%), Frame = -2

Query:   229 NIQHDNTMKSPVDKHMDHNNVPINEWPGDA-HEKELNNIFVNKIKNNNDAQSYKGINNKT 53
             N + DN  KS  + + D N++  +    D  H+ + N+   N  K++N+ +S    N+K+
Sbjct:     1 NHKSDNNHKSDHNHNSDSNHMSDHNHKSDHNHKSDHNHKSDNNHKSDNNHKSDP--NHKS 58

Query:    52 IFLEENNDERYNQENE 5
                + NN+ + N+ ++
Sbjct:    59 DHKKNNNNNKDNKNDD 74

 Score = 59 (20.8 bits), Expect = 4.8, P = 0.99
 Identities = 18/62 (29%), Positives = 29/62 (46%), Frame = -2

Query:   352 KNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH- 176
             K++N++  +     + +H   +N  +D N K      S  NN + DN  KS  +   DH 
Sbjct:     3 KSDNNHKSDHNHNSDSNHMSDHNHKSDHNHKSDHNHKSD-NNHKSDNNHKSDPNHKSDHK 61

Query:   175 -NN 170
              NN
Sbjct:    62 KNN 64


>gi|1022332 (X83707) protein kinase [Plasmodium falciparum]
            Length = 909

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.13, Sum P(2) = 0.12
 Identities = 26/95 (27%), Positives = 42/95 (44%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEG 323
             N  + +  I+S  NN  DN  + N    +  N N +NN   ++        NNN +    
Sbjct:   193 NNMIVQGMINSNNNNNRDNNGDNNSSNNNSSNNNSSNNNSSNNNSS-----NNNSSSSSS 247

Query:   322 QDIQNIHHNVYNNTPTDQNKKE--YEEESSGFNNIQH 218
               + N  H   NNTP+D++ +   Y + +   N I H
Sbjct:   248 SSVLNDVH--VNNTPSDEDMESCNYIKNNRRINIINH 282

 Score = 83 (29.2 bits), Expect = 5.6, Sum P(2) = 1.0
 Identities = 35/147 (23%), Positives = 60/147 (40%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN--IHHNVYN 287
             N+N+ ++     K  I   N N  + G    ++    NN DN G+     N   ++N  N
Sbjct:   175 NQNEEMTADE--KSGIHPGNNNMIVQGMINSNN---NNNRDNNGDNNSSNNNSSNNNSSN 229

Query:   286 NTPTDQNKKEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFV 110
             N  ++ N       SS  +++ +D +   +P D+ M+  N   N    +      N+ F 
Sbjct:   230 NNSSNNNSSNNNSSSSSSSSVLNDVHVNNTPSDEDMESCNYIKNNRRINIINHFKNSFFN 289

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERY 20
               I N     +      K+ FL EN  + Y
Sbjct:   290 ENINNICSCHNISDFIKKS-FLNENQIKIY 318

 Score = 43 (15.1 bits), Expect = 0.13, Sum P(2) = 0.12
 Identities = 20/86 (23%), Positives = 37/86 (43%), Frame = -2

Query:   265 KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNND 86
             KK+Y  +   FN  + +N MK   D+  + +         D  +   ++    KI N + 
Sbjct:   381 KKKYNNQ---FNMFEFNNDMKDTRDEICNLDKT------SDICDMSCDD----KILNGDG 427

Query:    85 AQSYKGINNKTIFLEENNDERYNQEN 8
               S   INN    L  ++++  N++N
Sbjct:   428 ISSCHKINNYNNILYNSHNKSTNEQN 453

 Score = 39 (13.7 bits), Expect = 5.6, Sum P(2) = 1.0
 Identities = 10/26 (38%), Positives = 14/26 (53%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVH 425
             N Y D+E  +    N N N+S K +H
Sbjct:    19 NIYFDDEKSE----NSNKNLSYKILH 40


>sp|P30397|YCX4_EUGGR HYPOTHETICAL 64.3 KD PROTEIN IN RPS3 3'REGION (ORF516)
            >pir||S34525 hypothetical protein 516 (rps3 3' region) - Euglena
            gracilis chloroplast >gnl|PID|e222140 (X70810) orf516; ttg start
            [Euglena gracilis] >gnl|PID|e223926 (Z11874) ORF516 polypeptide,
            function unknown [Euglena gracilis]
            Length = 516

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.13, P = 0.12
 Identities = 52/152 (34%), Positives = 73/152 (48%), Frame = +2

Query:     2 FF--IFLII-PFII----IFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFI 160
             FF  +FLII  FI      FFQ+N F+ Y    L  I  FYF  K+   F F+C  +  I
Sbjct:   206 FFKSLFLIIFNFIFNGLNFFFQENFFISYKVYYLFYIDKFYFFFKFPYDF-FIC--KKII 262

Query:   161 YRDIIMIHMFVDRTFHSIIMLYIIEAT*F-FFIFFFILISRCIIIYI-MMYI-LYVLSFT 331
                  +  + ++   +S    Y  E   F FFIF F+     I+++I   +I  Y LS  
Sbjct:   263 ISFFSLRGIILNININSF---YRFETFVFNFFIFDFLRFGSNILLHINKKHIQFYKLSLK 319

Query:   332 KIVIIIFKKDIIXLI*SHNIIILVNILN---ILFMNIFI 439
              IV +  KK +  L+   N  IL + LN     F N F+
Sbjct:   320 MIVKMFLKKSVFFLVNLLNKKIL-DCLNRGFFCFNNNFL 357


>gi|2149570 (U87912) MAP kinase kinase protein DdMEK1 [Dictyostelium
            discoideum]
            Length = 660

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.72, P = 0.51
 Identities = 39/154 (25%), Positives = 73/154 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND- 338
             S+ GN  ++  P  +  NN+N+N +N N +  +  N N +NN   ++  + +  K     
Sbjct:    12 SSSGNNIINT-PT-TNNNNKNNNNNNNNNNNSNNSNNNSSNN--NNNNNNAVGVKTGKKV 67

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKK-EYEEESSGFNNIQHDNTMKSPV-DKHMD---HN 173
             N      +QN + N Y+ T +   K+ +      G   I+ ++   S V D++ +   H+
Sbjct:    68 NLKVETPVQN-NENSYSLTTSGTFKEGDLLINKKGLL-IKGESPKNSSVNDRNKNKSLHS 125

Query:   172 NV-P-INEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINN 59
             N+ P +   P  +   + N  F N   NNN+  +   +NN
Sbjct:   126 NLNPQLLASPTSSESMDFNQGFYNNNNNNNNNNNNNNLNN 165

 Score = 89 (31.3 bits), Expect = 0.93, P = 0.61
 Identities = 46/192 (23%), Positives = 71/192 (36%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFK-----NNND 338
             NT        +  NN N+N ++ N +     N N NNN VG      +  K      NN+
Sbjct:    20 NTPTTNNNNKNNNNNNNNNNNSNNSNNNSSNNNNNNNNAVGVKTGKKVNLKVETPVQNNE 79

Query:   337 N---------FGEGQDIQNIHHN-VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDK 188
             N         F EG  + N     +   +P + +  +  +  S  +N+ +   + SP   
Sbjct:    80 NSYSLTTSGTFKEGDLLINKKGLLIKGESPKNSSVNDRNKNKSLHSNL-NPQLLASPTSS 138

Query:   187 H-MDHNNVPINEWPGDAHEKELNNI--FVNKIKNNNDAQSYKGIN----------NKTIF 47
               MD N    N    + +    NN+  F N + N  D+    GI+          N T  
Sbjct:   139 ESMDFNQGFYNNNNNNNNNNNNNNLNNFNNLMNNGIDSPQLSGISISTPTSSHSFNNTFT 198

Query:    46 LEENNDERYNQEN 8
                NN+  YN  N
Sbjct:   199 NYYNNNNNYNNYN 211

 Score = 88 (31.0 bits), Expect = 0.13, Sum P(2) = 0.12
 Identities = 25/89 (28%), Positives = 39/89 (43%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQ-NNNIVGSDQXDDIFFKNN------NDNFGEGQDIQNI 305
             NN N+N +N N    ++ N N   NN + S Q   I           N+ F    +  N 
Sbjct:   149 NNNNNNNNNNN--NNNLNNFNNLMNNGIDSPQLSGISISTPTSSHSFNNTFTNYYNNNNN 206

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
             ++N  NN  ++ N   Y   ++ FNN  + N
Sbjct:   207 YNNYNNNNNSNNNNNNYNNSNNNFNNFNNYN 237

 Score = 85 (29.9 bits), Expect = 2.8, P = 0.94
 Identities = 43/156 (27%), Positives = 64/156 (41%), Frame = -2

Query:   475 DSTKNNR-NDNISNKNVHKKDIQNINQN--NNIVGSDQXD-DIFFKNNNDNFGEGQDIQN 308
             +S KN+  ND   NK++H     N+N     +   S+  D +  F NNN+N     +  N
Sbjct:   107 ESPKNSSVNDRNKNKSLHS----NLNPQLLASPTSSESMDFNQGFYNNNNNNNNNNNNNN 162

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKE 128
             +  N +NN     N      + SG +       + +P   H   NN   N +  + +   
Sbjct:   163 L--NNFNNL---MNNGIDSPQLSGIS-------ISTPTSSH-SFNNTFTNYYNNNNNYNN 209

Query:   127 LNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              NN   N   NNN+  +Y   NN   F   NN   Y   N
Sbjct:   210 YNN---NNNSNNNN-NNYNNSNNN--FNNFNNYNNYGNNN 243

 Score = 74 (26.0 bits), Expect = 6.5, Sum P(2) = 1.0
 Identities = 23/104 (22%), Positives = 45/104 (43%), Frame = -2

Query:   475 DSTKNNRND--NISNKNVHKKDIQNINQNNNIVGSDQXDDIF--FKNNNDNFGE--GQDI 314
             ++  NN N+  N+ N  +    +  I+ +     S   ++ F  + NNN+N+      + 
Sbjct:   157 NNNNNNLNNFNNLMNNGIDSPQLSGISISTP-TSSHSFNNTFTNYYNNNNNYNNYNNNNN 215

Query:   313 QNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
              N ++N YNN+  + N           NN  + N ++S  +   D
Sbjct:   216 SNNNNNNYNNSNNNFNNFNNYNNYGNNNNFNNFNALQSSSNSSFD 260

 Score = 73 (25.7 bits), Expect = 8.7, Sum P(2) = 1.0
 Identities = 24/81 (29%), Positives = 36/81 (44%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG--EGQDIQNI 305
             I S+ NN  +  +  N +K +  N N NNN   S+        NNN+  G   G+ +   
Sbjct:    11 ISSSGNNIINTPTTNNNNKNNNNNNNNNNNSNNSNNNSSNNNNNNNNAVGVKTGKKV--- 67

Query:   304 HHNVYNNTPTDQNKKEYEEESSG 236
               N+   TP   N+  Y   +SG
Sbjct:    68 --NLKVETPVQNNENSYSLTTSG 88

 Score = 46 (16.2 bits), Expect = 0.13, Sum P(2) = 0.12
 Identities = 13/41 (31%), Positives = 17/41 (41%), Frame = -2

Query:   130 ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +L N+ +N   NNN   S    NN       NN+   N  N
Sbjct:   532 QLQNLDINN-SNNNIRNSNNNNNNNN---NNNNNNNNNNNN 568

 Score = 44 (15.5 bits), Expect = 0.21, Sum P(2) = 0.19
 Identities = 13/41 (31%), Positives = 17/41 (41%), Frame = -2

Query:   130 ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +L N+ +N   NNN   S    NN       NN+   N  N
Sbjct:   532 QLQNLDINN-SNNNIRNSNNNNNNNN----NNNNNNNNNNN 567


>pir||S23691 hypothetical protein 8 - Plasmodium falciparum
            Length = 256

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.13, P = 0.12
 Identities = 30/107 (28%), Positives = 54/107 (50%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDI---QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             +DS+KN  + N    +++K DI    N N NNN+  S    ++F K+N+ +     D+  
Sbjct:   136 MDSSKNMISPN-DRSSINKGDITMNNNENNNNNMGISRSSSNMFTKHNSFHNNNNNDLNQ 194

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             I     NN    +N  EY    S   N ++ N + + ++ + ++NN+  N
Sbjct:   195 I-----NNFGIKKN--EYYGNFSTSRNAKNVNNLINKIEDNKNNNNINNN 237

 Score = 83 (29.2 bits), Expect = 1.2, P = 0.71
 Identities = 31/107 (28%), Positives = 52/107 (48%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDI---QNINQNNNIVGSDQXDDIFFKNN---NDNFGEGQD 317
             +DS+KN  + N    +++K DI    N N NNN+  S    ++F K+N   N+N  +   
Sbjct:   136 MDSSKNMISPN-DRSSINKGDITMNNNENNNNNMGISRSSSNMFTKHNSFHNNNNNDLNQ 194

Query:   316 IQN--IHHN-VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             I N  I  N  Y N  T +N K      +   + +++N + +    H+D
Sbjct:   195 INNFGIKKNEYYGNFSTSRNAKNVNNLINKIEDNKNNNNINNN-GGHLD 242

 Score = 83 (29.2 bits), Expect = 1.2, P = 0.71
 Identities = 30/140 (21%), Positives = 64/140 (45%), Frame = -2

Query:   448 NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQ 269
             N S+++ +K  +QN N  N+    D   ++   N+  +  +G    N + N  NN    +
Sbjct:   116 NRSSRS-NKLSMQNYNHINH--NMDSSKNMISPNDRSSINKGDITMNNNENNNNNMGISR 172

Query:   268 NKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNN 89
             +      + + F+N  ++N   + ++      N     +    + K +NN+ +NKI++N 
Sbjct:   173 SSSNMFTKHNSFHN--NNNNDLNQINNFGIKKNEYYGNFSTSRNAKNVNNL-INKIEDNK 229

Query:    88 DAQSYKGINNKTIFLEENND 29
             +  +   INN    L+ ++D
Sbjct:   230 NNNN---INNNGGHLDLDSD 246

 Score = 76 (26.8 bits), Expect = 8.5, P = 1.0
 Identities = 37/151 (24%), Positives = 72/151 (47%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD--DIFFKNNND 338
             NK N + +     S+ +N N+ +   N+ K   ++IN+N+NI  + Q +  DI + N+  
Sbjct:    49 NKTNHHNNTTTTSSSSSN-NNMLKLNNIMKN--KDINKNDNIESNHQYNAHDILYDNSR- 104

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKH-MDHNNVPI 161
                 G  +  +    YN + +  NK   +  +   +N+     M SP D+  ++  ++ +
Sbjct:   105 ----GAMVDTMTPG-YNRS-SRSNKLSMQNYNHINHNMDSSKNMISPNDRSSINKGDITM 158

Query:   160 NEWPGDAHE----KELNNIFV--NKIKNNNDAQSYKGINN 59
             N    + +     +  +N+F   N   NNN+      INN
Sbjct:   159 NNNENNNNNMGISRSSSNMFTKHNSFHNNNN-NDLNQINN 197


>pir||A45600 asparagine-rich blood stage antigen (clone Pfa55-14) - Plasmodium
            falciparum (fragment) >gi|552185 (M59473) asparagine-rich antigen
            Pfa55-14 [Plasmodium falciparum]
            Length = 307

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.14, P = 0.13
 Identities = 44/177 (24%), Positives = 84/177 (47%), Frame = -2

Query:   505 GNTYVDEE-PIDSTKNNRNDNISNKNVHKKDIQNI----NQNNNIVGSDQXDDIFFKNNN 341
             G+ Y  E    D+ KN +   ++N+ V  K++ +     NQ +N +   +  + F   N 
Sbjct:    27 GDKYYKENIDYDNLKNQKR--LTNE-VDAKEMSDFILSSNQCSNNMNDKETQNGFDSLNE 83

Query:   340 DNFGEGQDIQ-NIHHNVY----NNTPTDQNKKEYEE-ESSGFNNIQHDNTM--KSPVDKH 185
             +   + +DIQ N + N Y    N++PT+ N   Y+  +   FN+ + ++T   KS    +
Sbjct:    84 EEAFKKEDIQVNPNKNFYDCNNNSSPTN-NISHYKHYDIFNFNDKKEEHTSFNKSNNSNN 142

Query:   184 MDHN--NVPINEW-PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
              ++N  N   N   P + + + +  +  N  +NNN+  S    NN  +     ++  Y+ 
Sbjct:   143 NNNNLKNTTYNMINPNNVY-RNVGTLPCNIQRNNNNNNSNNNNNNNDLMYNSFSNINYDN 201

Query:    13 EN 8
             EN
Sbjct:   202 EN 203

 Score = 91 (32.0 bits), Expect = 0.18, P = 0.17
 Identities = 43/156 (27%), Positives = 76/156 (48%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKK-DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI-H 302
             D    N  D+++ +   KK DIQ +N N N          F+  NN N     +I +  H
Sbjct:    71 DKETQNGFDSLNEEEAFKKEDIQ-VNPNKN----------FYDCNN-NSSPTNNISHYKH 118

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH-EKEL 125
             ++++N    +  K+E+   +   N+  ++N +K+     ++ NNV  N      + ++  
Sbjct:   119 YDIFN---FNDKKEEHTSFNKSNNSNNNNNNLKNTTYNMINPNNVYRNVGTLPCNIQRNN 175

Query:   124 NNIFVNKIKNNNDAQ--SYKGIN--NKTIF-LEENNDER---YNQEN 8
             NN   N   NNND    S+  IN  N+ I+ + +   E+   YN+ N
Sbjct:   176 NNNNSNNNNNNNDLMYNSFSNINYDNENIYNIYKELKEKCQLYNERN 222

 Score = 83 (29.2 bits), Expect = 1.7, P = 0.82
 Identities = 43/163 (26%), Positives = 77/163 (47%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKK------DIQNINQNNNIVGSDQXDDIFFK 350
             NK N   +    ++ KN   + I+  NV++       +IQ  N NNN   ++  +D+ + 
Sbjct:   135 NKSNNSNNNN--NNLKNTTYNMINPNNVYRNVGTLPCNIQRNNNNNNSNNNNNNNDLMYN 192

Query:   349 N-NNDNFGEGQDIQNIHHNV------YN--NTPTD--QNKKEYEEE-SSGFNNIQHDNTM 206
             + +N N+ + ++I NI+  +      YN  N+  +  +N  +Y+   S    N+ + N  
Sbjct:   193 SFSNINY-DNENIYNIYKELKEKCQLYNERNSLEEHIKNNMKYKIHLSKEMLNLYNPNER 251

Query:   205 KSPVDKHMDHNNVPINEWPGDAHEKELNNI---FVNKIKNNNDAQSY 74
             K   D  +   +  IN +    +EK+ NNI   F  K  NN   +SY
Sbjct:   252 KIKRDYLIGCLSSLIN-YDDLNNEKDYNNICDFFKKKSNNNKKGKSY 297


>gnl|PID|e8900 (X05182) RESA FC27 Ag46 (1 is 3rd base in codon) [Plasmodium
            falciparum]
            Length = 318

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.15, P = 0.14
 Identities = 35/162 (21%), Positives = 81/162 (50%), Frame = -2

Query:   487 EEPID-STKNNRNDNISN--KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             EE ++   + N  +N+    +NV +   +N+ +N   V  +  +++  +N  +N  E  +
Sbjct:   170 EENVEHDAEENVEENVEEVEENVEENVEENVEENVEEVEENVEENVE-ENVEENVEENVE 228

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQH-DNTMKSPVDKHMDHNNVPINEWPGDA 140
              +N+  NV  N   ++N +EY+EE     N++  +  ++  V+++++ N   + E   + 
Sbjct:   229 -ENVEENVEENV--EENVEEYDEE-----NVEEVEENVEENVEENVEEN---VEE---NV 274

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              E E  N+  N ++ N +    + +       +E N E +N+E ++
Sbjct:   275 EEVE-ENVEEN-VEENVEENVEENVEENVEEYDEENVEEHNEEYDE 318


>sp|P54673|P3K1_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 1 (PI3-KINASE)
            (PTDINS-3-KINASE) (PI3K) >gi|733520 (U23476)
            phosphatidylinositol-4,5-diphosphate 3-kinase [Dictyostelium
            discoideum]
            Length = 1570

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.15, P = 0.14
 Identities = 35/129 (27%), Positives = 61/129 (47%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNN-----IVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             +S KNN + N +  N++K +  + N NNN     I+G D   +   KNNNDN     +I 
Sbjct:    17 NSNKNNTHLNSNYNNIYKNNSTSSNNNNNHNNIEIIGIDNNKNNN-KNNNDNNNNNNNID 75

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH-NNVPINEWPGDAHE 134
                 +  N    + N+ E  E    +N+   + +  S    H+++ +++ I E     HE
Sbjct:    76 KKRKDSKNKQNQEINQ-EMSENKKIYNSNDSNCSSGSSSGGHVNNGHHILIEENERLEHE 134

Query:   133 -KELNNIFVNK 104
              +E+  I+  K
Sbjct:   135 NQEIQEIYKQK 145

 Score = 90 (31.7 bits), Expect = 1.9, P = 0.85
 Identities = 34/129 (26%), Positives = 57/129 (44%), Frame = -2

Query:   514 SNKGNTYVDEE--PIDSTKNNR---NDNISNKN-VHKKDIQNINQNNNIVGSDQXDDIFF 353
             SN  N + + E   ID+ KNN    NDN +N N + KK   + N+ N  +  +  ++   
Sbjct:    40 SNNNNNHNNIEIIGIDNNKNNNKNNNDNNNNNNNIDKKRKDSKNKQNQEINQEMSENKKI 99

Query:   352 KNNND-NFGEGQD----IQNIHHN-VYNNTPTDQNKKEYEE--ESSGFNNIQHDNTMKSP 197
              N+ND N   G      + N HH  +  N   +   +E +E  +  G    + D      
Sbjct:   100 YNSNDSNCSSGSSSGGHVNNGHHILIEENERLEHENQEIQEIYKQKGMEFQKKDLRFGYD 159

Query:   196 VDKHMDHNN 170
             V+ + ++NN
Sbjct:   160 VNSNNNNNN 168

 Score = 85 (29.9 bits), Expect = 7.4, P = 1.0
 Identities = 31/120 (25%), Positives = 53/120 (44%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             I+S+ N+ N+   NKN +K +  ++N N NNI  ++        NNN N  E   I N  
Sbjct:     4 IESSSNDSNE--INKNSNKNNT-HLNSNYNNIYKNNSTSSN--NNNNHNNIEIIGIDNNK 58

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELN 122
             +N  NN   + N    +++     N Q+    +   +    +N+   N   G +    +N
Sbjct:    59 NNNKNNNDNNNNNNNIDKKRKDSKNKQNQEINQEMSENKKIYNSNDSNCSSGSSSGGHVN 118

Query:   121 N 119
             N
Sbjct:   119 N 119


>gi|2331032 (AF012551) ornithine decarboxylase [Plasmodium falciparum]
            Length = 947

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.16, P = 0.14
 Identities = 45/147 (30%), Positives = 71/147 (48%), Frame = -2

Query:   448 NISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQ 269
             N + +   K+D   IN NN+   ++  +D    NNN+N   GQ   NI +++   +  D 
Sbjct:   682 NFAQQENKKQDETKINHNNDNNDNNDNNDNNINNNNNNQKGGQG--NIMNDLIITSTNDS 739

Query:   268 NKKEYEEESSGFNNIQHDNTMKSPVDKHMDH---NNVPINEWP---GDAHEKELNNIFV- 110
               K+Y+  S     IQ  N   +  DK +D+   N   IN  P   G  +  + +NI + 
Sbjct:   740 TSKKYDHSSRKV--IQ--NVSCTIRDKEVDNIKINTHTINN-PNINGKENTVDGDNINIA 794

Query:   109 NKIKNNNDAQSYKGINNKTIFLEE--N-NDERYN 17
             +K   NN + S   + N T   ++  N ND RYN
Sbjct:   795 HKNIGNNFSSSNSKLGNITNIKKKVVNINDNRYN 828

 Score = 82 (28.9 bits), Expect = 9.5, P = 1.0
 Identities = 35/133 (26%), Positives = 57/133 (42%), Frame = -2

Query:   475 DSTK-NNRNDNISNKNVHKKDIQNINQNNNIVGSDQX-DDIFFKNNNDNFGEGQDIQNIH 302
             D TK N+ NDN  N + +  +I N N NN   G     +D+   + ND+  +  D  +  
Sbjct:   692 DETKINHNNDNNDNNDNNDNNINN-NNNNQKGGQGNIMNDLIITSTNDSTSKKYDHSS-- 748

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNT--MKSPVDK---HMDHNNVPINEWPGDAH 137
               V  N       KE +      + I + N    ++ VD    ++ H N+  N    ++ 
Sbjct:   749 RKVIQNVSCTIRDKEVDNIKINTHTINNPNINGKENTVDGDNINIAHKNIGNNFSSSNSK 808

Query:   136 EKELNNIFVNKIKNNND 86
                + NI   K+ N ND
Sbjct:   809 LGNITNI-KKKVVNIND 824

 Score = 73 (25.7 bits), Expect = 0.24, Sum P(2) = 0.21
 Identities = 31/118 (26%), Positives = 47/118 (39%), Frame = -2

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESS----GFNNIQHDNTMKSPVD---KHMDHNNVP 164
             QD   I+HN  NN   D N       ++    G  NI +D  + S  D   K  DH++  
Sbjct:   691 QDETKINHNNDNNDNNDNNDNNINNNNNNQKGGQGNIMNDLIITSTNDSTSKKYDHSSRK 750

Query:   163 -INEWPGDAHEKELNNIFVNK--IKNNNDAQSYKGINNKTIFLEENN-DERYNQENEK 2
              I        +KE++NI +N   I N N       ++   I +   N    ++  N K
Sbjct:   751 VIQNVSCTIRDKEVDNIKINTHTINNPNINGKENTVDGDNINIAHKNIGNNFSSSNSK 808

 Score = 65 (22.9 bits), Expect = 0.24, Sum P(2) = 0.21
 Identities = 19/64 (29%), Positives = 32/64 (50%), Frame = -2

Query:   514 SNKGNTYV-DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +N GN  + D   +D   NN N+N  N NV     +N +  N     ++ +D+  +NN +
Sbjct:   276 NNHGNEKMKDYISVDENNNNNNNN-KNNNVLLTLQRNSDDENGKDKDNEKNDVSLENNME 334

Query:   337 -NFGE 326
              N+ E
Sbjct:   335 KNYKE 339


>pir||A45612 ATPase 6 - Sauroleishmania tarentolae >gi|340586 (M33229) ATPase 6
            [Leishmania tarentolae] >gi|340615 (L07543) MURF4 [Leishmania
            tarentolae]
            Length = 232

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.19, Sum P(2) = 0.17
 Identities = 30/99 (30%), Positives = 47/99 (47%), Frame = +2

Query:    80 LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIM-LYIIEAT*FFFI 256
             LC++  F  + + I  FL M  +   +    +M+ MF D  +  II  L+ I     +FI
Sbjct:   127 LCVLECFSLLCRCISTFLRMFCN--LLSSHFLML-MFCDFVYFFIIFFLFFIMCDFIYFI 183

Query:   257 FFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI 376
              F   +  CII Y+ +Y L +     + I IF   I+ LI
Sbjct:   184 IFTFAMLFCIIFYLFLYALDMFC-ALLQIFIFCNMIMQLI 222

 Score = 83 (29.2 bits), Expect = 1.0, P = 0.65
 Identities = 34/150 (22%), Positives = 68/150 (45%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIF-------YFINKYII*FLFMCISRPF-- 157
             ++ + I F I+F     F ++ F  L   I+F        F++ + + +L +C+   F  
Sbjct:    78 YLNVYILFCIVFMYYMAF-LFCFCFLLDFILFGSLLVGDAFMDVFFLRYL-LCVLECFSL 135

Query:   158 IYRDI-IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTK 334
             + R I   + MF +      +ML   +   +FFI FF+    C  IY +++   +L    
Sbjct:   136 LCRCISTFLRMFCNLLSSHFLMLMFCDFV-YFFIIFFLFFIMCDFIYFIIFTFAMLFCII 194

Query:   335 IVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFI 439
               + ++  D+   +    I I  N++  L M+  +
Sbjct:   195 FYLFLYALDMFCAL--LQIFIFCNMIMQLIMDFLL 227

 Score = 37 (13.0 bits), Expect = 0.19, Sum P(2) = 0.17
 Identities = 9/25 (36%), Positives = 13/25 (52%), Frame = +3

Query:    30 SLFSSKKMVLLFMPLYDCASLLFFI 104
             S++S    VL +   Y C  L+F I
Sbjct:    21 SVWSRIIFVLFYNVFYICTELMFCI 45


>pir||E64434 hypothetical protein MJ1078 - Methanococcus jannaschii >gi|1591726
            (U67550) M. jannaschii predicted coding region MJ1078
            [Methanococcus jannaschii]
            Length = 234

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.20, P = 0.18
 Identities = 29/115 (25%), Positives = 60/115 (52%), Frame = -3

Query:   486 RNQLIQPKIIEMTTLAI-KMFIKRIFKILTKIIILWDQIKXMISFLKIIMTILVKDKTYK 310
             R  L++ K  E  +L +  +FI+R+F ++  I +L+  I   +SF   I   ++    + 
Sbjct:    16 RGYLLKKKTNESISLGVGTVFIERVFDLVAMISLLF--ISAYLSFKSDIPKEILYSIKWG 73

Query:   309 IYIIMYIII----HLLIRIKKNMKKNQVASIIYNMIIL*KVLSTNIWIIIMSL*MNG 151
             + II+++II     L++  K N+K  ++ +I+ N     K +  N   ++++L   G
Sbjct:    74 VIIILFLIILIFGFLIVNSKINLKNKKLEAILMNFEKGLKAVKLNTLPLLITLSFTG 130


>gi|1519703 (U67923) pXi [Dictyostelium discoideum]
            Length = 325

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.22, Sum P(2) = 0.20
 Identities = 26/108 (24%), Positives = 49/108 (45%), Frame = -2

Query:   511 NKGNTYVDEE--PIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             N GN  ++ +  PI  +K++ + +  N  +    +   + NNNI            NNN+
Sbjct:    67 NNGNGTIERQFRPIHMSKDSDSGSYENLLLGTSPLVKNHNNNNI-----------NNNNN 115

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDK 188
             NF   ++    + N YN++          +ES+G  + + D + K  VD+
Sbjct:   116 NFCHSRNSSFGYGNSYNSSNGGSGCSSSSDESTG-GSFKKDKS-KYGVDR 163

 Score = 64 (22.5 bits), Expect = 0.22, Sum P(2) = 0.20
 Identities = 17/53 (32%), Positives = 29/53 (54%), Frame = -2

Query:   181 DHNNVPINEWPGDAHEKELNNIFVN-KIK-NNNDAQSYKGINNKTIFLEENND 29
             ++NN  I +   + +E E + I +N ++  NNN   +    NN T+ LE NN+
Sbjct:   272 NNNNNEILDKKSNENENENDKIKINLELNLNNNVNNNNNNNNNNTVILENNNN 324

 Score = 55 (19.4 bits), Expect = 2.3, Sum P(2) = 0.90
 Identities = 22/84 (26%), Positives = 38/84 (45%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN-------FGEGQDIQN 308
             ++N N N +N N++     +IN  N  +   Q   I    ++D+        G    ++N
Sbjct:    46 QHNNNINNNNNNINNGGSTSINNGNGTI-ERQFRPIHMSKDSDSGSYENLLLGTSPLVKN 104

Query:   307 IHHNVYNNTPTDQNKKEYEEESS-GFNN 227
              H+N  NN   + N   +   SS G+ N
Sbjct:   105 -HNN--NNINNNNNNFCHSRNSSFGYGN 129


>pir||S47661 topoisomerase II - Plasmodium falciparum
            Length = 160

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.22, P = 0.20
 Identities = 23/74 (31%), Positives = 40/74 (54%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             K+N NDN +NK   + D  N N NNN   ++Q +D    + ++   +G   +N ++N  N
Sbjct:    37 KDNSNDNKNNKG--QNDNNNNNNNNNDENANQNNDNLDVSLSNEPADGTPTKNNNNN-NN 93

Query:   286 NTPTDQNKKEYEEE 245
             N   D+  K +E++
Sbjct:    94 NNDEDEIVKIHEKQ 107

 Score = 84 (29.6 bits), Expect = 0.31, P = 0.27
 Identities = 24/74 (32%), Positives = 38/74 (51%), Frame = -2

Query:   496 YVD---EEPIDSTKNNRNDNISNKNVHKKDIQNINQNN-NI---VGSDQXDDIFFKNNND 338
             YVD   ++  +  KNN+  N +N N +  + +N NQNN N+   + ++  D    KNNN+
Sbjct:    31 YVDLYLKDNSNDNKNNKGQNDNNNNNNNNNDENANQNNDNLDVSLSNEPADGTPTKNNNN 90

Query:   337 NFGEGQD--IQNIH 302
             N     +  I  IH
Sbjct:    91 NNNNNDEDEIVKIH 104


>pir||C22845 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 - Trypanosoma
            brucei mitochondrion (SGC6)
            Length = 439

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.24, P = 0.21
 Identities = 40/172 (23%), Positives = 86/172 (50%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKN---GFVI-YAFI*LCI------IIIFYFINKYII*FLFM--CIS 148
             FI LI+  I I+   +   G  I Y ++ + +       + F  I  YI+ FL    C+S
Sbjct:    14 FILLIVTIIYIYINYSFCIGIEINYVYVNIYLNYISLWFVFFMGIIMYILIFLLSKKCVS 73

Query:   149 -RPFIYRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFF-FILISRCII-IYIMMYILYV 319
                + Y  I+MI+M++   + +++++ I++    F I F  +    C++ ++      ++
Sbjct:    74 YNKYFY--IVMIYMYI---YINVVLIIILDDFMCFMIAFESLFFPICLVSLFFNFNNRFI 128

Query:   320 LSFTKIVIIIFKKDIIXLI*SHNIIILVNILNI-LFMNIFIANVVISIIFG*INWFLIYI 496
              +   ++I      ++ +I    +I   NI+N+  F+++   + + S IF    W L++I
Sbjct:   129 FAIFYLIIFSSVSSVVCIIICIIVISHFNIINLQAFIDVCYFDSLYSAIF---IWILLFI 185

 Score = 81 (28.5 bits), Expect = 4.9, P = 0.99
 Identities = 28/94 (29%), Positives = 54/94 (57%), Frame = +2

Query:     5 FIFLI-IPFIIIFFQKNGFVIYAFI*LCIIII--FYFINKYII*---FLFMCIS-RPFIY 163
             F+F I  PF+++F+  + F++Y  I +  I I  FY I   I     +++MC+S   F++
Sbjct:   346 FLFNIDFPFMLLFYV-DIFILYGLISISFIYIISFYIITLTIFLSSIYIYMCLSFYSFVW 404

Query:   164 RDIIMIHMFVDRTFHSI-IMLYIIEAT*FFFIFFFILI 274
              D    ++ +D + + I + + I  +T  F+ F ++LI
Sbjct:   405 LDK---YLRLDVSINDIYVFMSISISTIVFYYFIYLLI 439


>pir||S49313 protein kinase - slime mold (Dictyostelium discoideum)
            >pir||S52076 protein kinase - slime mold (Dictyostelium discoideum)
            >gi|551446 (Z37981) protein kinase [Dictyostelium discoideum]
            Length = 1094

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.24, P = 0.21
 Identities = 36/165 (21%), Positives = 69/165 (41%), Frame = -2

Query:   496 YVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQD 317
             +  ++ I +T  N   N     ++   +Q  N NNNI   D  DD    ++ND+F     
Sbjct:   293 FEQQQKISTTNGNNKQNGGAPKINNLPLQYSNNNNNIYDDDDDDDDD-DDDNDSFPRPYS 351

Query:   316 IQNIHHNVYNNTPTDQNKKEYE-EESSGFNNIQHDNTMKSPVDK---HMDHNNVPINEWP 149
               N + NV   + ++ N      +E       Q    +K   D+     D +N+ +  + 
Sbjct:   352 -DNSNSNVTLESNSNYNSSTINGQEQQEQQEQQQQQQVKEERDEGEIEQDDDNIEV--YD 408

Query:   148 GDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
              D ++K+L       ++  N  Q+ +G  ++    E+  +E    E E+
Sbjct:   409 SD-YQKKLEEHQKELLERQN--QNQEGSTDENEVYEQEEEEEEEDEEEQ 454


>gnl|PID|e316518 (Y13097) STAT protein [Dictyostelium discoideum]
            Length = 707

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.25, P = 0.22
 Identities = 22/73 (30%), Positives = 39/73 (53%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N+  S++N +  +I NIN NNN   ++  ++     NN N   G +  N ++N  NN
Sbjct:   148 NNSNNTSSSQNYNNNNI-NINNNNNNNNTNNNNNNN-NGNNSNGNNGNNNNNNNNNNNNN 205

Query:   283 TPTDQNKKEYEEE 245
             T  + N  + +++
Sbjct:   206 TNNNNNNNQQQQQ 218

 Score = 89 (31.3 bits), Expect = 1.0, P = 0.64
 Identities = 25/89 (28%), Positives = 42/89 (47%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N NI+N N +  +  N N NNN  G++   +    NNN+N     +  N ++N  N 
Sbjct:   160 NNNNININNNN-NNNNTNNNNNNNN--GNNSNGNNGNNNNNNNNNNNNNTNNNNNN--NQ 214

Query:   283 TPTDQNKKEYEEESSGFNNIQHDN-TMKSP 197
                 Q +++ +++       Q  N  + SP
Sbjct:   215 QQQQQQQQQQQQQQQQQQQQQQGNPNLSSP 244

 Score = 85 (29.9 bits), Expect = 3.0, P = 0.95
 Identities = 22/73 (30%), Positives = 38/73 (52%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N NI+N N +  +  N N NNN  G++   +    NNN+N     +  N ++N  NN
Sbjct:   160 NNNNININNNN-NNNNTNNNNNNNN--GNNSNGNNGNNNNNNN---NNNNNNTNNNNNNN 213

Query:   283 TPTDQNKKEYEEE 245
                 Q +++ +++
Sbjct:   214 QQQQQQQQQQQQQ 226

 Score = 85 (29.9 bits), Expect = 3.0, P = 0.95
 Identities = 34/146 (23%), Positives = 61/146 (41%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             NN N NI+N N +     N N NN  N  G++  ++    NNN+N     +  N      
Sbjct:   160 NNNNININNNNNNNNTNNNNNNNNGNNSNGNNGNNNNNNNNNNNNNTNNNNNNNQQQQQQ 219

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFV 110
                   Q +++ +++  G  N+     +   + K +      + +     HE+ L    +
Sbjct:   220 QQQQQQQQQQQQQQQQQGNPNLSSPQPILDTIYKLLSEQEQTLVQM---IHEQSL---LL 273

Query:   109 NKIKNNNDAQSY---KGINNKTIFLE-ENNDE 26
             N++    D  S    K ++ K I L  + N E
Sbjct:   274 NRLPPTLDENSLAPLKSLSQKQITLSGQMNTE 305

 Score = 84 (29.6 bits), Expect = 4.0, P = 0.98
 Identities = 32/146 (21%), Positives = 58/146 (39%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNN--NIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             NN N NI+N N +     N N NN  N  G++  ++    NNN+N     +  N      
Sbjct:   160 NNNNININNNNNNNNTNNNNNNNNGNNSNGNNGNNNNNNNNNNNNNTNNNNNNNQQQQQQ 219

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFV 110
                   Q +++ +++  G  N+     +   + K +      + +     HE+ L    +
Sbjct:   220 QQQQQQQQQQQQQQQQQGNPNLSSPQPILDTIYKLLSEQEQTLVQM---IHEQSLLLNRL 276

Query:   109 NKIKNNNDAQSYKGINNKTIFLE-ENNDE 26
                 + N     K ++ K I L  + N E
Sbjct:   277 PPTLDENSLAPLKSLSQKQITLSGQMNTE 305


>gi|288590 (X68020) ARP gene product [Saccharomyces cerevisiae]
           Length = 719

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.26, P = 0.23
 Identities = 22/78 (28%), Positives = 35/78 (44%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N+N +N N++       N NNNI G+   +     N+N+N     +  N HHN   N+
Sbjct:   490 NNNNNNNNNNINNMTNNRYNINNNINGNGNGNG---NNSNNNNNHNNNHNNNHHNGSINS 546

Query:   280 PTDQNKKEYEEESSGFNN 227
              ++ N        +  NN
Sbjct:   547 NSNTNNNNNNNNGNNSNN 564

 Score = 82 (28.9 bits), Expect = 6.9, P = 1.0
 Identities = 23/74 (31%), Positives = 38/74 (51%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNN-NDNFGEGQ--DIQN 308
             ++  NN N+NI+N   ++ +I N IN N N  G++  ++    NN N+N   G      N
Sbjct:   490 NNNNNNNNNNINNMTNNRYNINNNINGNGNGNGNNSNNNNNHNNNHNNNHHNGSINSNSN 549

Query:   307 IHHNVYNNTPTDQN 266
              ++N  NN   + N
Sbjct:   550 TNNNNNNNNGNNSN 563


>gi|3413 (X16385) Baf1 protein (AA 1-731) [Saccharomyces cerevisiae]
         Length = 731

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.29, Sum P(2) = 0.25
 Identities = 22/95 (23%), Positives = 46/95 (48%), Frame = -2

Query:   418 DIQNINQNNNIVGSD-QXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEES 242
             D+Q  + +NN   +D +      ++N+ ++ + Q+I +   +       + NK +  +++
Sbjct:   441 DLQPSSSSNNNNNNDGELSGTNLRSNSIDYAKHQEISSAGTSSNTTKNVNNNKNDSNDDN 500

Query:   241 SGFNNIQHDNTMKSPVDKHMDHNNVP-----INEW 152
             +G NN    N M+S +DK   H   P     +N+W
Sbjct:   501 NGNNNNDASNLMESVLDKTSSHRYQPKKMPSVNKW 535

 Score = 45 (15.8 bits), Expect = 0.29, Sum P(2) = 0.25
 Identities = 11/34 (32%), Positives = 19/34 (55%), Frame = -2

Query:   478 IDSTKNNRND----NISNKNVHKKDIQNINQNNN 389
             +DS  NN++D    + +N N  + +  N + NNN
Sbjct:   254 VDSQSNNKHDGKDDDATNNNDGQDNNTNNDHNNN 287

 Score = 38 (13.4 bits), Expect = 1.4, Sum P(2) = 0.76
 Identities = 7/22 (31%), Positives = 13/22 (59%), Frame = -2

Query:   475 DSTKNN-RNDNISNKNVHKKDI 413
             D   NN  ND+ +N N++  ++
Sbjct:   274 DGQDNNTNNDHNNNSNINNNNV 295


>gnl|PID|e16326 (X15081) MURF2 protein (AA 1-348) [Crithidia fasciculata]
            Length = 347

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.30, P = 0.26
 Identities = 42/157 (26%), Positives = 69/157 (43%), Frame = +2

Query:    26 FIIIFFQKNGFVIYAFI*---LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMF-V 193
             FI+ +F  + F++Y F+    +CI  IF F+  +   FL +  S  F+   I+   +F +
Sbjct:    19 FILWWFDLD-FILYDFVFDFVVCITFIFVFVLGF---FLRIFFSFVFVLLFIVFFGLFSL 74

Query:   194 DRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXL 373
               TF    + YI     + FI FF       I+Y + +  YV  F     + F   +   
Sbjct:    75 ALTFTGYYIYYIYIL--YNFICFFFCFGLSYILYFIEFFTYVSFFLFFDFVSFSSHLTTF 132

Query:   374 I*-SHNI-IILVNILNILFMNIFIANVVISIIFG*INWFLIYI 496
                ++N  +I  + L  LF   FI   +   IF  I    + I
Sbjct:   133 FGLTNNFSVIFCSYLFCLFY--FIVCFLFCFIFFVIRCLFVII 173

 Score = 89 (31.3 bits), Expect = 0.39, P = 0.32
 Identities = 38/168 (22%), Positives = 73/168 (43%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFY---FINKYII*FLFMCISRPFIYRDII 175
             ++F +  FI+ F     F    F+  C+ +I Y   F N  +     MC     IY D I
Sbjct:   146 YLFCLFYFIVCFL----FCFIFFVIRCLFVIIYDFLFFNFDLYISFLMC---DLIYVDFI 198

Query:   176 ---MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYI-LYVLSFTKIVI 343
                +++      F S    +I      F + FF+L      I++   + L++  +T  + 
Sbjct:   199 CFLLLYFGFIFCFISGFFCFIFVLNYVFLLLFFVLALFFGFIFLSYGLALFLCCYTFWLF 258

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISF 508
             +I+ +    L+ S  I       N+ F+ +F+  + I   FG      +++++ F
Sbjct:   259 MIYTRSCYVLLPSVLIFFKFLYFNVFFIFVFLLILFIVCFFGFFLKDFLFLNLFF 313

 Score = 88 (31.0 bits), Expect = 0.51, P = 0.40
 Identities = 48/189 (25%), Positives = 82/189 (43%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQK-------NGFVIYAFI*LCIIIIFYFIN--KYII*FL-FMCISR 151
             FF F+ +   I+FF          G+ IY    L   I F+F     YI+ F+ F     
Sbjct:    56 FFSFVFVLLFIVFFGLFSLALTFTGYYIYYIYILYNFICFFFCFGLSYILYFIEFFTYVS 115

Query:   152 PFIYRDIIMI--HM--FVDRTFH-SIIMLYIIEAT*FF---FIFFFIL-ISRC--IIIYI 298
              F++ D +    H+  F   T + S+I    +    +F   F+F FI  + RC  +IIY 
Sbjct:   116 FFLFFDFVSFSSHLTTFFGLTNNFSVIFCSYLFCLFYFIVCFLFCFIFFVIRCLFVIIYD 175

Query:   299 MMYILYVLSFTKIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*IN 478
              ++  + L  + ++  +   D I  +  +   I   I    F  IF+ N V  ++F  + 
Sbjct:   176 FLFFNFDLYISFLMCDLIYVDFICFLLLYFGFIFCFISGF-FCFIFVLNYVFLLLFFVLA 234

Query:   479 WFLIYISISF 508
              F  +I +S+
Sbjct:   235 LFFGFIFLSY 244

 Score = 85 (29.9 bits), Expect = 1.2, P = 0.69
 Identities = 47/184 (25%), Positives = 80/184 (43%), Frame = +2

Query:     5 FIFLIIPFIIIF---FQKNGFVIYAFI*LCIIIIFYFIN--KYII*FL-FMCISRPFIYR 166
             F+ L I F  +F       G+ IY    L   I F+F     YI+ F+ F      F++ 
Sbjct:    61 FVLLFIVFFGLFSLALTFTGYYIYYIYILYNFICFFFCFGLSYILYFIEFFTYVSFFLFF 120

Query:   167 DIIMI--HM--FVDRTFH-SIIMLYIIEAT*FF---FIFFFIL-ISRC--IIIYIMMYIL 313
             D +    H+  F   T + S+I    +    +F   F+F FI  + RC  +IIY  ++  
Sbjct:   121 DFVSFSSHLTTFFGLTNNFSVIFCSYLFCLFYFIVCFLFCFIFFVIRCLFVIIYDFLFFN 180

Query:   314 YVLSFTKIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIY 493
             + L  + ++  +   D I  +  +   I   I    F  IF+ N V  ++F  +  F  +
Sbjct:   181 FDLYISFLMCDLIYVDFICFLLLYFGFIFCFISGF-FCFIFVLNYVFLLLFFVLALFFGF 239

Query:   494 ISISF 508
             I +S+
Sbjct:   240 IFLSY 244

 Score = 83 (29.2 bits), Expect = 2.0, P = 0.87
 Identities = 37/154 (24%), Positives = 68/154 (44%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFY---FINKYII*FLFMCISRPFIYRDII 175
             ++F +  FI+ F     F    F+  C+ +I Y   F N  +     MC     IY D I
Sbjct:   146 YLFCLFYFIVCFL----FCFIFFVIRCLFVIIYDFLFFNFDLYISFLMC---DLIYVDFI 198

Query:   176 ---MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYI-LYVLSFTKIVI 343
                +++      F S    +I      F + FF+L      I++   + L++  +T  + 
Sbjct:   199 CFLLLYFGFIFCFISGFFCFIFVLNYVFLLLFFVLALFFGFIFLSYGLALFLCCYTFWLF 258

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIF 466
             +I+ +    L+ S    +L+     L+ N+F   V + I+F
Sbjct:   259 MIYTRSCYVLLPS----VLI-FFKFLYFNVFFIFVFLLILF 294

 Score = 79 (27.8 bits), Expect = 6.0, P = 1.0
 Identities = 22/110 (20%), Positives = 48/110 (43%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRP-FIYRDIIM 178
             F  FL++ F  IF   +GF  + F+   + ++ +F+      F+F+      F+      
Sbjct:   197 FICFLLLYFGFIFCFISGFFCFIFVLNYVFLLLFFVLALFFGFIFLSYGLALFLCCYTFW 256

Query:   179 IHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSF 328
             + M   R+ + ++   +I     +F  FFI +   I+  +  +  ++  F
Sbjct:   257 LFMIYTRSCYVLLPSVLIFFKFLYFNVFFIFVFLLILFIVCFFGFFLKDF 306

 Score = 79 (27.8 bits), Expect = 6.0, P = 1.0
 Identities = 34/133 (25%), Positives = 58/133 (43%), Frame = +2

Query:    26 FIIIFFQKNGFVIYAFI*---LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMF-V 193
             FI+ +F  + F++Y F+    +CI  IF F+  +   FL +  S  F+   I+   +F +
Sbjct:    19 FILWWFDLD-FILYDFVFDFVVCITFIFVFVLGF---FLRIFFSFVFVLLFIVFFGLFSL 74

Query:   194 DRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXL 373
               TF    + YI     + FI FF       I+Y + +  YV  F     + F   +   
Sbjct:    75 ALTFTGYYIYYIYIL--YNFICFFFCFGLSYILYFIEFFTYVSFFLFFDFVSFSSHLTTF 132

Query:   374 I*SHNIIILVNILNILF 424
                     L N  +++F
Sbjct:   133 FG------LTNNFSVIF 143


>gi|343539 (M14820) NADH dehydrogenase subunit 4 [Trypanosoma brucei]
           Length = 437

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.31, P = 0.27
 Identities = 40/172 (23%), Positives = 86/172 (50%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKN---GFVI-YAFI*LCI------IIIFYFINKYII*FLFM--CIS 148
             FI LI+  I I+   +   G  I Y ++ + +       + F  I  YI+ FL    C+S
Sbjct:    11 FILLIVTIIYIYINYSFCIGIEINYVYVNIYLNYISLWFVFFMGIIMYILIFLLSKKCVS 70

Query:   149 -RPFIYRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFF-FILISRCII-IYIMMYILYV 319
                + Y  I+MI+M++   + +++++ I++    F I F  +    C++ ++      ++
Sbjct:    71 YNKYFY--IVMIYMYI---YINVVLIIILDDFMCFMIAFESLFFPICLLSLFFNFNNRFI 125

Query:   320 LSFTKIVIIIFKKDIIXLI*SHNIIILVNILNI-LFMNIFIANVVISIIFG*INWFLIYI 496
              +   ++I      ++ +I    +I   NI+N+  F+++   + + S IF    W L++I
Sbjct:   126 FAIFYLIIFSSVSSVVCIIICIIVISHFNIINLQAFIHVCYFDSLYSAIF---IWILLFI 182

 Score = 81 (28.5 bits), Expect = 4.9, P = 0.99
 Identities = 28/94 (29%), Positives = 54/94 (57%), Frame = +2

Query:     5 FIFLI-IPFIIIFFQKNGFVIYAFI*LCIIII--FYFINKYII*---FLFMCIS-RPFIY 163
             F+F I  PF+++F+  + F++Y  I +  I I  FY I   I     +++MC+S   F++
Sbjct:   344 FLFNIDFPFMLLFYV-DIFILYGLISISFIYIISFYIITLTIFLSSIYIYMCLSFYSFVW 402

Query:   164 RDIIMIHMFVDRTFHSI-IMLYIIEAT*FFFIFFFILI 274
              D    ++ +D + + I + + I  +T  F+ F ++LI
Sbjct:   403 LDK---YLRLDVSINDIYVFMSISISTIVFYYFIYLLI 437

 Score = 79 (27.8 bits), Expect = 8.3, P = 1.0
 Identities = 32/140 (22%), Positives = 69/140 (49%), Frame = +2

Query:    47 KNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLY 226
             K   +   FI L + II+ +IN     + F CI     Y   + ++++++  + S+  ++
Sbjct:     3 KLNLICINFILLIVTIIYIYIN-----YSF-CIGIEINY---VYVNIYLN--YISLWFVF 51

Query:   227 IIEAT*FFFIFFFILISRCIII--YIMMYILYVLSFTKIVIIIFKKDII-XLI*SHNIII 397
              +      +I  F+L  +C+    Y  + ++Y+  +  +V+II   D +  +I   ++  
Sbjct:    52 FMGI--IMYILIFLLSKKCVSYNKYFYIVMIYMYIYINVVLIIILDDFMCFMIAFESLFF 109

Query:   398 LVNILNILFM--NIFIANVVISIIF 466
              + +L++ F   N FI  +   IIF
Sbjct:   110 PICLLSLFFNFNNRFIFAIFYLIIF 134


>gi|1658333 (U40232) exported serine/threonine protein kinase [Plasmodium
            falciparum]
            Length = 2510

  Minus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.35, P = 0.29
 Identities = 41/157 (26%), Positives = 72/157 (45%), Frame = -2

Query:   466 KNNRNDNISNKNVHK-KDIQNINQNNNIVGSDQXD--DIFFKNN---NDNFGEGQDIQNI 305
             K+  N N+ NK ++K   I N N+N N +  ++    DI   +    ND   E  ++ NI
Sbjct:   982 KHRINKNMHNKQINKMSQINNRNRNMNNMDEEKKSSTDICDHSREMENDENEENVELDNI 1041

Query:   304 H--HNVYN--NTPTDQN-KKEYEEESSGFNNIQHD-NTMKSPVDKHMDHNNVPINEWPGD 143
                + + N  N   D+N K + ++     N I ++ N  K    K  D  N   ++   +
Sbjct:  1042 KELNGIINKENIENDENIKPDMKKNKEKVNVITNERNKRKREKTKCTDEKN---DQGKDN 1098

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
              HE  +      K++ +++       NNK  + + NNDE+ N
Sbjct:  1099 THEHMVEKKV--KLEEDSEEMERNTNNNKINYDKNNNDEKNN 1138

 Score = 96 (33.8 bits), Expect = 0.60, P = 0.45
 Identities = 38/146 (26%), Positives = 67/146 (45%), Frame = -2

Query:   439 NKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKK 260
             NKN+H K I  ++Q NN   +    D   K++ D     ++++N  +    N   D N K
Sbjct:   986 NKNMHNKQINKMSQINNRNRNMNNMDEEKKSSTDICDHSREMENDENE--ENVELD-NIK 1042

Query:   259 EYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQ 80
             E     +   NI++D  +K  + K+ +  NV  NE   +  ++E       K     D  
Sbjct:  1043 ELNGIINK-ENIENDENIKPDMKKNKEKVNVITNE--RNKRKREKTKCTDEKNDQGKD-N 1098

Query:    79 SYKGINNKTIFLEENNDE-RYNQENEK 2
             +++ +  K + LEE+++E   N  N K
Sbjct:  1099 THEHMVEKKVKLEEDSEEMERNTNNNK 1125

 Score = 95 (33.4 bits), Expect = 0.80, P = 0.55
 Identities = 37/154 (24%), Positives = 71/154 (46%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDD-IFFKN--------NNDNFGEGQDIQ 311
             NNRN N++N +  KK   +I  ++  + +D+ ++ +   N        N +N    ++I+
Sbjct:  1001 NNRNRNMNNMDEEKKSSTDICDHSREMENDENEENVELDNIKELNGIINKENIENDENIK 1060

Query:   310 -NIHHNVYN-NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
              ++  N    N  T++  K   E++   +  ++D   K    +HM    V + E   +  
Sbjct:  1061 PDMKKNKEKVNVITNERNKRKREKTKCTDE-KNDQG-KDNTHEHMVEKKVKLEE-DSEEM 1117

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDE 26
             E+  NN  +N  KNNND ++         + E+N  E
Sbjct:  1118 ERNTNNNKINYDKNNNDEKNNNTDCTNCTYCEDNIKE 1154

 Score = 91 (32.0 bits), Expect = 2.4, P = 0.91
 Identities = 49/157 (31%), Positives = 75/157 (47%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF--GEGQDIQNIH 302
             DS +  RN N +  N  K +    N N +       +D   K NN  F  G  ++I N  
Sbjct:  1113 DSEEMERNTNNNKINYDKNNNDEKNNNTDCTNCTYCEDNI-KENNIIFLNGNVENIDNDK 1171

Query:   301 HNVYNNT---PTDQN-KKEYEEESSGFNN---------IQHDNTMKSPVDKHMDHNNVPI 161
             + + + T     D N KK+  E+ +  NN         I  D  MK+ V+  + HN+V I
Sbjct:  1172 NKLVSETVECTNDINEKKKIGEQIACTNNDKMLYSVNVINDDFNMKNVVE-FLSHNDVAI 1230

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLE--ENNDERYN 17
                     +KELN  ++N I+N    + Y   N KT+ ++  +N D  YN
Sbjct:  1231 --------KKELN--YLN-IENKIHEREYILDNKKTLHIDNKKNKDIYYN 1269

 Score = 89 (31.3 bits), Expect = 4.1, P = 0.98
 Identities = 35/124 (28%), Positives = 66/124 (53%), Frame = -2

Query:   457 RNDNIS-NKNVHKK----DIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +N+ I  N ++HKK    + +N N NNN +  D   +I+ K+  ++     D  N ++N+
Sbjct:  1977 QNERIKHNVHMHKKIDTNESKNKN-NNNEINRDNAYNIYNKHKKNH----ADNNNNNNNI 2031

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV-PINEWPGDAHEKELNNI 116
               +T TD+  KE   +  G  +++  N  K+P +  M  NN+   +   G    K  N I
Sbjct:  2032 IISTNTDETNKE---DKKG--HVKSCNK-KTPHNSDMCPNNIRSSSNTVGMVFNK--NKI 2083

Query:   115 FVNKIKNNND 86
             ++N +K +++
Sbjct:  2084 YLNSLKKDDE 2093

 Score = 89 (31.3 bits), Expect = 4.1, P = 0.98
 Identities = 35/166 (21%), Positives = 81/166 (48%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKN-NNDNFGEGQDI--QN 308
             I + K+    +  +KN++ KD++  N   N +   + ++I  +N   +N  E ++I  +N
Sbjct:   869 IKNKKHEEGKDKEDKNLNDKDMEKTNVEENDI---EEENITEENITEENVTE-ENITEEN 924

Query:   307 I-HHNVYNNTPTDQN-KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
             +   N+     T++N  +E E+++S   N++  N + S   +          +   + H 
Sbjct:   925 VTEENITEENITEENVTEENEDKNSDDKNVEERNCLASAHGRRFIQTRSRYKQLYNEKHR 984

Query:   133 --KELNNIFVNKIKN-NNDAQSYKGINNK---TIFLEENNDERYNQENEK 2
               K ++N  +NK+   NN  ++   ++ +   +  + +++ E  N ENE+
Sbjct:   985 INKNMHNKQINKMSQINNRNRNMNNMDEEKKSSTDICDHSREMENDENEE 1034

 Score = 86 (30.3 bits), Expect = 9.3, P = 1.0
 Identities = 40/169 (23%), Positives = 68/169 (40%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXD-DIFFKNNNDNFGEGQDI 314
             ++E I    N +  N  N +  +K    I    +  G D+ D ++  K+      E  DI
Sbjct:   841 EQENILDCANKKVFNNKNGSSRRKRNNEIKNKKHEEGKDKEDKNLNDKDMEKTNVEENDI 900

Query:   313 Q--NI-HHNVYNNTPTDQN--KKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             +  NI   N+     T++N  ++   EE+    NI  +N  +   DK+ D  NV      
Sbjct:   901 EEENITEENITEENVTEENITEENVTEENITEENITEENVTEENEDKNSDDKNVEERNCL 960

Query:   148 GDAHEKE-LNNIFVNKIKNNNDAQSYKGINNKTIF-LEENNDERYNQEN 8
               AH +  +      K   N   +  K ++NK I  + + N+   N  N
Sbjct:   961 ASAHGRRFIQTRSRYKQLYNEKHRINKNMHNKQINKMSQINNRNRNMNN 1009

 Score = 86 (30.3 bits), Expect = 9.3, P = 1.0
 Identities = 44/173 (25%), Positives = 86/173 (49%), Frame = -2

Query:   499 TYVDEEPIDSTKNNRNDNISNKNVHKKDI--QNINQNN----NIVGSDQXDDIFFKNNND 338
             T V+E  I+  +N   +NI+ +NV +++I  +N+ + N    NI   +  ++   KN++D
Sbjct:   893 TNVEENDIEE-ENITEENITEENVTEENITEENVTEENITEENITEENVTEENEDKNSDD 951

Query:   337 -NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHD---NTMKSPVDKHMDHNN 170
              N  E   + + H   +  T + + K+ Y E+    N   H+   N M    +++ + NN
Sbjct:   952 KNVEERNCLASAHGRRFIQTRS-RYKQLYNEKHR-INKNMHNKQINKMSQINNRNRNMNN 1009

Query:   169 VPINEWPG-DA--HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEEN--NDERYNQENE 5
             +   +    D   H +E+ N   ++ + N +  + K +N   I  +EN  NDE    + +
Sbjct:  1010 MDEEKKSSTDICDHSREMEN---DENEENVELDNIKELNG--IINKENIENDENIKPDMK 1064

Query:     4 K 2
             K
Sbjct:  1065 K 1065


>gi|887563 (Z22868) serine/threonine-protein kinase [Plasmodium falciparum]
           Length = 765

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.37, P = 0.31
 Identities = 42/154 (27%), Positives = 74/154 (48%), Frame = -2

Query:   475 DSTKNNRNDNISNK--NVHK---KDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             +  K N N+   +K  N HK   K  +N+    N+    +  ++F KN+N          
Sbjct:   194 ERNKYNINEKGMSKIFNTHKIGKKMCKNVCSKKNLCNIQK--NVFIKNDN-----AIKYN 246

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTM-KSPVDKHMDHNNVPINEWPGDAHE 134
             NI++N+YNNT      K+ +E+++G   I+   TM  +P+ K    + +    +    + 
Sbjct:   247 NIYNNIYNNT------KDKKEKNNG-ELIKSKTTMLNTPIRKCKIRHIIVSASFINKKNI 299

Query:   133 KELNNIFVN---KIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
             KELN I +N   K K NN   +   +  + I L + +   Y +
Sbjct:   300 KELNKIMLNNKHKSKLNNKENNIINVK-ENIHLNDLSSNIYEE 341


>pir||A54813 cAMP receptor CAR4 - slime mold (Dictyostelium discoideum)
            >bbs|158200 CAR4=cell-surface G protein-linked cAMP receptor
            [Dictyostelium discoideum=slime mold, NC-4, Peptide, 443 aa]
            Length = 443

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.43, P = 0.35
 Identities = 42/158 (26%), Positives = 73/158 (46%), Frame = -2

Query:   478 IDSTKNNRNDN-ISNKNV----HKKDIQNIN---QNNNIVGSDQXDDIFFKNNNDNFGEG 323
             +D  KNN N + I N       H   I++++    NN+I   +Q      +       + 
Sbjct:   290 LDRNKNNNNPSPILNSYAATVYHSSTIESLSLQHHNNDISNDNQQQQQQQQTPQQPQQQF 349

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
             Q  Q+       N   DQN +  E+  + +N I  D  ++   +K ++ N+  I +   D
Sbjct:   350 QQQQSPTVIEMQNLKQDQNIENNEQNENCYNTI--DTNIEIITNK-LNDNSFEITQPSND 406

Query:   142 AHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              +  E NN + N   NNN+       NN ++ +EE  DER  ++N+
Sbjct:   407 LNTIENNNNYNNN--NNNN-------NNNSLVIEEK-DEREKKDNK 442


>pir||C30010 hypothetical ORF-6 protein - Sauroleishmania tarentolae
            mitochondrion (SGC6)
            Length = 245

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.50, P = 0.39
 Identities = 27/125 (21%), Positives = 55/125 (44%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISR-PFIYRDIIM 178
             +  FL+I F  IF    GF  + F+   + ++ +F+      FLF+      F+      
Sbjct:    95 YICFLLIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFW 154

Query:   179 IHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKK 358
             +++   R+   ++   +I     +F  FFI +   +I++I+ +  + L     + I F  
Sbjct:   155 LYIIYSRSCFILLQSVVIFFKFLYFDVFFIFVF-LLILFIICFFGFFLKDFLFLNIFFDM 213

Query:   359 DIIXLI 376
               + LI
Sbjct:   214 FSVLLI 219

 Score = 84 (29.6 bits), Expect = 0.88, P = 0.58
 Identities = 38/168 (22%), Positives = 76/168 (45%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFY---FINKYII*FLFMCISRPFIYRDII 175
             ++F +  FII F     F    F+  C+ +I Y   F N  I     MC     IY D I
Sbjct:    44 YLFCLFYFIICFI----FCFIFFVIRCLFVIIYDFLFFNFDIYISFLMC---DIIYIDYI 96

Query:   176 ---MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYIL-YVLSFTKIVI 343
                +I+     +F +    +I      F + FF+L      +++   +  +++ +   + 
Sbjct:    97 CFLLIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLY 156

Query:   344 IIFKKDIIXLI*SHNIIILVNIL--NILFMNIFIANVVISIIFG*INWFLIYISISF 508
             II+ +    L+   +++I    L  ++ F+ +F+  + I   FG      ++++I F
Sbjct:   157 IIYSRSCFILL--QSVVIFFKFLYFDVFFIFVFLLILFIICFFGFFLKDFLFLNIFF 211

 Score = 81 (28.5 bits), Expect = 2.0, P = 0.87
 Identities = 27/128 (21%), Positives = 55/128 (42%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISR-PFIYRDIIM 178
             +  FL+I F  IF    GF  + F+   + ++ +F+      FLF+      F+      
Sbjct:    95 YICFLLIYFGFIFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFW 154

Query:   179 IHMFVDRT----FHSIIMLYIIEAT*FFFIFFFILISR--CIIIYIMMYILYVLSFTKIV 340
             +++   R+      S+++ +       FFIF F+LI    C   + +   L++  F  + 
Sbjct:   155 LYIIYSRSCFILLQSVVIFFKFLYFDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMF 214

Query:   341 IIIFKKDI 364
              ++   D+
Sbjct:   215 SVLLIYDV 222

 Score = 80 (28.2 bits), Expect = 0.72, Sum P(2) = 0.51
 Identities = 32/106 (30%), Positives = 48/106 (45%), Frame = +2

Query:    11 FLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYR-DIIMIHM 187
             F II    + F    F ++ FI +C I  F F   ++I  LF+ I     +  DI +  +
Sbjct:    31 FGIINMFNVIFCSYLFCLFYFI-ICFIFCFIF---FVIRCLFVIIYDFLFFNFDIYISFL 86

Query:   188 FVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSF 328
               D  +   I   +I    F FIF FI    C I +++ Y+  VL F
Sbjct:    87 MCDIIYIDYICFLLIY---FGFIFSFITGFFCFI-FVLNYVFLVLFF 129

 Score = 37 (13.0 bits), Expect = 0.72, Sum P(2) = 0.51
 Identities = 11/28 (39%), Positives = 16/28 (57%), Frame = +3

Query:   387 ILLFWLIF*ISFL*TFLLLMLSFLLFLV 470
             ++LF + F   FL  FL L + F +F V
Sbjct:   189 LILFIICFFGFFLKDFLFLNIFFDMFSV 216


>pir||S36953 cytochrome-c oxidase (EC 1.9.3.1) chain III - Herpetomonas
            samuelpessoai mitochondrion (SGC6)
            Length = 288

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.51, P = 0.40
 Identities = 37/169 (21%), Positives = 75/169 (44%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKN---GFVI-----YAFI*LCIIIIFYFINKYII*FLFMCISRPFI 160
             F+FL +P ++I +      GF+I     + F+ +C +  F     + I  LF  +   F+
Sbjct:    15 FVFLSLPAVVICYYVVCLCGFMICCFGSFLFVDMCFVF-FLVCLLFCILLLFCDVFVDFL 73

Query:   161 YRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIV 340
              R I     F+ R      + ++I     F  FF ++   CI +      ++VL      
Sbjct:    74 -RGIFDFLTFI-RCLQYCFIWFVISELVLFLTFFTVVFGYCIFLCCEFAFVFVLPMLFCC 131

Query:   341 IIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
             +++    +         I L N+L   F+ +F++ +  + +F  + WF  ++   F+
Sbjct:   132 LLVDYGFVFYWF----FIDLFNLLINTFL-LFVSGLFCNFLFFCV-WFRFFVVCVFV 182


>gi|2258300 (AF001783) AgrC [Staphylococcus aureus]
            Length = 425

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.53, P = 0.41
 Identities = 35/150 (23%), Positives = 72/150 (48%), Frame = +2

Query:    65 YAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYIIEAT* 244
             Y    +  + + +FI+ +I    +      +I   ++    F D+   SI  L +I    
Sbjct:     9 YVLFVIVQVSLMFFISAFISGIRYKKSDYIYIIGIVLSSVYFFDK-IRSI-SLVVITIFI 66

Query:   245 FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI*SHNIIILVNILNILF 424
               F++F I +    ++ +   ILY  +F  + IIIF   II +  SH++ I++ I  +++
Sbjct:    67 IIFLYFKIRLYSVFLVMVTQIILYCANF--VYIIIFSY-IITI--SHSVFIVLPIFLVVY 121

Query:   425 MNIFIANV-VISIIFG*INWFLIYISISFIT 514
             ++I  A   +++ I   IN   + ++  F+T
Sbjct:   122 VSISYALAYILNRILKRINGTYLSLNKKFLT 152

 Score = 79 (27.8 bits), Expect = 8.0, P = 1.0
 Identities = 26/104 (25%), Positives = 52/104 (50%), Frame = +2

Query:   203 FHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI*S 382
             F  I  + ++  T F  IF +  I R   ++++M    +L     V II    II +  S
Sbjct:    51 FDKIRSISLVVITIFIIIFLYFKI-RLYSVFLVMVTQIILYCANFVYIIIFSYIITI--S 107

Query:   383 HNIIILVNILNILFMNIFIANV-VISIIFG*INWFLIYISISFIT 514
             H++ I++ I  +++++I  A   +++ I   IN   + ++  F+T
Sbjct:   108 HSVFIVLPIFLVVYVSISYALAYILNRILKRINGTYLSLNKKFLT 152


>sp|P40002|YEA7_YEAST HYPOTHETICAL 72.5 KD PROTEIN IN GCN4-WBP1 INTERGENIC
            REGION >pir||S50452 hypothetical protein YEL007w - yeast
            (Saccharomyces cerevisiae) >gi|602374 (U18530) Yel007wp
            [Saccharomyces cerevisiae]
            Length = 666

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.54, P = 0.42
 Identities = 39/163 (23%), Positives = 67/163 (41%), Frame = -2

Query:   505 GNTYVDEEPIDSTKN-NRNDNISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNF 332
             GNT +     +ST   N  +NI+NK+     +   I+ NNN    +      F + N N+
Sbjct:   225 GNTTLGNVKNNSTTTGNGPNNINNKSNSSTPLNTVISTNNNSANINAAGSNQFTSANKNY 284

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEW 152
                 D ++  + +    P   +       +  +     DNT  + ++ H+++NN   N  
Sbjct:   285 YYKND-ESSGYPITQFAPALPSTTLMYTANPPYITQSPDNTNATGMNTHVNNNNNNSNNS 343

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGINN-KTIFLEENNDERYN 17
                 +    NN   N   NNN+  +   INN  T     NN  R++
Sbjct:   344 SNSNNSNNNNNN--NNNNNNNNNNNINNINNVNTNAGNGNNPNRFH 387

 Score = 83 (29.2 bits), Expect = 4.8, P = 0.99
 Identities = 25/83 (30%), Positives = 39/83 (46%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNN-NDNFGEGQDIQNIHHN 296
             +T  N N+N SN + +  +  N N NNN   ++  ++I   NN N N G G +    H+ 
Sbjct:   330 NTHVNNNNNNSNNSSNSNNSNNNNNNNNNNNNNNNNNINNINNVNTNAGNGNNPNRFHNA 389

Query:   295 --VYNNTPTDQNKKEYEEESSGF 233
                YN T    N ++  + S  F
Sbjct:   390 SFAYNTTGDFINPQQQGQISYPF 412


>sp|P34787|TBG_PLAFO TUBULIN GAMMA CHAIN >gi|396806 (X62393) gamma-tubulin
            [Plasmodium falciparum]
            Length = 452

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.56, Sum P(2) = 0.43
 Identities = 17/64 (26%), Positives = 34/64 (53%), Frame = -2

Query:   433 NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEY 254
             N H  D + I +NNN +  D+ D  F++ ++++F  G  + ++   V N+  T + +  Y
Sbjct:    27 NEHNIDQEGILKNNNFLNEDRKDIFFYQADDEHFIPGALLFDLEPRVINSIQTSEYRNLY 86

Query:   253 EEES 242
               E+
Sbjct:    87 NPEN 90

 Score = 42 (14.8 bits), Expect = 0.56, Sum P(2) = 0.43
 Identities = 8/13 (61%), Positives = 10/13 (76%), Frame = -2

Query:   127 LNNIFVNKIKNNN 89
             LN IFV ++K NN
Sbjct:   211 LNRIFVERLKLNN 223


>prf||1411304A thrombospondin related protein TRAP [Plasmodium falciparum]
            Length = 559

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.58, P = 0.44
 Identities = 40/165 (24%), Positives = 67/165 (40%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNVHKKDIQNINQN---NNIVGSDQXDDIFFKNNNDNFGEG 323
             V +EP D     R DN S +   +  I N  Q    N   G D+  + F  + N      
Sbjct:   295 VPDEPEDDQPRPRGDNSSVQKPEENIIDNNPQEPSPNPEEGKDENPNGFDLDENPENPPN 354

Query:   322 QDIQ----NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
              DI     NI  +     P+D  K   ++    F+        K P +KH + NN+P ++
Sbjct:   355 PDIPEQKPNIPEDSEKEVPSDVPKNPEDDREENFD------IPKKPENKHDNQNNLPNDK 408

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDER-YNQENE 5
                +     L    ++  +  +D QS     N+ +   E+ + R + + NE
Sbjct:   409 SDRNIPYSPLPPKVLDNERKQSDPQSQDNNGNRHVPNSEDRETRPHGRNNE 459


>gnl|PID|e220208 (X95276) ORF78 [Plasmodium falciparum]
            Length = 78

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.60, P = 0.45
 Identities = 20/52 (38%), Positives = 31/52 (59%), Frame = -3

Query:   453 MTTLAI-KMFIKRIFKILTKIIILWDQIKXMISFLKIIMTILVKDKTYKIYII 298
             M  + I K FIK+IFKI+    I++ ++   I ++ I++ ILV  K Y   II
Sbjct:     1 MKNITINKFFIKKIFKIIKYFNIIYYRLFIWI-YIIILLFILVNKKKYYNTII 52

 Score = 59 (20.8 bits), Expect = 4.8, P = 0.99
 Identities = 18/49 (36%), Positives = 28/49 (57%), Frame = -3

Query:   315 YKIYIIMYIIIHLLIRIKKNMKKNQVASIIYNMIIL*KVLSTNIWIIIM 169
             Y+++I +YIII L I + K    N   +IIYN     K L   ++II++
Sbjct:    26 YRLFIWIYIIILLFILVNKKKYYN---TIIYNKY---KYLLNFLFIILL 68


>pir||S51911 cryptogene protein G5(ND3) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 89

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.60, P = 0.45
 Identities = 23/87 (26%), Positives = 41/87 (47%), Frame = +2

Query:    50 NGFVIYAFI*LCIIIIFYFINKY----II*FLFMCISRPFIYRDIIMIHMFVDRTFHSII 217
             N   +Y  I LC  ++  F+  Y    +I FL + +   F+ +   +   FV   F SI+
Sbjct:     2 NSRFVYVSIDLCFAVLLCFVMFYSIIGLILFLIVVVLY-FMCKLFFVWFCFVFLLFWSIV 60

Query:   218 MLYIIEAT*FFFIFFFILISRCIIIYIMM 304
                I     F FIFF +++   +  Y+++
Sbjct:    61 F-NIWFCVLFVFIFFLLILINSVFSYLIL 88


>gi|9872 (X65738) ATPase I [Plasmodium falciparum]
         Length = 1956

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.61, P = 0.46
 Identities = 46/153 (30%), Positives = 71/153 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNIN-------QNNNIVGSDQXDDIFFKN 347
             NTY D       KNN+ D N +N N  KK I N+N        +N+++  D+     F++
Sbjct:   231 NTYDDVH----MKNNKMDYNNNNNNKKKKKINNLNFVKGTYINSNDLLYDDKIGVNIFED 286

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             + +N     + +NI  N YN    D N  EY  +     +              + ++N 
Sbjct:   287 DVNNMKHKFNQRNI--NYYNK---DTNNLEYNNKHRYIYDCLLKKVEAISQKNKIIYSNE 341

Query:   166 PINEWP--GDAHEKELNNIFVNKIK-NNNDAQSYKGINNKTIFL 44
              IN++   G  +   L NI  NKIK NN +     G+  KT F+
Sbjct:   342 DINKYMLYGGTYVLSLYNI--NKIKYNNKEENRILGLVIKTGFI 383

 Score = 93 (32.7 bits), Expect = 1.0, P = 0.65
 Identities = 44/151 (29%), Positives = 67/151 (44%), Frame = -2

Query:   508 KGN--TYVDEE--PIDSTKNNRN---DNISNKNVHKKDIQNIN-QNNNIVGSD-QXDDIF 356
             KG+  T +D E   I S  N+ N   DNI   N++  +I   N   +NI G +   D+I+
Sbjct:  1098 KGHDKTCIDNEFTSIQSQMNSDNICGDNICGDNIYGDNICGDNIYGDNINGDNINGDNIY 1157

Query:   355 FKN-NNDNFGEGQDIQNIHHNVYNNT------PTDQNKKEYEEESSGFNNIQHDNTMKSP 197
               N N DN   G +I N + N+Y +       PT+ +K  Y       NN  +    K  
Sbjct:  1158 GDNINGDNIN-GDNI-NTYDNIYGDNYNLDYCPTEYHKCTYNNSILYRNNFLYKKENKK- 1214

Query:   196 VDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNN 92
              DK+  + +        D    +L +I +NK   N
Sbjct:  1215 -DKNYKNISTLYEHRTNDIQFDKLCDILINKDPRN 1248

 Score = 89 (31.3 bits), Expect = 3.2, P = 0.96
 Identities = 47/153 (30%), Positives = 71/153 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNN-NDNF 332
             NTY D       KNN+ D N +N N  KK I N+N      + S+   D+ + +    N 
Sbjct:   231 NTYDDVH----MKNNKMDYNNNNNNKKKKKINNLNFVKGTYINSN---DLLYDDKIGVNI 283

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMK-----SPVDKHMDHNNV 167
              E  D+ N+ H          NK     E +  +   +D  +K     S  +K + ++N 
Sbjct:   284 FE-DDVNNMKHKFNQRNINYYNKDTNNLEYNNKHRYIYDCLLKKVEAISQKNKII-YSNE 341

Query:   166 PINEWP--GDAHEKELNNIFVNKIK-NNNDAQSYKGINNKTIFL 44
              IN++   G  +   L NI  NKIK NN +     G+  KT F+
Sbjct:   342 DINKYMLYGGTYVLSLYNI--NKIKYNNKEENRILGLVIKTGFI 383


>pir||A44396 P-type cation translocating ATPase - Plasmodium falciparum
            Length = 1984

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.62, P = 0.46
 Identities = 46/153 (30%), Positives = 71/153 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNIN-------QNNNIVGSDQXDDIFFKN 347
             NTY D       KNN+ D N +N N  KK I N+N        +N+++  D+     F++
Sbjct:   259 NTYDDVH----MKNNKMDYNNNNNNKKKKKINNLNFVKGTYINSNDLLYDDKIGVNIFED 314

Query:   346 NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             + +N     + +NI  N YN    D N  EY  +     +              + ++N 
Sbjct:   315 DVNNMKHKFNQRNI--NYYNK---DTNNLEYNNKHRYIYDCLLKKVEAISQKNKIIYSNE 369

Query:   166 PINEWP--GDAHEKELNNIFVNKIK-NNNDAQSYKGINNKTIFL 44
              IN++   G  +   L NI  NKIK NN +     G+  KT F+
Sbjct:   370 DINKYMLYGGTYVLSLYNI--NKIKYNNKEENRILGLVIKTGFI 411

 Score = 93 (32.7 bits), Expect = 1.1, P = 0.66
 Identities = 44/151 (29%), Positives = 67/151 (44%), Frame = -2

Query:   508 KGN--TYVDEE--PIDSTKNNRN---DNISNKNVHKKDIQNIN-QNNNIVGSD-QXDDIF 356
             KG+  T +D E   I S  N+ N   DNI   N++  +I   N   +NI G +   D+I+
Sbjct:  1126 KGHDKTCIDNEFTSIQSQMNSDNICGDNICGDNIYGDNICGDNIYGDNINGDNINGDNIY 1185

Query:   355 FKN-NNDNFGEGQDIQNIHHNVYNNT------PTDQNKKEYEEESSGFNNIQHDNTMKSP 197
               N N DN   G +I N + N+Y +       PT+ +K  Y       NN  +    K  
Sbjct:  1186 GDNINGDNIN-GDNI-NTYDNIYGDNYNLDYCPTEYHKCTYNNSILYRNNFLYKKENKK- 1242

Query:   196 VDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNN 92
              DK+  + +        D    +L +I +NK   N
Sbjct:  1243 -DKNYKNISTLYEHRTNDIQFDKLCDILINKDPRN 1276

 Score = 89 (31.3 bits), Expect = 3.2, P = 0.96
 Identities = 47/153 (30%), Positives = 71/153 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRND-NISNKNVHKKDIQNIN-QNNNIVGSDQXDDIFFKNN-NDNF 332
             NTY D       KNN+ D N +N N  KK I N+N      + S+   D+ + +    N 
Sbjct:   259 NTYDDVH----MKNNKMDYNNNNNNKKKKKINNLNFVKGTYINSN---DLLYDDKIGVNI 311

Query:   331 GEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMK-----SPVDKHMDHNNV 167
              E  D+ N+ H          NK     E +  +   +D  +K     S  +K + ++N 
Sbjct:   312 FE-DDVNNMKHKFNQRNINYYNKDTNNLEYNNKHRYIYDCLLKKVEAISQKNKII-YSNE 369

Query:   166 PINEWP--GDAHEKELNNIFVNKIK-NNNDAQSYKGINNKTIFL 44
              IN++   G  +   L NI  NKIK NN +     G+  KT F+
Sbjct:   370 DINKYMLYGGTYVLSLYNI--NKIKYNNKEENRILGLVIKTGFI 411


>sp|P04540|NU5M_TRYBB NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >pir||QQUTC5 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Trypanosoma
            brucei mitochondrion (SGC6) >gi|343540 (M14820) NADH dehydrogenase
            subunit 5 [Trypanosoma brucei]
            Length = 590

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.62, P = 0.46
 Identities = 38/176 (21%), Positives = 79/176 (44%), Frame = +2

Query:     8 IFLIIP-FIIIFFQKNGFVIYAFI*LC------IIIIFYFINKYII*FL--FMCISRPFI 160
             +F+++  +I IFF       Y F+  C      +++IF  +N   I FL  F C      
Sbjct:   339 LFIVLGIWIHIFFGLQDLRCYFFMYFCGCVLARLLLIFAILNSCSIWFLCGFYCKDMLLA 398

Query:   161 YRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILY-------- 316
                ++  +  ++  F SII ++      +F +FF + + +C  +   +++L+        
Sbjct:   399 LLMLLSFYNIIEFLFISIIFIFFTMIYNYFLLFFLMFVFKCFCLVDCLFLLFDYECCLVY 458

Query:   317 -VLS-FTKIVIIIFKKDI--IXLI*SHNII--ILVNILNILFMNIFIANVVISIIF 466
              ++S +  I+ I F  D   I +  S+ +     +N  N   + IF+  +++S+ F
Sbjct:   459 CLISLYMCILSIFFIIDFVCIFVFSSYCVFWSFFLNFYNFFDIAIFVVFLILSVGF 514

 Score = 85 (29.9 bits), Expect = 2.4, P = 0.91
 Identities = 36/163 (22%), Positives = 79/163 (48%), Frame = +2

Query:     5 FIF--LIIPFIIIFFQKNGFVIYAFI*LCIIIIFYF--INKYII*FLFMCISRPFIYRDI 172
             FIF  +I  + ++FF    F  +  +  C+ ++F +     Y +  L+MCI   F   D 
Sbjct:   418 FIFFTMIYNYFLLFFLMFVFKCFCLVD-CLFLLFDYECCLVYCLISLYMCILSIFFIIDF 476

Query:   173 IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIF 352
             + I +F   + + +   + +     F+ FF I I    ++++++ + + L +  +    F
Sbjct:   477 VCIFVF---SSYCVFWSFFLN----FYNFFDIAI---FVVFLILSVGF-LYYGCLFFYFF 525

Query:   353 KKDIIXLI*SHNIIILVNILNILFMN-IFIANVVISIIFG*INW-FLIY 493
               D I L      +I++ ++ ++F    F+  ++  ++F    W F+IY
Sbjct:   526 NIDCIMLFWRIFFVIIILVVFMIFCCWYFVCMIIFMLLFV---WNFVIY 571


>sp|P35352|CAR3_DICDI CYCLIC AMP RECEPTOR 3 >pir||A46391 cAMP receptor subtype
            3 - slime mold (Dictyostelium sp.) >bbs|125369 (S55235) cAMP
            receptor subtype 3 [Dictyostelium, Peptide, 490 aa] [Dictyostelium]
            Length = 490

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.64, P = 0.47
 Identities = 38/145 (26%), Positives = 67/145 (46%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNI--SNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             NK N   +  P+  + N +N+N   ++ N H  +  N N NNN   SD     F  N++ 
Sbjct:   303 NKNNN--NHSPVGLSNNAQNNNHHHNHNNNHNNNHNNHNNNNNNNNSD-----FVNNDSS 355

Query:   337 NFG-----EGQDIQNIHHNVYNNTPT-DQN--KKEYEEESSGFNNIQHDNTMKSPVDKHM 182
             N+      E   +QN +    N      QN   ++ +++S   NN  ++N   +  + + 
Sbjct:   356 NYYTASMIESFSVQNENSKSINGADNFKQNGASQQDDKDSPNSNNNNNNNNNNNNNNNNN 415

Query:   181 DHNNVPINEWPGDAHEKELNNIFVNKIKNNNDA 83
             ++NN   N +     E  ++N   N I  +N A
Sbjct:   416 NNNNNNNNNYNNKDIEP-IDNCNTNSIPMDNIA 447

 Score = 86 (30.3 bits), Expect = 1.5, P = 0.77
 Identities = 28/112 (25%), Positives = 51/112 (45%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNN-------DNF---GEGQ-- 320
             NN N++ +N N +  D  N N ++N   +   +    +N N       DNF   G  Q  
Sbjct:   333 NNHNNHNNNNNNNNSDFVN-NDSSNYYTASMIESFSVQNENSKSINGADNFKQNGASQQD 391

Query:   319 DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             D  + + N  NN   + N       ++  NN  ++N    P+D + + N++P++
Sbjct:   392 DKDSPNSNNNNNNNNNNNNNNNNNNNNNNNNNNYNNKDIEPID-NCNTNSIPMD 444

 Score = 82 (28.9 bits), Expect = 4.3, P = 0.99
 Identities = 33/146 (22%), Positives = 60/146 (41%), Frame = -2

Query:   487 EEPIDSTKNNRNDN-ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             ++ ++  KNN N + +   N  + +  + N NNN   ++  ++    NNN+N      + 
Sbjct:   297 QQRLEKNKNNNNHSPVGLSNNAQNNNHHHNHNNN--HNNNHNN---HNNNNNNNNSDFVN 351

Query:   310 NIHHNVYNNTPTDQNKKEYEEESS--GFNNI-QHDNTMKSPVDKHMDHNNVPINEWPGDA 140
             N   N Y  +  +    + E   S  G +N  Q+  + +   D    +NN   N    + 
Sbjct:   352 NDSSNYYTASMIESFSVQNENSKSINGADNFKQNGASQQDDKDSPNSNNNNNNNNNNNNN 411

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTI 50
             +    NN   N   NN D +     N  +I
Sbjct:   412 NNNNNNNNNNNNNYNNKDIEPIDNCNTNSI 441

 Score = 81 (28.5 bits), Expect = 5.7, P = 1.0
 Identities = 35/146 (23%), Positives = 63/146 (43%), Frame = -2

Query:   487 EEPIDSTKNNRNDN-ISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             ++ ++  KNN N + +   N  + +  + N NNN   ++  ++    NNN+N      + 
Sbjct:   297 QQRLEKNKNNNNHSPVGLSNNAQNNNHHHNHNNN--HNNNHNN---HNNNNNNNNSDFVN 351

Query:   310 NIHHNVYNNTPTDQNKKEYEEESS--GFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH 137
             N   N Y  +  +    + E   S  G +N + +   +   DK   ++N   N    + +
Sbjct:   352 NDSSNYYTASMIESFSVQNENSKSINGADNFKQNGASQQD-DKDSPNSN---NNNNNNNN 407

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTI 50
                 NN   N   NNN+  +Y   NNK I
Sbjct:   408 NNNNNN---NNNNNNNNNNNY---NNKDI 430


>pir||C26696 hypothetical protein (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 211

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.65, P = 0.48
 Identities = 30/99 (30%), Positives = 47/99 (47%), Frame = +2

Query:    80 LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIM-LYIIEAT*FFFI 256
             LC++  F  + + I  FL M  +   +    +M+ MF D  +  II  L+ I     +FI
Sbjct:   106 LCVLECFSLLCRCISTFLRMFCN--LLSSHFLML-MFCDFVYFFIIFFLFFIMCDFIYFI 162

Query:   257 FFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI 376
              F   +  CII Y+ +Y L +     + I IF   I+ LI
Sbjct:   163 IFTFAMLFCIIFYLFLYALDMFC-ALLQIFIFCNMIMQLI 201

 Score = 83 (29.2 bits), Expect = 0.85, P = 0.57
 Identities = 34/150 (22%), Positives = 68/150 (45%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIF-------YFINKYII*FLFMCISRPF-- 157
             ++ + I F I+F     F ++ F  L   I+F        F++ + + +L +C+   F  
Sbjct:    57 YLNVYILFCIVFMYYMAF-LFCFCFLLDFILFGSLLVGDAFMDVFFLRYL-LCVLECFSL 114

Query:   158 IYRDI-IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTK 334
             + R I   + MF +      +ML   +   +FFI FF+    C  IY +++   +L    
Sbjct:   115 LCRCISTFLRMFCNLLSSHFLMLMFCDFV-YFFIIFFLFFIMCDFIYFIIFTFAMLFCII 173

Query:   335 IVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFI 439
               + ++  D+   +    I I  N++  L M+  +
Sbjct:   174 FYLFLYALDMFCAL--LQIFIFCNMIMQLIMDFLL 206


>gi|1513298 (U66526) AbcA [Dictyostelium discoideum]
            Length = 1336

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.4, Sum P(2) = 0.76
 Identities = 17/79 (21%), Positives = 35/79 (44%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             ++N N   ++ N +   + N+  + N   +D  D+ +  N+N NF    +  N ++N  N
Sbjct:   745 QSNGNVGFASSN-NSVLLNNVVNDENYNNNDHIDEYYHYNSNKNFNNNNNNNNNNNNNNN 803

Query:   286 NTPTDQNKKEYEEESSGFN 230
             N   + N       ++  N
Sbjct:   804 NNNNNNNNNNNNRRNNNNN 822

 Score = 70 (24.6 bits), Expect = 0.69, Sum P(2) = 0.50
 Identities = 20/79 (25%), Positives = 36/79 (45%), Frame = -2

Query:   358 FFKN-NNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHM 182
             F +N NN N    Q I+N++H   N+     N       ++  NN  ++N   +  + + 
Sbjct:  1209 FIENINNHNNHSIQQIENLYHQA-NSIHAQYNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1267

Query:   181 DHNNVPINEWPGDAHEKELN 122
             ++NN   N    D  + +LN
Sbjct:  1268 NNNNNNNNNSGNDEIKNKLN 1287

 Score = 69 (24.3 bits), Expect = 7.0, Sum P(2) = 1.0
 Identities = 19/67 (28%), Positives = 30/67 (44%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT 275
             ND   N N H  +  + N N N   ++  ++    NNN+N     +  N ++N  NN   
Sbjct:   766 NDENYNNNDHIDEYYHYNSNKNFNNNNNNNN---NNNNNNNNNNNNNNNNNNNRRNN--- 819

Query:   274 DQNKKEY 254
             + NK  Y
Sbjct:   820 NNNKNRY 826

 Score = 68 (23.9 bits), Expect = 5.7, Sum P(2) = 1.0
 Identities = 17/87 (19%), Positives = 40/87 (45%), Frame = -2

Query:   415 IQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSG 236
             I+NIN +NN     Q ++++ + N+ +     +  N ++N  NN   + N       ++ 
Sbjct:  1210 IENINNHNNH-SIQQIENLYHQANSIHAQYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1268

Query:   235 FNNIQHDNTMKSPVDKHMDHNNVPINE 155
              NN  ++N+    +   ++  +  I +
Sbjct:  1269 NNNNNNNNSGNDEIKNKLNQKDRMIED 1295

 Score = 67 (23.6 bits), Expect = 0.69, Sum P(2) = 0.50
 Identities = 17/56 (30%), Positives = 30/56 (53%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             N ++DE    ++  N N+N +N N +  +  N N NNN   +++ ++    NNN N
Sbjct:   773 NDHIDEYYHYNSNKNFNNNNNNNNNNNNNNNNNNNNNNNNNNNRRNN----NNNKN 824

 Score = 64 (22.5 bits), Expect = 3.0, Sum P(2) = 0.95
 Identities = 26/112 (23%), Positives = 41/112 (36%), Frame = -2

Query:   343 NDNFGEGQDIQNIHHNVYNNT-PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
             N NF +   I   H N   N  P    + +  ++       QH     + ++   +HNN 
Sbjct:  1160 NTNFYDLFLILKNHLNYQINLMPPQPQQPQQPQQPHHQQQQQHYLNFNNFIENINNHNNH 1219

Query:   166 PINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              I +     H+   N+I      NNN+  +    NN       NN+   N  N
Sbjct:  1220 SIQQIENLYHQA--NSIHAQYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1270

 Score = 60 (21.1 bits), Expect = 3.4, Sum P(2) = 0.97
 Identities = 16/43 (37%), Positives = 23/43 (53%), Frame = -2

Query:   502 NTYVDEE-PIDSTKN----NRNDNISNKNVHKKDIQNINQNNN 389
             N ++DE    +S KN    N N+N +N N +  +  N N NNN
Sbjct:   773 NDHIDEYYHYNSNKNFNNNNNNNNNNNNNNNNNNNNNNNNNNN 815

 Score = 58 (20.4 bits), Expect = 1.4, Sum P(2) = 0.76
 Identities = 22/92 (23%), Positives = 37/92 (40%), Frame = -2

Query:   271 QNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIKNN 92
             Q ++ Y   ++   NI + N       +++ H    I+    + +    NN   N   NN
Sbjct:  1198 QQQQHYLNFNNFIENINNHNNHSIQQIENLYHQANSIHAQYNNNNNNNNNNNNNNNNNNN 1257

Query:    91 NDAQSYKGINNKTIFLEEN--NDERYNQENEK 2
             N+  +    NN       N  NDE  N+ N+K
Sbjct:  1258 NNNNNNNNNNNNNNNNNNNSGNDEIKNKLNQK 1289


>sp|P15577|NU2M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 2 >pir||S07734 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - Paramecium
            tetraurelia mitochondrion (SGC6) >gi|515876 (X15917) ND2 protein
            (AA 1-193) (unusual start codon) [Paramecium aurelia] >gi|1019630
            (M26930) NADH dehydrogenase subunit 2 [Paramecium aurelia]
            Length = 193

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.70, P = 0.50
 Identities = 37/171 (21%), Positives = 78/171 (45%), Frame = +2

Query:    11 FLIIPFIIIFFQKNGFVIY---AFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             FL +  I + F K G + +   A   L + + F+F+    +  L   +S+ + + +I   
Sbjct:    23 FLNLLMINLMFSKLGAIFFLNLALYLLALALFFFFLFNVKV-ALLKSVSQIYYFNNIFFF 81

Query:   182 HMFVDRTFHSI-----IMLYIIEAT*FFFIFFFILISRCIII--YIMMYILYVLSFTKIV 340
               FV   F ++     ++ + ++   FFF+FF   ++  +I   + M  + + LS  K  
Sbjct:    82 KFFVLIFFLNLAGIPPLLGFFLKFLIFFFLFFKTNLAFILIFLGFNMATLFFYLSTVKSF 141

Query:   341 IIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISF 508
             +    +    ++ S N  I   +  + F N F   +  +  F   + FLI++++ F
Sbjct:   142 V---NRKQASVLNSFNFFIRAELSFLYFFNFFYFFLFFAFFFL-DSTFLIFLNLFF 193


>pir||JS0233 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - Paramecium
            tetraurelia mitochondrion (SGC6)
            Length = 193

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.70, P = 0.50
 Identities = 37/171 (21%), Positives = 78/171 (45%), Frame = +2

Query:    11 FLIIPFIIIFFQKNGFVIY---AFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMI 181
             FL +  I + F K G + +   A   L + + F+F+    +  L   +S+ + + +I   
Sbjct:    23 FLNLLMINLMFSKLGAIFFLNLALYLLALALFFFFLFNVKV-ALLKSVSQIYYFNNIFFF 81

Query:   182 HMFVDRTFHSI-----IMLYIIEAT*FFFIFFFILISRCIII--YIMMYILYVLSFTKIV 340
               FV   F ++     ++ + ++   FFF+FF   ++  +I   + M  + + LS  K  
Sbjct:    82 KFFVLIFFLNLAGIPPLLGFFLKFLIFFFLFFKTNLAFILIFLGFNMATLFFYLSTVKSF 141

Query:   341 IIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISF 508
             +    +    ++ S N  I   +  + F N F   +  +  F   + FLI++++ F
Sbjct:   142 V---NRKQASVLNSFNFFIRAELSFLYFFNFFYFFLFFAFFFL-DSTFLIFLNLFF 193


>sp|P27571|XIST_MOUSE X INACTIVE SPECIFIC TRANSCRIPT PROTEIN >pir||S15433
            hypothetical protein - mouse >gi|1181245 (X59289) ORF [Mus
            musculus] >prf||1711440A xist gene [Mus musculus]
            Length = 298

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.71, P = 0.51
 Identities = 35/116 (30%), Positives = 58/116 (50%), Frame = +3

Query:    18 LYLSSLFSSKKMVLLFMPLYDCASLLFFILLTNILFNSF-SCASPGHSFIGTLL*SICLS 194
             L+L  + S+  +V +F+  + C  LL   +L+N L + F  C      F+   +  +CL 
Sbjct:     4 LFLPCIVSNS-LVYIFLHCFVCLCLL---VLSNSLLHLFLPCFVC--LFLPCFV-CLCLP 56

Query:   195 TGLFIVLSCCI-LLKPLDSSSYSFLF*-SVGVLLYTL*CIFCMSCPSPKLSLLFLKKIS 365
               + + L C + LL P  S+S   LF  S   LL +  C+FC+ C  P + +  L  +S
Sbjct:    57 CFVCLCLPCFVYLLLPCVSNSLLHLFLPSFACLLLSFVCLFCLQCVLP-IPMFLLHVLS 114


>pir||S51908 cryptogene protein G1(ND9) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 196

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.72, P = 0.52
 Identities = 38/155 (24%), Positives = 75/155 (48%), Frame = +2

Query:    26 FIIIFFQKNGFVIYAFI*LCIIIIFY-FIN-KYII*FLFMCISRPFIYRDIIMIHMFVDR 199
             F+I+F  +  FV+  F  LC   +F  F++  ++  +LF+C    F++    ++ +F + 
Sbjct:    10 FLIMF--RCVFVLLLFFCLCCRWVFLCFVDCSFVFFYLFVCF---FLF---FVMFLFFNL 61

Query:   200 TFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXL 373
              F    +LY ++   F   F      R I+IY++  +L  + +SF  I   +F   +  L
Sbjct:    62 WF---FLLYCLDL--FCIDFCGFCFVRFILIYVLFCLLLCFRVSFVLICFFLFFGLVFSL 116

Query:   374 I*-SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLI 490
                S+ + I    +  LF  +F  N  +   +  ++WF +
Sbjct:   117 FFCSYALCIFEREVFDLFGFVFCGNDCLHRFY--VDWFFV 154


>gi|794235 (U10128) NADH dehydrogenase subunit 5 [Anopheles gambiae]
           Length = 265

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.76, P = 0.53
 Identities = 29/107 (27%), Positives = 57/107 (53%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLMDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILVN 406
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I +++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISILS 116


>gnl|PID|e233513 (X96869) histidine kinase [Dictyostelium discoideum]
            Length = 1670

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.76, Sum P(2) = 0.53
 Identities = 22/68 (32%), Positives = 34/68 (50%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             ID   NN N+N +N N +  +  N N NNN   ++  +     NNN+N G+  D + +  
Sbjct:    41 IDDLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN-----NNNNNDGDKNDKKLL-- 93

Query:   298 NVYNNTPT 275
              +  N PT
Sbjct:    94 -IITNAPT 100

 Score = 52 (18.3 bits), Expect = 0.76, Sum P(2) = 0.53
 Identities = 18/90 (20%), Positives = 38/90 (42%), Frame = -2

Query:   289 NNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFV 110
             NNT    N    E +SS  + +   +T  S +   +  NN+ +N    + +    N+I V
Sbjct:  1436 NNTNNTNNTNNIENKSSIDSPLSITSTSSSIITPILTSNNLDLN----NNNNNNNNSILV 1491

Query:   109 NKIKNNNDAQSYKGINNKTIFLEENNDERY 20
             +   NN        + +    ++++  ++Y
Sbjct:  1492 S---NNGGVDGGNNVPSTLTTIQQSQPKKY 1518

 Score = 52 (18.3 bits), Expect = 0.76, Sum P(2) = 0.53
 Identities = 23/107 (21%), Positives = 40/107 (37%), Frame = -2

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDN---TMKSPVDKHMDHNNVPINEW 152
             + ++  + N  NNT T+ N       ++  NN  ++N   T  +                
Sbjct:   358 KQLKERYSNNNNNTNTNNNNNNNNNNNNNNNNNNNNNNNDTTTTTTTTTTTTTTTTTTTT 417

Query:   151 PGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
                 +E + NN   N   NNN+  +    NN       NN+E   Q  ++
Sbjct:   418 TTTTNESDNNN---NNNNNNNNNNNNNNNNN-------NNNEEIKQNTKE 457

 Score = 48 (16.9 bits), Expect = 1.9, Sum P(2) = 0.85
 Identities = 14/60 (23%), Positives = 25/60 (41%), Frame = -2

Query:   175 NNVPINEW-PG---DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             N++PIN   PG   +    ++ + +++        + Y   NN T     NN+   N  N
Sbjct:   327 NSIPINNLAPGLLPNTDPTKILDPYISLYNKKQLKERYSNNNNNTNTNNNNNNNNNNNNN 386

 Score = 47 (16.5 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 12/45 (26%), Positives = 20/45 (44%), Frame = -2

Query:   139 HEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
             ++K+L   + N   NNN+  +    NN       NN+   N  N+
Sbjct:   356 NKKQLKERYSN---NNNNTNTNNNNNNNNNNNNNNNNNNNNNNND 397

 Score = 41 (14.4 bits), Expect = 9.5, Sum P(2) = 1.0
 Identities = 11/32 (34%), Positives = 13/32 (40%), Frame = -2

Query:   124 NNIFVNKIKNNNDAQSYKGINNKTIFLEENND 29
             NN   N   NNN+  +    NN       NND
Sbjct:   369 NNTNTNNNNNNNNNNNNNNNNNNN---NNNND 397


>pir||D44863 R45 antigen - Plasmodium falciparum (fragment) >gi|160624 (M83795)
            trophozoite antigen [Plasmodium falciparum]
            Length = 65

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 0.77, P = 0.54
 Identities = 17/58 (29%), Positives = 26/58 (44%), Frame = -2

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEK 131
             +H   NN  +D N K      S  N++  D+  KS  +   DHN+   N    D++ K
Sbjct:     8 NHKSDNNHKSDHNHKSDSNHMSDHNHMS-DHNHKSDHNHKSDHNHKSDNNHKSDSNHK 64


>prf||2015259H NADH dehydrogenase:SUBUNIT=5 [Anopheles quadrimaculatus]
            Length = 576

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.79, P = 0.55
 Identities = 29/106 (27%), Positives = 57/106 (53%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHS--IIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+ +D++    +    F S  I+M ++ +     F+ F 
Sbjct:     6 ISFYFLLSISL-SLFL-ISLKFLLKDLVYFIEWEAWVFKSMSIVMTFLFDWMSLMFMSFV 63

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    64 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 111


>sp|P33510|NU5M_ANOQU NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >gi|1217661
            (L04272) NADH dehydrogenase subunit 5 [Anopheles quadrimaculatus A]
            Length = 576

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.79, P = 0.55
 Identities = 29/106 (27%), Positives = 57/106 (53%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHS--IIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+ +D++    +    F S  I+M ++ +     F+ F 
Sbjct:     6 ISFYFLLSISL-SLFL-ISLKFLLKDLVYFIEWEAWVFKSMSIVMTFLFDWMSLMFMSFV 63

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    64 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 111


>sp|P32770|ARP_YEAST ARP PROTEIN >pir||S61046 ARP1 protein - yeast
            (Saccharomyces cerevisiae) >gi|1061272 (Z67750) ARP protein
            [Saccharomyces cerevisiae] >gnl|PID|e253076 (Z74215) ORF YDL167c
            [Saccharomyces cerevisiae]
            Length = 719

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.79, P = 0.55
 Identities = 22/78 (28%), Positives = 34/78 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N++       N NNNI G+   +     N+N+N     +  N HHN   N+
Sbjct:   490 NNNINNNNNNINNMTNNRYNINNNINGNGNGNG---NNSNNNNNHNNNHNNNHHNGSINS 546

Query:   280 PTDQNKKEYEEESSGFNN 227
              ++ N        +  NN
Sbjct:   547 NSNTNNNNNNNNGNNSNN 564


>gi|295139 (L13334) ORFB [Staphylococcus lugdunensis]
           Length = 276

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.81, P = 0.56
 Identities = 41/151 (27%), Positives = 70/151 (46%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDII-MIH 184
             IFLII  +I F+ K G  +Y+ + +    +  +++ YI   L + I+  F    I+ +I 
Sbjct:    57 IFLIIGCLIFFYLKIG--LYSVLAIFGSALIMYVSNYISVILSV-IADYFSLSYIVQIII 113

Query:   185 MFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDI 364
             + V  T  SII  Y I          ++  ++  I  I ++++  L    +   IFK++ 
Sbjct:   114 ILVSFTLISIICAYFIRFLLISSKKTYLYFNKIYISVISIFLILSLIMLYLYTQIFKQEY 173

Query:   365 IXLI*SHNIIILVNILNILFMNIFIANVVISI 460
               L      II V IL   F+ IFI  +  S+
Sbjct:   174 QDL--KIFAIIFVGIL--FFLAIFIIAITFSV 201


>gi|501027 (U01849) ORF2 [Trypanosoma brucei]
           Length = 141

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.83, P = 0.56
 Identities = 25/99 (25%), Positives = 49/99 (49%), Frame = +2

Query:    56 FVIYAFI*LCIIIIFYFINKYII*F-LFMCISRPFIYRDIIMIHMFVDRTFHSII-MLYI 229
             FV   FI   I++ F+ +   +I +  F CI   + + D+I++ +F    F+ ++  LY 
Sbjct:    33 FVWVCFICFVIVVCFFLLFWVVIFYWCFDCIV--YFFCDVIILFIFF---FYFVLCFLYC 87

Query:   230 IEAT*FFFI-FFFILISRCIIIYIMMYILYVLSFTKIVIIIF 352
                  F+ +   F  I  C++ Y ++Y L    F  + + +F
Sbjct:    88 C----FYLVCLVFFCIFCCVLCYFLIYFLCCFLFWVVFLFLF 125

 Score = 76 (26.8 bits), Expect = 2.1, P = 0.87
 Identities = 20/99 (20%), Positives = 50/99 (50%), Frame = +2

Query:    11 FLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMF 190
             F ++ +++IF+     ++Y F  + I+ IF+F   +++ FL+ C    F    ++   +F
Sbjct:    47 FFLLFWVVIFYWCFDCIVYFFCDVIILFIFFFY--FVLCFLYCC----FYLVCLVFFCIF 100

Query:   191 VDRTFHSIIML---YIIEAT*FFFIFFFILISRCIIIYIMMY 307
                  + +I     ++      F  FFF+ +  C  ++++++
Sbjct:   101 CCVLCYFLIYFLCCFLFWVVFLFLFFFFVYV--CFYLWLLLF 140


>gi|605651 (M97918) regulatory protein [Saccharomyces cerevisiae]
           Length = 187

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.85, P = 0.57
 Identities = 26/112 (23%), Positives = 47/112 (41%), Frame = -2

Query:   433 NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEY 254
             N+  K  Q IN NNN   +      ++ N + N   G      ++N  NN   + N++ Y
Sbjct:    84 NIIDKVKQQINSNNNSNSNGPGHKRYYNNRDSNNNRG------NYNRRNNNNGNSNRRPY 137

Query:   253 EEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIK 98
              +    +NN    N   S  +  ++ NN  +N   G + +   N+    K++
Sbjct:   138 SQNRQ-YNNSNSSNINNS--NNSINSNNQNMNNGLGGSVQHHFNSSSPQKVE 186

 Score = 75 (26.4 bits), Expect = 6.2, P = 1.0
 Identities = 27/97 (27%), Positives = 42/97 (43%), Frame = -2

Query:   478 IDSTK---NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN 308
             ID  K   N+ N++ SN   HK+   N + NNN    ++ +     NNN N       QN
Sbjct:    86 IDKVKQQINSNNNSNSNGPGHKRYYNNRDSNNNRGNYNRRN-----NNNGNSNRRPYSQN 140

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNN-----IQHDNTMKSP 197
               +N  N++  + +       +   NN     +QH     SP
Sbjct:   141 RQYNNSNSSNINNSNNSINSNNQNMNNGLGGSVQHHFNSSSP 182


>pir||S34959 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 - Crithidia
            oncopelti mitochondrion (SGC6) >gi|12881 (X56015) NADH
            dehydrogenase subunit 4 [Crithidia oncopelti]
            Length = 437

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.96, P = 0.62
 Identities = 43/168 (25%), Positives = 81/168 (48%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYF-INKYII*FLFMCISRPFIYRDIIMIH 184
             I  I+  III F  N   + +FI +C     Y  I  +I+ F+   I  P     + +  
Sbjct:   140 IMCIMICIIIIFHFNVLNLQSFIDICFFDSLYLAIYIWILLFIMFAIKYPIWPLHVWLPE 199

Query:   185 MFVD-RTFHSIIMLYIIEAT*FFFIFFFILIS-RCIIIYIMMYI--LYVLSFTKIVI-II 349
             M V+  T  S+++  ++    FF +F F+ ++   + I+ +  I  + +L  T + I ++
Sbjct:   200 MHVEVNTEMSVLLASVVLKMGFFGVFKFLFLAFNQVSIWFLGVIDSMVMLGLTFLSISLL 259

Query:   350 FKKDIIXLI*SHNII------ILVNILNILFMNI-FIANV--VISIIF 466
             F+ D   +I + ++I      IL+   ++LF+ I F  N+  +IS  F
Sbjct:   260 FQSDYKKIIANWSVIHTGMGLILLWHNDLLFIGILFFCNLSHIISSAF 307

 Score = 81 (28.5 bits), Expect = 4.9, P = 0.99
 Identities = 33/132 (25%), Positives = 71/132 (53%), Frame = +2

Query:    71 FI*LCIIIIFYFINKYII*FL-FMCI--SRPFIYRDIIMIHMFVDRTFHSIIMLYIIEAT 241
             F+ L +  + + + + I+ +  + CI  +  FIY D++ I +  D  F   ++L+  E+ 
Sbjct:    52 FMGLIVFFLVFLLTRKIVSYSKYFCIVCTYIFIYIDVVFIILIDD--FVCFMILF--ESL 107

Query:   242 *F---FFIFFFILISRCIIIYIMMYILYVLSFTKIVIIIFKKDIIXLI*SHNIIILVNIL 412
              F   F   FF   +R   I+ + Y++ V S + I+ I+     I +I   N++ L + +
Sbjct:   108 FFPICFVSLFFNFNNR--FIFAIFYLVIVSSISSIMCIMI---CIIIIFHFNVLNLQSFI 162

Query:   413 NILFMN-IFIANVVISIIF 466
             +I F + +++A  +  ++F
Sbjct:   163 DICFFDSLYLAIYIWILLF 181


>pir||F30010 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 443

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.97, P = 0.62
 Identities = 44/151 (29%), Positives = 75/151 (49%), Frame = +2

Query:    59 VIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYIIEA 238
             VI  FI L +I+   FIN     + F C++  F Y   I I+++++  + ++  +Y +  
Sbjct:    13 VICNFILLFLIVTLIFIN-----YSF-CLALQFNY---IYINIYLN--YINLWFIYFMGL 61

Query:   239 T*FFFIFFFILISRCIIIYIM-MYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILVNI 409
               FF IF   L+SR ++ Y    YIL  Y+  F  + +II   D +  +    I+     
Sbjct:    62 IVFFLIF---LLSRKLVSYSKYFYILLSYIFIFFDVTLIILIDDFMCFM----ILFESLF 114

Query:   410 LNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
               I F+++F  N     IF  I + +I+ S+S I
Sbjct:   115 FPICFVSLFF-NFNNRFIFA-IFYLVIFSSLSSI 146

 Score = 87 (30.6 bits), Expect = 0.97, P = 0.62
 Identities = 44/168 (26%), Positives = 82/168 (48%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYF-INKYII*FLFMCISRPFIYRDIIMIH 184
             I  II  III F  N   + +FI +CI    Y  +  +I+ F+   I  P     + +  
Sbjct:   146 IMCIIICIIIIFHFNILNLQSFIDICIFDSLYLGLYVWILLFIMFSIKYPIWPFHVWLPE 205

Query:   185 MFVD-RTFHSIIMLYIIEAT*FFFIFFFILIS-RCIIIYIMMYI--LYVLSFTKIVI-II 349
             + V+  T  SI++  ++    FF ++ F+ +S   + I+ + +I  L +L  T + I ++
Sbjct:   206 LHVEVNTELSILLASVVLKIGFFGLYKFLFLSFNQLSIWFLGFIDSLVMLGLTFLAITLL 265

Query:   350 FKKDIIXLI*SHNII------ILVNILNILFMNIFI-ANV--VISIIF 466
             F  D   +I + ++I      IL+   +I+F+ + I  N+  +IS  F
Sbjct:   266 FLSDYKKIIATWSVIHTGIGLILLWHNDIIFLGLLIFCNLSHIISSAF 313

 Score = 87 (30.6 bits), Expect = 0.97, P = 0.62
 Identities = 43/172 (25%), Positives = 80/172 (46%), Frame = +2

Query:     8 IFLIIPFIIIFF------QKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFI--- 160
             +FLI+  I I +      Q N   I  ++    +   YF+   I+ FL   +SR  +   
Sbjct:    20 LFLIVTLIFINYSFCLALQFNYIYINIYLNYINLWFIYFMG-LIVFFLIFLLSRKLVSYS 78

Query:   161 -YRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFF-FILISRCII-IYIMMYILYVLSFT 331
              Y  I++ ++F+   F  + ++ +I+    F I F  +    C + ++      ++ +  
Sbjct:    79 KYFYILLSYIFI---FFDVTLIILIDDFMCFMILFESLFFPICFVSLFFNFNNRFIFAIF 135

Query:   332 KIVIIIFKKDIIXLI*SHNIIILVNILNIL-FMNIFIANVVISIIFG*INWFLIYISIS 505
              +VI      I+ +I    II   NILN+  F++I I +   S+  G   W L++I  S
Sbjct:   136 YLVIFSSLSSIMCIIICIIIIFHFNILNLQSFIDICIFD---SLYLGLYVWILLFIMFS 191

 Score = 81 (28.5 bits), Expect = 5.0, P = 0.99
 Identities = 32/116 (27%), Positives = 53/116 (45%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKN--GFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPF--IYRD 169
             +F+ LI+ F+I    +    +  Y +I L  I IF+ +   I+   FMC    F  ++  
Sbjct:    57 YFMGLIVFFLIFLLSRKLVSYSKYFYILLSYIFIFFDVTLIILIDDFMCFMILFESLFFP 116

Query:   170 IIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIVI 343
             I  + +F +  F++  +  I     F  +   + I  CIII     IL + SF  I I
Sbjct:   117 ICFVSLFFN--FNNRFIFAIFYLVIFSSLSSIMCIIICIIIIFHFNILNLQSFIDICI 172

 Score = 80 (28.2 bits), Expect = 6.5, P = 1.0
 Identities = 30/90 (33%), Positives = 52/90 (57%), Frame = +2

Query:     5 FIFLI-IPFIIIF----FQKNGFVIYAFI*LC---IIIIFYFINKYII*FLFMCIS-RPF 157
             F+F I  PF+++F    F   G +  +FI +C   II++  F++     +++MC+S   F
Sbjct:   350 FLFNIDFPFMLLFYIDIFLLYGLISLSFIYICCFYIIVLAVFLSSI---YMYMCLSFYSF 406

Query:   158 IYRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILI 274
             I+ D    ++ +D T + I + +I   T    I FF LI
Sbjct:   407 IWLDK---YLRLDLTINDIYLYFI---TSIIVILFFYLI 439


>sp|P54674|P3K2_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 2 (PI3-KINASE)
            (PTDINS-3-KINASE) (PI3K) >gi|733522 (U23477)
            phosphatidylinositol-4,5-diphosphate 3-kinase [Dictyostelium
            discoideum]
            Length = 1858

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.99, P = 0.63
 Identities = 24/105 (22%), Positives = 43/105 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             S+   T     P  ++ NN N+N +N N +  +  N N NNN   ++  ++    NNN+N
Sbjct:   169 SSSSTTATTPSPTTTSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN----NNNNN 224

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKS 200
                          + +++P   +          FNN  ++N   S
Sbjct:   225 NNTTSTTTTTTSILISSSPPPSSSSSSSSNDEQFNNNNNNNNSNS 269

 Score = 92 (32.4 bits), Expect = 3.1, Sum P(2) = 0.96
 Identities = 21/64 (32%), Positives = 32/64 (50%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +NK N   ++E  DS+ NN N+N +N N +  +  N N NNN    +   +    N+N N
Sbjct:   998 TNKENKDSNKENKDSSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNGNNNGNNSNNNSNSN 1057

Query:   334 FGEG 323
                G
Sbjct:  1058 ISRG 1061

 Score = 89 (31.3 bits), Expect = 3.0, P = 0.95
 Identities = 38/144 (26%), Positives = 69/144 (47%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             ++ K N++ N  NK+    +  N N NNN   ++  ++    NNN+N   G +  N  +N
Sbjct:   997 ETNKENKDSNKENKDSSSNNNNNNNNNNNNNNNNNNNN----NNNNNNNNGNNNGNNSNN 1052

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN-VPIN--EWPGDAHEKEL 125
               +N+   +   + E   SG  N     T+    +  + +N+ +PIN  +     +   L
Sbjct:  1053 -NSNSNISRGSIDSEGNGSGSGNGSEQPTLIGVQNFSLPNNSKLPINIVKRLFRVNIAGL 1111

Query:   124 NNIFVNKIKNNNDAQSY--KGINNK-TIFL 44
              N+  N   NN DA++    G NN+  +F+
Sbjct:  1112 RNLNFN---NNEDARNKFADGKNNQPNVFV 1138

 Score = 37 (13.0 bits), Expect = 3.1, Sum P(2) = 0.96
 Identities = 10/65 (15%), Positives = 29/65 (44%), Frame = -2

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             +  D   + Q ++++H        T+ + +  +    G + I+  +T + P+D   +   
Sbjct:  1508 HRQDLIKQNQVLKSLHTVAMAVKQTNGSSERKKVLMEGLSKIKFPDTFQLPLDPRWEAKG 1567

Query:   169 VPINE 155
             + I++
Sbjct:  1568 LIIDK 1572


>gi|940761 (X85877) invasive associated protein [Listeria monocytogenes]
           Length = 86

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 1.0, P = 0.63
 Identities = 17/56 (30%), Positives = 26/56 (46%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             NT  ++   ++  NN N N  +KN +     N N N+N   ++Q       NNN N
Sbjct:    21 NTNANKTNTNTNTNNTNTNTPSKNTNTNSNTNTNTNSN-TNANQGSS----NNNSN 71


>gi|794226 (U10125) NADH dehydrogenase subunit 5 [Anopheles arabiensis]
           Length = 265

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLTDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>gi|794229 (U10126) NADH dehydrogenase subunit 5 [Anopheles gambiae] >gi|794247
           (U10132) NADH dehydrogenase subunit 5 [Anopheles quadriannulatus]
           >gi|1932716 (U10124) NADH dehydrogenase subunit 5 [Anopheles
           arabiensis]
           Length = 265

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLMDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>gi|794232 (U10127) NADH dehydrogenase subunit 5 [Anopheles gambiae] >gi|794236
           (U10123) NADH dehydrogenase subunit 5 [Anopheles melas] >gi|1932718
           (U10133) NADH dehydrogenase subunit 5 [Anopheles quadriannulatus]
           Length = 265

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLTDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>gi|794238 (U10129) NADH dehydrogenase subunit 5 [Anopheles melas]
           Length = 265

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLTDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYDINRFILLVLMFVMSMMMLIISPNLISIL 115


>gi|794241 (U10130) NADH dehydrogenase subunit 5 [Anopheles merus] >gi|794244
           (U10131) NADH dehydrogenase subunit 5 [Anopheles merus]
           Length = 265

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLTDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>sp|P51899|NU5M_ANOAR NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5
            Length = 266

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLMDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>gi|343544 (M33228) ATPase 6 [Trypanosoma brucei]
           Length = 231

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.0, P = 0.64
 Identities = 33/126 (26%), Positives = 65/126 (51%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIY-AFI*LCII-IIFYFINKYII*FLFMCISRPF-IYRDII 175
             F+FL   F+  FF  N  ++  +F+ +  I  +  F+  + +  L  C+S    ++ +++
Sbjct:    96 FLFLFC-FLCDFFLFNNLLVGDSFMDVFFIRFLLCFLECFSL--LCRCLSTFLRLFCNLL 152

Query:   176 MIH----MFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTKIV- 340
               H    MF D  F+ I + +      ++FI F  +   C++ Y+ +Y+L +  F  I+ 
Sbjct:   153 SSHFLLLMFFD-FFYFIFVFFFYGVFCYWFILFIFVFCFCLLFYVFLYLLDL--FAAILQ 209

Query:   341 IIIFKKDIIXLI 376
             + IF   I+ LI
Sbjct:   210 LFIFCNMILQLI 221

 Score = 82 (28.9 bits), Expect = 1.3, P = 0.74
 Identities = 34/167 (20%), Positives = 82/167 (49%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFI--NKYII*FLFMCISRPFIYRDII 175
             +F  L++ F  + F    F +Y F+ LC+ ++ +F+  N Y +  L+ CI+    Y ++ 
Sbjct:    31 YFNCLMLIFDFLLFCL--FDLYLFVGLCLFLLLWFMLFNLYSL-ILYYCIT----YLNLY 83

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCII-IYIMMYILYVLSFTKIV---I 343
             ++   V   + + + L+       FF+F  +L+    + ++ + ++L  L    ++   +
Sbjct:    84 LLFCIVFLLYIAFLFLFCFLCD--FFLFNNLLVGDSFMDVFFIRFLLCFLECFSLLCRCL 141

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*I-NWFLIYISI 502
               F +    L+ SH ++++       F + F   + +   +G    WF+++I +
Sbjct:   142 STFLRLFCNLLSSHFLLLM-------FFDFFYF-IFVFFFYGVFCYWFILFIFV 187

 Score = 75 (26.4 bits), Expect = 9.5, P = 1.0
 Identities = 33/153 (21%), Positives = 71/153 (46%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFY-------FINKYII*FLFMCISRPF-- 157
             ++ L + F I+F     F ++ F  LC   +F        F++ + I FL +C    F  
Sbjct:    79 YLNLYLLFCIVFLLYIAF-LFLFCFLCDFFLFNNLLVGDSFMDVFFIRFL-LCFLECFSL 136

Query:   158 IYRDI-IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFI-LISRCIIIYIMMYILYVLSFT 331
             + R +   + +F +      ++L   +   F F+FFF  +     I++I ++   +L + 
Sbjct:   137 LCRCLSTFLRLFCNLLSSHFLLLMFFDFFYFIFVFFFYGVFCYWFILFIFVFCFCLLFYV 196

Query:   332 KIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFI 439
              + ++     I+ L    N+I+ + I++ L   +F+
Sbjct:   197 FLYLLDLFAAILQLFIFCNMILQL-IMDFLLFLLFV 231


>gi|1022918 (U38184) ATPase subunit 6 [Trypanosoma cruzi]
            Length = 233

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.0, P = 0.65
 Identities = 39/170 (22%), Positives = 84/170 (49%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFI--NKYII*FLFMCISRPFIYRDII 175
             +F  L++ F  + F    F +Y+FI LC+ ++ +F+  N Y +  L+ CI+    Y ++ 
Sbjct:    31 YFNCLLLIFDFLLFCL--FDLYSFIGLCLFLLLWFMLFNLYSL-ILYYCIT----YLNLY 83

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCII-IYIMMYILYVLSFTKIV---I 343
             ++   V   + S + L+       FF+F  +L+    + ++ + ++L  L    ++   +
Sbjct:    84 LLFCIVFLYYMSFLFLFCFLLD--FFLFNNLLVGDNFMDVFFIRFLLCFLECFSLLCRCL 141

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISISFI 511
               F +    L+ SH ++++       F+  F    V  I F  ++ FL++I   F+
Sbjct:   142 STFLRLFCNLLSSHFLLLMF----FDFLYFFF---VFFIFFCFLD-FLVFILFIFV 189


>sp|Q94481|CIGB_DICDI CIGB PROTEIN >gi|1513302 (U66528) CigB [Dictyostelium
            discoideum]
            Length = 735

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.1, P = 0.66
 Identities = 44/162 (27%), Positives = 71/162 (43%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQ 311
             D + I +  NN N++I +K      +    Q NN   +D  DD + + + D     +  Q
Sbjct:   142 DNKIISTILNNNNNSIIDK------LNYFTQINNQQDNDDNDDCY-QIDTDTIELIKQYQ 194

Query:   310 N---IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA 140
             N   I  N  NN       KEY  +   F+N Q  N +K+         ++P      DA
Sbjct:   195 NSLLILKNS-NNINNLTKLKEYNNQILKFDN-QTINNIKNSFKSIYSFGDIP-----NDA 247

Query:   139 HEKELNNIFVNKIKNNNDAQS-YKGINNKTIFLE--ENNDERYNQENE 5
              +  +NN   N   NNN+  +     NNK  F++   +N   Y++ +E
Sbjct:   248 IDYNINNNNNNNNNNNNNNNNELNNSNNKNEFIKILNHNFYIYSESDE 295

 Score = 87 (30.6 bits), Expect = 1.8, P = 0.84
 Identities = 46/161 (28%), Positives = 72/161 (44%), Frame = -2

Query:   478 IDSTKNNRNDNISN--KNVHKKDIQNIN---QNNNIVGSDQXDDIFFKNNNDNFGEGQDI 314
             I S+ NN N  IS    N +   I  +N   Q NN   +D  DD + + + D     +  
Sbjct:   135 ITSSINNDNKIISTILNNNNNSIIDKLNYFTQINNQQDNDDNDDCY-QIDTDTIELIKQY 193

Query:   313 QNIHHNVYN-NTPTDQNK-KEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA 140
             QN    + N N   +  K KEY  +   F+N Q  N +K+         ++P      DA
Sbjct:   194 QNSLLILKNSNNINNLTKLKEYNNQILKFDN-QTINNIKNSFKSIYSFGDIP-----NDA 247

Query:   139 HEKELNNIFVNKIKNNNDAQS-YKGINNKTIFLE--ENNDERYNQENE 5
              +  +NN   N   NNN+  +     NNK  F++   +N   Y++ +E
Sbjct:   248 IDYNINNNNNNNNNNNNNNNNELNNSNNKNEFIKILNHNFYIYSESDE 295


>gi|1405368 (U60170) RegA [Dictyostelium discoideum]
            Length = 793

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.2, P = 0.69
 Identities = 27/92 (29%), Positives = 41/92 (44%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             +  NN N+N SN N  +KDI ++  N++   S+            N     +  N ++N+
Sbjct:    56 NNNNNNNNNNSNNNEKQKDIVSLENNSS---SNNTTTTTTTTTTSNHNSNNNSNNNNNNI 112

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHD--NTMKSP 197
              NN   + N   YE   +G NN   D  N   SP
Sbjct:   113 NNNNINNNN---YEPLVNGHNNGFGDKLNDQPSP 143

 Score = 85 (29.9 bits), Expect = 3.4, P = 0.97
 Identities = 34/102 (33%), Positives = 47/102 (46%), Frame = -2

Query:   475 DSTK-NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ-DIQNIH 302
             DST   +    I N NVH K   N N NNN             NNN N  E Q DI ++ 
Sbjct:    31 DSTSLKSMISGIENLNVHSKGNDNKNNNNNN-----------NNNNSNNNEKQKDIVSLE 79

Query:   301 HNVYNN-------TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD-HNN 170
             +N  +N       T T  N       ++  NNI ++N   +  +  ++ HNN
Sbjct:    80 NNSSSNNTTTTTTTTTTSNHNSNNNSNNNNNNINNNNINNNNYEPLVNGHNN 131


>pir||G64417 hypothetical protein MJ0943 - Methanococcus jannaschii >gi|1591612
            (U67538) M. jannaschii predicted coding region MJ0943
            [Methanococcus jannaschii]
            Length = 417

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.69
 Identities = 32/93 (34%), Positives = 48/93 (51%), Frame = -2

Query:   424 KKDIQNINQNNNIVGSDQXDDIFFKNNN----DNFGEGQDIQNI--HHN--VYN--NTPT 275
             K DI NIN N N  G +    I  +N N    +N  E Q  QNI  + N  + N  N P 
Sbjct:    32 KIDI-NINSNTNN-GENTEKPINQENQNVNNVENKKESQSTQNIQSYENKEIKNQENHPL 89

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
               N+  YE+ +  FN  +++N M +  +  +++NN P
Sbjct:    90 QSNQN-YEQTNGNFNE-ENENAMTNVGESEVNYNNEP 124

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.69
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             N N N +N    +K I   NQN NN+    +        N  ++ E ++I+N       N
Sbjct:    36 NINSNTNNGENTEKPINQENQNVNNVENKKESQST---QNIQSY-ENKEIKN-----QEN 86

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
              P   N+  YE+ +  FN  +++N M +  +  +++NN P
Sbjct:    87 HPLQSNQN-YEQTNGNFNE-ENENAMTNVGESEVNYNNEP 124


>pir||A05236 hypothetical protein B-114 - Trypanosoma brucei mitochondrion
            (SGC6)
            Length = 114

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 1.2, P = 0.71
 Identities = 25/97 (25%), Positives = 45/97 (46%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIH 184
             F FL +  +I    K G + Y+ + + + + +Y +  +    L +C    FI+  II   
Sbjct:    28 FRFLYVYNVI---DKYGILFYSILRILLYVFWYVVRAFFDYILNICCVHEFIH-PIIWF- 82

Query:   185 MFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIY 295
                   F+S++ + II     FF F F++   CI I+
Sbjct:    83 ------FNSLLRMRIIRVILIFFNFIFLIPFFCIKIW 113


>sp|P39001|UME6_YEAST TRANSCRIPTIONAL REGULATOR UME6 (NEGATIVE TRANSCRIPTIONAL
            REGULATOR OF IME2) >pir||S61570 regulatory protein NIM2 - yeast
            (Saccharomyces cerevisiae) >gi|435118 (L24539) transcriptional
            regulator [Saccharomyces cerevisiae] >gnl|PID|e213790 (Z68194)
            Nim2p [Saccharomyces cerevisiae]
            Length = 836

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.2, P = 0.71
 Identities = 41/167 (24%), Positives = 66/167 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDS-TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +NK N      P+   ++NN  +N  N ++   D +  + NN I G       + +    
Sbjct:   260 ANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNNNEIGG-------YLRGGTK 312

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
               G   +   + HNV++    DQ        +  FN    D  +  P  K +D N   IN
Sbjct:   313 RGGSPSNDSQVQHNVHD----DQCAVGVAPRNFYFNK---DREITDPNVK-LDENESKIN 364

Query:   157 E--WPGDAHEKE---LNNIFVNKIKNNNDAQSY-KGINNKTIFLEENNDE--RYNQ 14
                W    +  E   LN    N   +N D  +  +  N  +     NN +  R+NQ
Sbjct:   365 ISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQ 420


>gnl|PID|d1005428 (D23663) NIM2 protein [Saccharomyces cerevisiae]
            Length = 836

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.2, P = 0.71
 Identities = 41/167 (24%), Positives = 66/167 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDS-TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +NK N      P+   ++NN  +N  N ++   D +  + NN I G       + +    
Sbjct:   260 ANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNNNEIGG-------YLRGGTK 312

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
               G   +   + HNV++    DQ        +  FN    D  +  P  K +D N   IN
Sbjct:   313 RGGSPSNDSQVQHNVHD----DQCAVGVAPRNFYFNK---DREITDPNVK-LDENESKIN 364

Query:   157 E--WPGDAHEKE---LNNIFVNKIKNNNDAQSY-KGINNKTIFLEENNDE--RYNQ 14
                W    +  E   LN    N   +N D  +  +  N  +     NN +  R+NQ
Sbjct:   365 ISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQ 420


>gi|479019 (L32186) car80 [Saccharomyces cerevisiae]
           Length = 836

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.2, P = 0.71
 Identities = 41/167 (24%), Positives = 67/167 (40%), Frame = -2

Query:   514 SNKGNTYVDEEPIDS-TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND 338
             +NK N      P+   ++NN  +N  N ++   D +  + NN I G       + +    
Sbjct:   260 ANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNNNEIGG-------YLRGGTK 312

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN--VP 164
               G   +   + HNV++    DQ        +  FN    D  +  P  K +D N   V 
Sbjct:   313 RGGSPSNDSQVQHNVHD----DQCAVGVAPRNFYFNK---DREITDPNVK-LDENESKVN 364

Query:   163 INEWPGDAHEKE---LNNIFVNKIKNNNDAQSY-KGINNKTIFLEENNDE--RYNQ 14
             I+ W    +  E   LN    N   +N D  +  +  N  +     NN +  R+NQ
Sbjct:   365 ISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQ 420


>sp|Q23868|TAGC_DICDI PRESTALK-SPECIFIC PROTEIN TAGC PRECURSOR >gi|1399915
            (U60086) multidrug resistance transporter/Ser protease
            [Dictyostelium discoideum]
            Length = 1743

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 1.2, Sum P(2) = 0.71
 Identities = 27/111 (24%), Positives = 56/111 (50%), Frame = -2

Query:   502 NTYVDEEPIDSTKNNR---NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N  +D     S KNN+   NDN +N+N+    ++ +N NNN             NNN+N 
Sbjct:    58 NEIIDTNNKPSIKNNQIFINDNDNNENISPILLRILNNNNN-------------NNNNN- 103

Query:   331 GEGQDIQNIHHNV--YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             G+ + I   +H +  + +   D+ +++ +E   G + +  +   +S +  ++ H++
Sbjct:   104 GDDKSIYKKNHYIVQFKDRINDETREQLKEFLIGTDIVLDEQPYQSHIVHYIPHDS 159

 Score = 55 (19.4 bits), Expect = 1.2, Sum P(2) = 0.71
 Identities = 21/69 (30%), Positives = 31/69 (44%), Frame = -2

Query:   220 HDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL-NNIFV---NKIKNNNDAQSYKGINNKT 53
             HD  M+     H   NN        +  E+EL NN+ +   N+  N N+ ++    NN  
Sbjct:  1671 HDELMERKGKYHRMFNN--------EKDEEELLNNLGLPSNNETNNENNNENNNNNNNNN 1722

Query:    52 IFLEENNDERYNQ 14
                  NND+  NQ
Sbjct:  1723 NNNNNNNDDNNNQ 1735


>pir||S61977 RLM1 protein - yeast (Saccharomyces cerevisiae) >gnl|PID|d1010303
            (D63340) Rlm1 [Saccharomyces cerevisiae] >gi|1151237 (U43281)
            Rlm1p,Lpg19p [Saccharomyces cerevisiae]
            Length = 676

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 1.3, P = 0.72
 Identities = 29/106 (27%), Positives = 48/106 (45%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKN-NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             N GN+      I ST N N N+N +N N    +  N N NN    S+  ++ ++ NN D 
Sbjct:   556 NNGNS----SNISSTNNTNNNNNNNNNNSSNNNSNNGNDNN----SNNSNNSYYSNNEDA 607

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNN----IQHDNTMKSPV 194
                G  I    H    ++    N   Y+  ++ +N       + NT ++P+
Sbjct:   608 PVNGAAISE--HTTDGDSNNQSNSSTYDAAATAYNGNTGLTPYINTAQTPL 656


>gnl|PID|e332342 (Y11183) 235kDa rhoptry protein [Plasmodium yoelii]
            Length = 127

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 1.3, P = 0.72
 Identities = 21/86 (24%), Positives = 45/86 (52%), Frame = -2

Query:   475 DSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             D  KN + + I N+N    ++Q IN+   I  ++  ++ +  + ND   +  D  +I+ N
Sbjct:     1 DDLKNKKQE-IENRN----NLQTINREQEITQTEHVNNTYHHDIND-INDINDTNDINQN 54

Query:   295 VYNNTPTDQNKKEYEEESSGFNNIQH 218
              + N+ +D  KK+Y +     N++++
Sbjct:    55 -HQNSSSD--KKDYSKTRDTGNSVKY 77


>gi|794253 (U10134) NADH dehydrogenase subunit 5 [Anopheles sundaicus]
           Length = 265

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.73
 Identities = 29/106 (27%), Positives = 54/106 (50%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHMFV-DRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +   F  IS  F+  D++  I   V      SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISLSLFF--ISLKFLLSDLVYFIEWEVLSLQCMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>sp|P15911|VFP3_FOWPV PROTEIN FP3 >pir||WMVZP3 F3 protein - fowlpox virus
            (strain HP444) >gnl|PID|d1000674 (D00320) FP3 [Fowlpox virus]
            Length = 96

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.4, P = 0.75
 Identities = 16/57 (28%), Positives = 34/57 (59%), Frame = +2

Query:   173 IMIHMFVDRTFHSIIMLYIIEAT*FFFI------FFFILISRCIIIYIMMYILYVLS 325
             I++ + ++  F S+I  ++I  + + F+        F+L+S  I  +I+MY+LY++S
Sbjct:    36 IILDLVLNLIFDSLITSFVIIYSLYSFVARNNKVLLFLLMSYAIFRFIVMYLLYIVS 92


>pir||S65062 fiber protein E6 (clone CKE6-4A) - upland cotton >gi|1000086
            (U30506) E6 [Gossypium hirsutum]
            Length = 241

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 1.5, P = 0.77
 Identities = 25/85 (29%), Positives = 42/85 (49%), Frame = -2

Query:   472 STKNNRNDNISNKNVH--KKDIQNIN--QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQN- 308
             STK N+N+N  N N++  K+ + +    +N       + ++ ++ N  DN   G   +N 
Sbjct:   155 STKENQNNNYYNGNINGEKQGMSDTRYLENGKYYYDVKSENSYYPNQLDN-SRGVASRNE 213

Query:   307 IHHNVYNNTPT-DQNKKEYEEESSGF 233
                N YNN     QN++E+EE    F
Sbjct:   214 FDENRYNNMGRYHQNQEEFEESEEEF 239


>gi|457146 (L27838) rhoptry protein [Plasmodium yoelii]
           Length = 2269

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 1.6, P = 0.81
 Identities = 50/174 (28%), Positives = 78/174 (44%), Frame = -2

Query:   508 KGNTYVDE----EPIDSTKNNRNDN-ISNK------NVHKKDIQNI-NQNNNIVGSDQXD 365
             K N Y+DE     P   T    N N I N        +++ DI    N+ ++IV  D  D
Sbjct:   141 KNNAYIDELANQSPYKVTGYIENKNTIYNTIKSYFDQIYEGDIDTFYNELSSIVKEDPID 200

Query:   364 DIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPV--- 194
             DI  K   +N     D      NVY+       K E E   S  NNI+ +N + + +   
Sbjct:   201 DIEDKTKLENLRSKID------NVYDKI----QKMEIETVKSHLNNIETNNKLPNTILEI 250

Query:   193 DKHM-DHNNVPINEWPGDAH--EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDER 23
              K++ D  +  +N+   D    EKEL+N   +  K       YK   +K + +  + + +
Sbjct:   251 KKYIYDEISKELNKMLEDFKNKEKELSNKISDYDKKREQLSEYK---SKMLEIRNHYNSQ 307

Query:    22 YNQENEK 2
              N +N K
Sbjct:   308 TNVDNTK 314


>gi|1216394 (U40265) ATPase subunit 6 [Trypanosoma cruzi]
            Length = 174

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 1.7, P = 0.81
 Identities = 32/145 (22%), Positives = 72/145 (49%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFI--NKYII*FLFMCISRPFIYRDII 175
             +F  L++ F  + F    F +Y FI LC+ ++ +F+  N Y +  L+ CI+    Y ++ 
Sbjct:    28 YFNCLLLIFDFLLFCL--FDLYLFIGLCLFLLLWFMLFNLYSL-ILYYCIT----YLNLY 80

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCII-IYIMMYILYVLSFTKIV---I 343
             ++   V   + S + L+       FF+F  +L+    + ++ + ++L  L    ++    
Sbjct:    81 LLFCIVFLYYMSFLFLFCFLLD--FFLFNNLLVGDNFMDVFFIRFLLCFLECFSLLCRCF 138

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIF 436
               F +    L+ SH ++++    + L+  +F
Sbjct:   139 ATFLRLFCNLLSSHFLLLM--FFDFLYFFLF 167


>sp|Q02510|LIP_STAEP LIPASE PRECURSOR (GLYCEROL ESTER HYDROLASE) >pir||A47705
            triacylglycerol lipase (EC 3.1.1.3) - Staphylococcus epidermidis
            >gi|153022 (M95577) lipase [Staphylococcus epidermidis]
            Length = 688

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 1.7, P = 0.82
 Identities = 37/163 (22%), Positives = 73/163 (44%), Frame = -2

Query:   502 NTYVDEEP-IDS-TKNN--RNDNISNKNV--HKKDIQNINQNNNIVGSDQXDDIFFKNNN 341
             N  V+E+  ++S T+N    N+   N+++   +KD QN N++ ++V  ++ +  F +N++
Sbjct:    68 NKNVNEKSNVNSITENESLHNETPKNEDLIQQQKDSQNDNKSESVVEQNKENGAFVQNHS 127

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             +   + + ++   H   NN  T  +K     E       Q DNT     D   +  N+  
Sbjct:   128 EEKPQQEQVELEKHASENNQ-TLHSKAAQSNEDVKTKPSQLDNTAAKQEDSQKE--NLSK 184

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSY-KGINNKTIFLEENNDE 26
              +         L     N+ K++   +   K +NN T  +   ND+
Sbjct:   185 QDTQSSKTTDLLRATAQNQSKDSQSTEEINKEVNNDTQQVTAKNDD 230


>gi|160727 (M96815) thrombospondin related anonymous protein [Plasmodium
           falciparum]
           Length = 562

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.7, P = 0.82
 Identities = 33/124 (26%), Positives = 58/124 (46%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDD-IFFK----NNNDNFGEG 323
             E P D  KN  +D   N ++ KK  +N + N N + +D+ D  I +     N  DN  + 
Sbjct:   374 EVPSDVPKNPEDDREENFDIPKKP-ENKHDNQNNLPNDKSDRYIPYSPLPPNVLDNERKQ 432

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFN---NIQHDNTMKSPVDKHMDHNNVPINEW 152
              D Q+  +N   + P  ++++      +  N   N +H+NT K P  +  +H     N+ 
Sbjct:   433 SDPQSQDNNGNRHVPNSEDRETRPHGRNNENRSYNRKHNNTPKHP--EREEHEKPDNNKK 490

Query:   151 PGDAHEK 131
              G++  K
Sbjct:   491 KGESDNK 497


>gi|160714 (M96807) thrombospondin related anonymous protein [Plasmodium
           falciparum]
           Length = 565

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.7, P = 0.83
 Identities = 33/124 (26%), Positives = 58/124 (46%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDD-IFFK----NNNDNFGEG 323
             E P D  KN  +D   N ++ KK  +N + N N + +D+ D  I +     N  DN  + 
Sbjct:   377 EVPSDVPKNPEDDREENFDIPKKP-ENKHDNQNNLPNDKSDRYIPYSPLPPNVLDNERKQ 435

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFN---NIQHDNTMKSPVDKHMDHNNVPINEW 152
              D Q+  +N   + P  ++++      +  N   N +H+NT K P  +  +H     N+ 
Sbjct:   436 SDPQSQDNNGNRHVPNSEDRETRPHGRNNENRSYNRKHNNTPKHP--EREEHEKPDNNKK 493

Query:   151 PGDAHEK 131
              G++  K
Sbjct:   494 KGESDNK 500


>sp|P24499|ATP6_TRYBB ATP SYNTHASE A CHAIN (PROTEIN 6)
            Length = 229

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 1.8, P = 0.83
 Identities = 33/167 (19%), Positives = 82/167 (49%), Frame = +2

Query:     2 FFIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFI--NKYII*FLFMCISRPFIYRDII 175
             +F  L++ F  + F    F +Y F+ LC+ ++ +F+  N Y +  L+ CI+    Y ++ 
Sbjct:    30 YFNCLMLIFDFLLFCL--FDLYLFVGLCLFLLLWFMLFNLYSL-ILYYCIT----YLNLY 82

Query:   176 MIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCII-IYIMMYILYVLSFTKIV---I 343
             ++   V   + + + L+       FF+F  +L+    + ++ + ++L  L    ++   +
Sbjct:    83 LLFCIVFLLYIAFLFLFCFLCD--FFLFNNLLVGDSFMDVFFIRFLLCFLECFSLLCRCL 140

Query:   344 IIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIFG*INWFLIYISI 502
               F +    L+ SH ++++       F + F   + +   +G   +F+++I +
Sbjct:   141 STFLRLFCNLLSSHFLLLM-------FFDFFYF-IFVFFFYGVFCYFILFIFV 185

 Score = 80 (28.2 bits), Expect = 2.3, P = 0.90
 Identities = 33/152 (21%), Positives = 71/152 (46%), Frame = +2

Query:     5 FIFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFY-------FINKYII*FLFMCISRPF-- 157
             ++ L + F I+F     F ++ F  LC   +F        F++ + I FL +C    F  
Sbjct:    78 YLNLYLLFCIVFLLYIAF-LFLFCFLCDFFLFNNLLVGDSFMDVFFIRFL-LCFLECFSL 135

Query:   158 IYRDI-IMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYILYVLSFTK 334
             + R +   + +F +      ++L   +   F F+FFF  +    I++I ++   +L +  
Sbjct:   136 LCRCLSTFLRLFCNLLSSHFLLLMFFDFFYFIFVFFFYGVFCYFILFIFVFCFCLLFYVF 195

Query:   335 IVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFI 439
             + ++     I+ L    N+I+ + I++ L   +F+
Sbjct:   196 LYLLDLFAAILQLFIFCNMILQL-IMDFLLFLLFV 229


>sp|P41696|AZF1_YEAST ASPARAGINE-RICH ZINC FINGER PROTEIN AZF1 >pir||S46593
            finger protein AZF1, asparagine-rich - yeast (Saccharomyces
            cerevisiae) >gi|525274 (Z26253) zinc finger protein of 101170 Da
            [Saccharomyces cerevisiae] >gi|1050816 (X90518) pid:e194977
            [Saccharomyces cerevisiae] >gnl|PID|e217740 (X94335) YOR3244w
            [Saccharomyces cerevisiae] >gnl|PID|e252013 (Z75021) ORF YOR113w
            [Saccharomyces cerevisiae]
            Length = 914

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 1.8, P = 0.83
 Identities = 28/114 (24%), Positives = 53/114 (46%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG 329
             K N   +++  DS+ NN N+N +N N      +N N NNN    D  D+      + N  
Sbjct:   348 KSNEVDNDDGNDSSNNNNNNNNNNNN------ENNNDNNN----DNNDNSINSATSTNIP 397

Query:   328 EGQDIQNIHHNVYNNTPTDQNKKEYEE-ESSGFNNIQHDNTMKSPVDKHMDHNNV 167
               +D     H++ +   T  ++K+ +E E     ++  ++   S + + +D N+V
Sbjct:   398 NQED-----HSLASTDTTSNSRKDLKEIEQRLRKHLNDEDNYSSAISRPLDKNDV 447

 Score = 85 (29.9 bits), Expect = 4.0, P = 0.98
 Identities = 29/119 (24%), Positives = 55/119 (46%), Frame = -2

Query:   502 NTYVDEEPI-DSTKNNRNDNISNK--NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N   + +P+ D+  NN     SN+  N    D  N N NNN   +++ ++    +NNDN 
Sbjct:   329 NNKANGDPVADNVTNNMKGK-SNEVDNDDGNDSSNNNNNNNNNNNNENNNDNNNDNNDNS 387

Query:   331 GEGQDIQNI----HHNVYNNTPTDQNKKEYEE-ESSGFNNIQHDNTMKSPVDKHMDHNNV 167
                    NI     H++ +   T  ++K+ +E E     ++  ++   S + + +D N+V
Sbjct:   388 INSATSTNIPNQEDHSLASTDTTSNSRKDLKEIEQRLRKHLNDEDNYSSAISRPLDKNDV 447


>sp|P14164|BAF1_YEAST TRANSCRIPTION FACTOR BAF1 (ARS BINDING FACTOR 1) (PROTEIN
            ABF1) (BIDIRECTIONALLY ACTING FACTOR) (SFB-B) (DNA REPLICATION
            ENHANCER-BINDING PROTEIN OBF1) >gi|58415 (X51654) ARS-binding
            protein 1 [Saccharomyces cerevisiae] >gi|170968 (M29067) ARS
            binding factor 1 [Saccharomyces cerevisiae] >gi|172058 (M63578)
            OBF1 [Saccharomyces cerevisiae] >prf||1604243A ARS binding factor I
            [Saccharomyces cerevisiae]
            Length = 731

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 1.8, P = 0.84
 Identities = 22/95 (23%), Positives = 46/95 (48%), Frame = -2

Query:   418 DIQNINQNNNIVGSD-QXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEES 242
             D+Q  + +NN   +D +      ++N+ ++ + Q+I +   +       + NK +  +++
Sbjct:   441 DLQPSSSSNNNNNNDGELSGTNLRSNSIDYAKHQEISSAGTSSNTTKNVNNNKNDSNDDN 500

Query:   241 SGFNNIQHDNTMKSPVDKHMDHNNVP-----INEW 152
             +G NN    N M+S +DK   H   P     +N+W
Sbjct:   501 NGNNNNDASNLMESVLDKTSSHRYQPKKMPSVNKW 535


>sp|P26694|CSP_PLARE CIRCUMSPOROZOITE PROTEIN PRECURSOR (CS) >pir||A39756
            circumsporozoite protein - Plasmodium reichenowi >gi|160229
            (M60972) circumsporozoite protein [Plasmodium reichenowi]
            Length = 388

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.8, P = 0.84
 Identities = 26/94 (27%), Positives = 41/94 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N +     N N N N   +   +     N N N    ++  N  +   +N 
Sbjct:   220 NANPN-ANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNRN--NEANGQGHNK 276

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             P DQN+     E++  NN   +N  + P DKH++
Sbjct:   277 PNDQNRNV--NENANANNAGRNNNNEEPSDKHIE 308


>sp|P40957|MAD1_YEAST SPINDLE ASSEMBLY CHECKPOINT COMPONENT MAD1 (MITOTIC MAD1
            PROTEIN) >pir||A57276 MAD1 protein - yeast (Saccharomyces
            cerevisiae) >gi|551092 (U14632) Mad1p [Saccharomyces cerevisiae]
            >gnl|PID|e243297 (Z72608) ORF YGL086w [Saccharomyces cerevisiae]
            Length = 749

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 1.9, P = 0.85
 Identities = 42/164 (25%), Positives = 82/164 (50%), Frame = -2

Query:   466 KNNRNDNISNKN-VHKKDIQNINQN---NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH 299
             +N + +NI  K+ + K +I N + +   NN+  +D  ++    NNNDN     D  N ++
Sbjct:   302 ENLQLENIDLKSKLTKWEIYNDSDDDDDNNVNNNDNNNNNKNDNNNDN---NNDTSN-NN 357

Query:   298 NVYNNTPTDQNKKEYEEES-SGFNNIQHDNTMKSPV-DK-HMDHNNVPI--NEWPGDAHE 134
             N+ NN  T  N +   EE    +   + +  + + + DK  +D+NN+ +  +E   + ++
Sbjct:   358 NINNNNRTKNNIRNNPEEIIRDWKLTKKECLILTDMNDKLRLDNNNLKLLNDEMALERNQ 417

Query:   133 -KELNNIFVNKIKN----NNDAQSYKGIN-NKTIFLEENNDERYNQEN 8
               +LN  + N I N    N++ +  K ++  +   L E  D  Y+ +N
Sbjct:   418 ILDLNKNYENNIVNLKRLNHELEQQKSLSFEECRLLREQLDGLYSAQN 465

 Score = 81 (28.5 bits), Expect = 9.6, P = 1.0
 Identities = 37/149 (24%), Positives = 70/149 (46%), Frame = -2

Query:   454 NDNISNK--NVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             N+ + NK   +H  + Q  N Q  NI    +       N++D+     D  N+++N  NN
Sbjct:   284 NEKLQNKLSQLHVLESQYENLQLENIDLKSKLTKWEIYNDSDD----DDDNNVNNNDNNN 339

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNK 104
                + N  +   ++S  NNI ++N  K+ +  + +     I +W     E  +     +K
Sbjct:   340 NNKNDNNNDNNNDTSNNNNINNNNRTKNNIRNNPEEI---IRDWKLTKKECLILTDMNDK 396

Query:   103 IKNNNDAQSYKGINNKTIFLEENN--DERYNQEN 8
             ++ +N+  + K +N++ + LE N   D   N EN
Sbjct:   397 LRLDNN--NLKLLNDE-MALERNQILDLNKNYEN 427


>gi|567922 (L36903) varI gene product [Saccharomyces cerevisiae]
           Length = 404

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.9, P = 0.86
 Identities = 43/148 (29%), Positives = 64/148 (43%), Frame = -2

Query:   451 DNISNK-NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT 275
             +NI  K N H   +  IN  NNI  +   + I   NNN+N     +I N  +N YNN   
Sbjct:   245 NNIMPKLNDHNISMNYINNINNINNNKYNNMINLLNNNNNNNNNNNINN--NNNYNN--- 299

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKS-PVDKHMDHNNVPIN-EWPGDAHEKELNNIFVNKI 101
               N   Y       NNI ++ T+ + P+D  M    V  + ++ G            N +
Sbjct:   300 --NNNNY---IGNINNIYNNMTIDNIPMDILMYKYLVGWSIKFKGRLSNNNGRTSTTNLL 354

Query:   100 KN--NNDAQSYKGINN--KTIFLEENNDERYNQEN 8
                 NN    +  INN  K  ++  N++  YN  N
Sbjct:   355 NGTFNNKKYLWSNINNNYKLNYIPSNHN-LYNNSN 388

 Score = 81 (28.5 bits), Expect = 4.4, P = 0.99
 Identities = 22/64 (34%), Positives = 37/64 (57%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV-YN 287
             NN N+N  N  ++  +  N N NNN + ++      + NNN+N+  G +I NI++N+  +
Sbjct:   265 NNINNNKYNNMINLLNNNNNNNNNNNINNNNN----YNNNNNNY-IG-NINNIYNNMTID 318

Query:   286 NTPTD 272
             N P D
Sbjct:   319 NIPMD 323

 Score = 81 (28.5 bits), Expect = 4.4, P = 0.99
 Identities = 22/64 (34%), Positives = 34/64 (53%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN N+N  N  ++  +  N N NNN + ++      + NNN+N+     I NI+ N+YNN
Sbjct:   265 NNINNNKYNNMINLLNNNNNNNNNNNINNNNN----YNNNNNNY-----IGNIN-NIYNN 314

Query:   283 TPTD 272
                D
Sbjct:   315 MTID 318

 Score = 80 (28.2 bits), Expect = 5.7, P = 1.0
 Identities = 41/168 (24%), Positives = 74/168 (44%), Frame = -2

Query:   511 NKGNT--YVDEEPIDSTKNNRNDNISNKNVHK-KDIQNINQNNNIVGSDQXDDIFFKNNN 341
             NK N   Y     I++  NN N+N     ++K  +I N N NNN+         ++ N  
Sbjct:   147 NKLNIKFYYYNNDINNNNNNNNNNYYMNMMNKLMNIMNNNMNNNLCNILS----YYYNKK 202

Query:   340 DNFGEGQDIQNIHHN--VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
                 E   +  I+ N  +++   +  +  +Y   +    N Q    + + + K  DHN +
Sbjct:   203 VTI-EPIKLSYIYLNSDIFSKYISLNDMDKYN--NGILTNYQR--MLNNIMPKLNDHN-I 256

Query:   166 PINEWPG--DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
              +N      + +  + NN+ +N + NNN+  +   INN   +   NN+   N  N
Sbjct:   257 SMNYINNINNINNNKYNNM-INLLNNNNNNNNNNNINNNNNYNNNNNNYIGNINN 310


>sp|P40070|USS1_YEAST U6 SNRNA-ASSOCIATED PROTEIN >pir||S50615 U6
            snRNA-associated protein USS1 - yeast (Saccharomyces cerevisiae)
            >gi|603351 (U18916) Uss1p: core protein of small nuclear
            ribonucleoprotein [Saccharomyces cerevisiae] >gi|695736 (X82649)
            pid:g695736 [Saccharomyces cerevisiae]
            Length = 187

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.0, P = 0.86
 Identities = 26/112 (23%), Positives = 48/112 (42%), Frame = -2

Query:   433 NVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEY 254
             N+  K  Q IN NNN   +      ++ N + N   G      ++N  NN   + N++ Y
Sbjct:    84 NIIDKVKQQINSNNNSNSNGPGHKRYYNNRDSNNNRG------NYNRRNNNNGNSNRRPY 137

Query:   253 EEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNKIK 98
              +    +NN    N   S ++  ++ NN  +N   G + +   N+    K++
Sbjct:   138 SQNRQ-YNNSNSSNINNS-INS-INSNNQNMNNGLGGSVQHHFNSSSPQKVE 186


>pir||S67087 hypothetical protein YOR195w - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e252389 (Z75103) ORF YOR195w [Saccharomyces cerevisiae]
            Length = 821

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 2.1, P = 0.88
 Identities = 46/175 (26%), Positives = 81/175 (46%), Frame = -2

Query:   478 IDSTKNNRNDN--ISNKNVHKKDIQNINQNN----NIVGSDQXDDIFFKNNNDN------ 335
             ID  + N + N  I N  V + D  NIN +     N +   Q ++ F K+N++N      
Sbjct:   193 IDMIETNISPNKFIINDGVERNDSFNINTDTLKLENDINEKQQEEDFIKSNSNNVVNIDN 252

Query:   334 -FGEGQDIQNIHHNVYNN--TPT-DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV 167
              + E +D +N   N + N  TP  + + +E      G N+   DN +       + H+N 
Sbjct:   253 AYKEKEDEENDITNSHINRLTPLYETSARESNSNEEGRNDYDDDNQLD------IRHDNF 306

Query:   166 PI----NEWPGDA--HEKELNNIFVNKIKNNNDAQSYKGIN-NKTIFLEENND--ERYNQ 14
              I    NE   D   H  ++ N  ++K  N + +  Y+ +N N  + ++  N+  ++ N 
Sbjct:   307 QIVAKRNEELTDQIYHLNQMLNSLISK--NESLSFQYEKLNKNHQLLIDLTNEKLDKLNT 364

Query:    13 ENE 5
             E E
Sbjct:   365 ERE 367


>pir||S28831 microtubule-associated protein H1 (clone KS18) - longfin squid
            (fragment) >prf||1908250A microtubule-associated protein
            H1:ISOTYPE=KS18 [Loligo pealei]
            Length = 359

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 2.1, P = 0.88
 Identities = 38/141 (26%), Positives = 64/141 (45%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-NFGEGQDIQNI 305
             P+    N+ N++  NK + KK + ++N  N+ + +     +   NN+  N    + + ++
Sbjct:   105 PMKKPVNHLNNSSLNKPM-KKSVNHLN--NSSLNNPMKKPVNHLNNSSLNNPMKKPVNHL 161

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             ++N  NN P    KK         NN   +N MK PV+ H+  NN  +N+ P       L
Sbjct:   162 NNNSLNN-PM---KKPVNH----LNNSSLNNPMKKPVN-HL--NNSSLNK-PMKKPVNHL 209

Query:   124 NNIFVNKIKNN--NDAQSYKGINN 59
             NN  +N       N   S   +NN
Sbjct:   210 NNSSLNNPMKKLVNHCSSNSSLNN 233

 Score = 82 (28.9 bits), Expect = 2.8, P = 0.94
 Identities = 36/144 (25%), Positives = 71/144 (49%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-NFGEGQDIQNI 305
             P+    N+ N++  NK + KK + ++N  N+ + +     +   NN+  N    + + ++
Sbjct:    73 PMKKPVNHLNNSSLNKPM-KKPVNHLN--NSSLNNPMKKPVNHLNNSSLNKPMKKSVNHL 129

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNN-----IQH--DNTMKSPVDKHMDH-NNVPINEWP 149
             +++  NN P    K      +S  NN     + H  +N++ +P+ K ++H NN  +N  P
Sbjct:   130 NNSSLNN-P--MKKPVNHLNNSSLNNPMKKPVNHLNNNSLNNPMKKPVNHLNNSSLNN-P 185

Query:   148 GDAHEKELNNIFVNK-IKNNNDAQSYKGINN 59
                    LNN  +NK +K   +  +   +NN
Sbjct:   186 MKKPVNHLNNSSLNKPMKKPVNHLNNSSLNN 216

 Score = 80 (28.2 bits), Expect = 4.9, P = 0.99
 Identities = 37/155 (23%), Positives = 70/155 (45%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-NFGEGQDIQNI 305
             P+    N+ N++  NK + KK + ++N  N+ + +     +   NN+  N    + + ++
Sbjct:    73 PMKKPVNHLNNSSLNKPM-KKPVNHLN--NSSLNNPMKKPVNHLNNSSLNKPMKKSVNHL 129

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN--NVPINEWPGDAHEK 131
             +++  NN P    KK         NN   +N MK PV+ H+++N  N P+ +     +  
Sbjct:   130 NNSSLNN-PM---KKPVNH----LNNSSLNNPMKKPVN-HLNNNSLNNPMKKPVNHLNNS 180

Query:   130 ELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
              LNN     + + N++   K +      L  NN    N
Sbjct:   181 SLNNPMKKPVNHLNNSSLNKPMKKPVNHL--NNSSLNN 216

 Score = 79 (27.8 bits), Expect = 6.3, P = 1.0
 Identities = 39/141 (27%), Positives = 66/141 (46%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNND-NFGEGQDIQNI 305
             P+    N+ N+N  N N  KK + ++N  N+ + +     +   NN+  N    + + ++
Sbjct:   153 PMKKPVNHLNNNSLN-NPMKKPVNHLN--NSSLNNPMKKPVNHLNNSSLNKPMKKPVNHL 209

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
             +++  NN P    KK     SS   N   +N MK PV+ H+  NN  +N  P       L
Sbjct:   210 NNSSLNN-PM---KKLVNHCSS---NSSLNNPMKKPVN-HL--NNSSLNN-PMKKPVNHL 258

Query:   124 NNIFVNK-IKNNNDAQSYKGINN 59
             NN  +NK +K   +  +   +NN
Sbjct:   259 NNSSLNKPMKKPANHLNNSSLNN 281


>pir||S54067 probable membrane protein YPR042c - yeast (Saccharomyces
            cerevisiae) >gnl|PID|e236901 (Z71255) unknown [Saccharomyces
            cerevisiae] >gnl|PID|e246768 (Z73616) hypothetical 119.5 kDa
            protein [Saccharomyces cerevisiae]
            Length = 1075

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 2.2, P = 0.88
 Identities = 36/131 (27%), Positives = 55/131 (41%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIF--FK-NNNDNFGEG-QDIQNI--HHNV 293
             N   +N+ V     QN NQN N  G D+ +  F  F+  N  N      ++ N+  ++N 
Sbjct:   939 NSYFNNQQVVYSGNQNQNQNGNSNGLDELNSQFDSFRIANGTNLSLPIVNLPNVSNNNNN 998

Query:   292 YNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIF 113
             YNN+             S  NN   +N   +  D + ++NN   N    + +    NN  
Sbjct:   999 YNNSGYSSQMNPLSRSVSHNNNNNTNNYNNNDNDNNNNNNNNNNNNNNNNNNNNNSNNSN 1058

Query:   112 VNKIKNNNDAQSYK 71
              N   NNND   Y+
Sbjct:  1059 NN---NNNDTSLYR 1069

 Score = 83 (29.2 bits), Expect = 8.4, P = 1.0
 Identities = 35/142 (24%), Positives = 57/142 (40%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNTPT 275
             N   +N+ V     QN NQN N  G D+ +  F     D+F       N+   + N    
Sbjct:   939 NSYFNNQQVVYSGNQNQNQNGNSNGLDELNSQF-----DSFRIANGT-NLSLPIVNLPNV 992

Query:   274 DQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP-INEWPGDAHEKELNNIFVNKIK 98
               N   Y   +SG+++        +P+ + + HNN    N +  + ++   NN   N   
Sbjct:   993 SNNNNNYN--NSGYSS------QMNPLSRSVSHNNNNNTNNYNNNDNDNNNNN---NNNN 1041

Query:    97 NNNDAQSYKGINNKTIFLEENND 29
             NNN+  +    N+       NND
Sbjct:  1042 NNNNNNNNNNNNSNNSNNNNNND 1064


>gi|1620042 (U42580) a370R [Paramecium bursaria Chlorella virus 1]
            Length = 82

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 2.2, P = 0.89
 Identities = 25/75 (33%), Positives = 39/75 (52%), Frame = +2

Query:    56 FVIYAFI*LCIIIIFYFINKYII*FLFMCISRPF-IYRDIIMIHMFV-DRTFHSIIMLY- 226
             F+IY  + + IIIIF  + K +  F F  I R    + + + +H +V D TF+ +   Y 
Sbjct:     5 FIIYRIVDVFIIIIF--VLKIVFCF-FNFIWRHIRSHSESVKVHQYVFDITFYDVFSEYA 61

Query:   227 --IIEAT*FF--FIFFFI 268
               I+     F  FI FF+
Sbjct:    62 LRIVPIRLSFSHFIIFFV 79


>gi|1262910 (U51645) cytidine triphosphate synthetase [Plasmodium falciparum]
            Length = 860

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 2.2, P = 0.89
 Identities = 39/155 (25%), Positives = 68/155 (43%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKK-DIQNINQNNNIVGSDQX--DDIFFKNNNDNFGEGQDIQN 308
             ID  +   N N +++      ++Q  +  NNI  SD    DD    NNNDN    +   N
Sbjct:   475 IDVAREYLNVNANSEEFEDTTEMQYTSHENNIADSDNYNKDD----NNNDNNQHAKKNPN 530

Query:   307 IHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVD-KHMDHNNVPINEWPGDAHEK 131
             + +  YN     + KK+ +E      N+++   +++  + ++++  +V INE        
Sbjct:   531 VTNCTYNEKEKKE-KKDKKENIINLENLENVENVENVENVENVNKTSVHINEICSQDTTA 589

Query:   130 ELNNIFVNKIKNNNDAQSYK------GINN--KTIFLEEN 35
                +I  N   N  +  SY        INN  K I  ++N
Sbjct:   590 SCISIKTNSSHNPKELASYTERQKHDNINNLKKEIHFDDN 629


>gi|794145 (X83690) MPT5=HTR1 gene product [Saccharomyces cerevisiae]
           Length = 812

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 11/42 (26%), Positives = 27/42 (64%), Frame = -3

Query:   513 VIKEILM*MRNQLIQPKIIEMTTLAIKMFIKRIFKILTKIII 388
             ++ E+   + N+L Q   ++ ++  ++ FIK++F+I+T  I+
Sbjct:   432 LLAELFNRLSNELCQLSCLKFSSNVVEKFIKKLFRIITGFIV 473

 Score = 64 (22.5 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 19/84 (22%), Positives = 34/84 (40%), Frame = -2

Query:   304 HHN---VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
             H+N   + N      NK  +    +  +N  H+N   +    H  H ++P N +   ++ 
Sbjct:   615 HNNLQTINNENKNPHNKNSHNHNHNHNHNHAHNNNNNNNQKSHTRHFSLPANAYHRRSNS 674

Query:   133 KELNNIFVNKIKNNNDAQSYKGINN 59
                NN F N+   +    S + I N
Sbjct:   675 SVTNN-FSNQYAQDQKIHSPQQIMN 698


>pir||S23684 hypothetical protein 1 - Plasmodium falciparum
            Length = 272

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 2.4, P = 0.91
 Identities = 35/129 (27%), Positives = 54/129 (41%), Frame = -2

Query:   466 KNNRNDNISN--KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQ-DIQNIHHN 296
             KN  + N  N  K VH  ++ ++N  NN+   +  + I   NNN   G      +  H +
Sbjct:   143 KNVGDKNSKNVIKCVHPYNMNSMNSMNNMNNMNNTNSICNINNNSRCGSKSFPYKETHVD 202

Query:   295 VYNNTPTDQNKKEYEE-ESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNN 119
                N P +  +   E  E S  N    ++  K   D H+D  +  +N  P  A     NN
Sbjct:   203 NKMNIPLETYEISSEILEKSKRNKNYFEDPFKYYTDIHVDDYSYGMNN-PYKAKNNNNNN 261

Query:   118 IFVNKIKNNNDAQ 80
                N   NNN+ +
Sbjct:   262 ---NNNSNNNNKE 271


>pir||S23467 hypothetical protein 2 - Plasmodium falciparum >gi|9939 (X63648)
            ORF 2 gene product [Plasmodium falciparum]
            Length = 749

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 2.5, P = 0.91
 Identities = 32/133 (24%), Positives = 59/133 (44%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVG-SDQXDDIFFKNNNDN---FGEG 323
             DE  +      +  N+  K  + KD+ +  +N NI+  ++  D  F K +N N   + + 
Sbjct:   185 DESNVKQELKQKAKNVGYKLYYYKDLIDKYKNRNIIPQTEMHDHDFHKEHNPNNAFYDKL 244

Query:   322 QDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGD 143
             +  Q  + N  NN   + +       ++  NN  ++N   + + K M+ NN  I+E    
Sbjct:   245 KKEQADYSNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNIQK-MNTNNRSIDE---- 299

Query:   142 AHEKELNNIFVNKIKNN 92
                   NN  + +IK N
Sbjct:   300 -----RNNYLMKQIKKN 311

 Score = 83 (29.2 bits), Expect = 5.5, P = 1.0
 Identities = 19/70 (27%), Positives = 33/70 (47%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +N  N   +    ++  NN N+N +N N +  +IQ +N NN  +  D+ ++   K    N
Sbjct:   254 NNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNIQKMNTNNRSI--DERNNYLMKQIKKN 311

Query:   334 FGEGQDIQNI 305
              G   D+  I
Sbjct:   312 KGNLNDVYTI 321


>gi|552200 (M63270) malaria antigen [Plasmodium falciparum]
           Length = 109

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 2.5, P = 0.92
 Identities = 31/109 (28%), Positives = 51/109 (46%), Frame = -2

Query:   334 FGEGQ-DIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             F  GQ  I+++++  +NN    +NK   EE+     +++ D   K   D+     +   +
Sbjct:     2 FKHGQIKIEDVNNENFNNEQM-KNKYNDEEKMDISKSLKSDFLEK---DQSQVITSEEDS 57

Query:   157 EWPGDAHEKELNNIFVN--KIKNNNDAQSYKGINNKTIFLEENND-ERYNQEN 8
             E      EK  NNI +   K+KNN++       NN     ++NND    N EN
Sbjct:    58 EMKSSCREKN-NNIKMGIPKMKNNSNYNKNDDNNNDDNNNDDNNDGNNNNDEN 109


>sp|P39016|MPT5_YEAST SUPPRESSOR PROTEIN MPT5 (HTR1 PROTEIN) >gnl|PID|d1005714
            (D26184) suppressor protein [Saccharomyces cerevisiae]
            >gnl|PID|d1005565 (D25541) HTR1 [Saccharomyces cerevisiae]
            >gi|1209471 (X83690) putative protein [Saccharomyces cerevisiae]
            Length = 834

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.5, Sum P(2) = 0.92
 Identities = 11/42 (26%), Positives = 27/42 (64%), Frame = -3

Query:   513 VIKEILM*MRNQLIQPKIIEMTTLAIKMFIKRIFKILTKIII 388
             ++ E+   + N+L Q   ++ ++  ++ FIK++F+I+T  I+
Sbjct:   407 LLAELFNRLSNELCQLSCLKFSSNVVEKFIKKLFRIITGFIV 448

 Score = 64 (22.5 bits), Expect = 2.5, Sum P(2) = 0.92
 Identities = 19/84 (22%), Positives = 34/84 (40%), Frame = -2

Query:   304 HHN---VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
             H+N   + N      NK  +    +  +N  H+N   +    H  H ++P N +   ++ 
Sbjct:   590 HNNLQTINNENKNPHNKNSHNHNHNHNHNHAHNNNNNNNQKSHTRHFSLPANAYHRRSNS 649

Query:   133 KELNNIFVNKIKNNNDAQSYKGINN 59
                NN F N+   +    S + I N
Sbjct:   650 SVTNN-FSNQYAQDQKIHSPQQIMN 673


>pir||A35349 H+-transporting ATP synthase (EC 3.6.1.34) protein 6 - Trypanosoma
            brucei mitochondrion (SGC6)
            Length = 214

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.7, P = 0.93
 Identities = 31/153 (20%), Positives = 75/153 (49%), Frame = +2

Query:     8 IFLIIPFIIIFFQKNGFVIYAFI*LCIIIIFYFI--NKYII*FLFMCISRPFIYRDIIMI 181
             + LI  F++       F +Y F+ LC+ ++ +F+  N Y +  L+ CI+    Y ++ ++
Sbjct:    35 LMLIFDFLLFCL----FDLYLFVGLCVFLLLWFMLFNLYSL-ILYYCIT----YLNLYLL 85

Query:   182 HMFVDRTFHSIIMLYIIEAT*FFFIFFFILISRCI--IIYIMMYILYVLSFTKIV--III 349
                V   + + + L+       FF+F  +L+      + +I   + ++  F+ +   +  
Sbjct:    86 FCIVFLLYIAFLFLFCFLCD--FFLFNNLLVGDSFMDVFFIRPLLCFLECFSLLCRCLST 143

Query:   350 FKKDIIXLI*SHNIIILV-NILNILFMNIFIANVVISIIF 466
             F +    L+ SH ++++  +    +F+  F+   ++ I F
Sbjct:   144 FLRLFCNLLSSHFLLLMFFDFFYFIFVFFFLWCFLLLIYF 183


>gi|294158 (M83161) circumsporozoite protein [Plasmodium falciparum]
           Length = 420

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 2.7, P = 0.93
 Identities = 40/139 (28%), Positives = 57/139 (41%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N +     N N N N  G+ Q  ++   + N N  E  +  N   N  N  
Sbjct:   276 NANPN-ANPNANPNANPNANPNKNNQGNGQGHNMP-NDPNRNVDENANANNAVKNNNNEE 333

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDA----HEKELNNIF 113
             P+D++ KEY  +    N+I   +T  SP       N + +   PG A     E E  N  
Sbjct:   334 PSDKHIKEYLTKIQ--NSI---STEWSPCSVTCG-NGIQVRIKPGSAGKPKDELEYENDI 387

Query:   112 VNKIKNNNDAQSYKGINNKTIFL 44
               KI       S   + N +I L
Sbjct:   388 EKKICKMEKCSSVFNVVNSSIGL 410


>pir||S64195 HTR1 protein - yeast (Saccharomyces cerevisiae) >gnl|PID|e243786
            (Z72700) ORF YGL178w [Saccharomyces cerevisiae]
            Length = 859

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.7, Sum P(2) = 0.93
 Identities = 11/42 (26%), Positives = 27/42 (64%), Frame = -3

Query:   513 VIKEILM*MRNQLIQPKIIEMTTLAIKMFIKRIFKILTKIII 388
             ++ E+   + N+L Q   ++ ++  ++ FIK++F+I+T  I+
Sbjct:   432 LLAELFNRLSNELCQLSCLKFSSNVVEKFIKKLFRIITGFIV 473

 Score = 64 (22.5 bits), Expect = 2.7, Sum P(2) = 0.93
 Identities = 19/84 (22%), Positives = 34/84 (40%), Frame = -2

Query:   304 HHN---VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHE 134
             H+N   + N      NK  +    +  +N  H+N   +    H  H ++P N +   ++ 
Sbjct:   615 HNNLQTINNENKNPHNKNSHNHNHNHNHNHAHNNNNNNNQKSHTRHFSLPANAYHRRSNS 674

Query:   133 KELNNIFVNKIKNNNDAQSYKGINN 59
                NN F N+   +    S + I N
Sbjct:   675 SVTNN-FSNQYAQDQKIHSPQQIMN 698


>sp|P24874|NULM_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 4L >pir||S26015 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4L - pig roundworm
            mitochondrion (SGC4) >gi|559489 (X54253) ND4L protein [Ascaris
            suum]
            Length = 77

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 2.9, P = 0.94
 Identities = 18/51 (35%), Positives = 31/51 (60%), Frame = +2

Query:     8 IFLIIPFIIIFF--QKNGFVIYA--FI*LCIIIIFYF-INKYII*FLFMCIS 148
             IF+ I F+ +FF  Q+  F++ +  FI + + I+F   +N+ +  F FMC S
Sbjct:     2 IFIFISFLSLFFKWQRLMFILISLEFIVMSLFILFSGDLNEMMF-FYFMCFS 52


>gi|695356 (M19879) calbindin 27 [Homo sapiens]
           Length = 61

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 2.9, P = 0.94
 Identities = 14/50 (28%), Positives = 27/50 (54%), Frame = -2

Query:   505 GNTYVDEEPIDST------KNNRNDNISNKNVHKKDIQNINQNNNIVGSD 374
             GN Y+DE  +D+       KN ++ +I+N   +KK+I  ++    +  +D
Sbjct:     2 GNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTD 51


>gi|854471 (Z49809) unknown [Saccharomyces cerevisiae]
           Length = 711

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 3.0, P = 0.95
 Identities = 33/154 (21%), Positives = 68/154 (44%), Frame = -2

Query:   490 DEEPIDSTKNNRNDNISNKNVHKKD----IQNI----NQNNNIVGSDQX--DDIFFKNNN 341
             DEE    + +   +N+ + N H+ D    I++I    +++ +   S+Q   DD  +K  N
Sbjct:   371 DEESQAESYSANAENVYHHNEHELDDKELIEDIESSDSESQSAQESEQGSEDDFEYKMKN 430

Query:   340 DNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             +     ++ +N   +       D   K   E+       + D+ ++S +DK+  H N   
Sbjct:   431 EK-STSEETENTSESRDQGFAKDAYTKNKVEQQENDEEPEKDDIIRSSLDKNF-HGNNNK 488

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTI 50
             +E+  +  E E +   V +    ND + Y  +  K++
Sbjct:   489 SEYSENVLENETDPAIVERENQINDVEGYD-VTGKSV 524


>gi|309064 (L20934) NADH dehydrogenase subunit 5 [Anopheles gambiae]
           Length = 580

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 3.1, P = 0.96
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLMDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>sp|P34854|NU5M_ANOGA NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5
            Length = 580

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 3.1, P = 0.96
 Identities = 29/106 (27%), Positives = 56/106 (52%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDII-MIHM-FVDRTFHSIIMLYIIEAT*FFFIFFF 265
             I FYF+    +  LF+ IS  F+  D++  I    +     SI+M ++ +     F+ F 
Sbjct:    10 ISFYFLMSISL-SLFL-ISLKFLLMDLVYFIEWEILSLQSMSIVMTFLFDWMSLMFMSFV 67

Query:   266 ILISRCIIIYIMMYIL--YVLSFTKIVIIIFKKDIIXLI*SHNIIILV 403
             +LIS  +I Y   Y+   Y ++   +++++F   ++ LI S N+I ++
Sbjct:    68 LLISSLVIFYSNQYMEEDYNINRFILLVLMFVMSMMMLIISPNLISIL 115


>gnl|PID|e276616 (Z81317) hypothetical protein [Schizosaccharomyces pombe]
            Length = 620

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 3.4, P = 0.97
 Identities = 38/182 (20%), Positives = 79/182 (43%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF 332
             N+  T  +    D  +N+       +++  KD +  +   +   + Q  ++   N+ +  
Sbjct:   355 NEAPTSSENIKADQPENSTKQENPEEDMQIKDAEEHSNLESTPAAQQTSEVEANNHQEKP 414

Query:   331 GEGQDIQNIHHNVYNNTP-TDQNKKEYEEESSGFNNI--QHDNTM-----KSPVDKHMDH 176
                  ++ I+ N  NNTP T+  + E EE ++   ++  Q + T      KS V+   + 
Sbjct:   415 SSLPAVEQINVNEENNTPETEGLEDEKEENNTAAESLINQEETTSGEAVTKSTVESSANE 474

Query:   175 NNVPINEWPGDAHEKELNNI---FVNKI--KNNNDAQSYKGINNKTIFLEENNDERYNQE 11
                  NE   +   K L N      N+   KNN ++++  G+ ++ I +E   D + N +
Sbjct:   475 EEAEPNEIIEENAVKSLLNQEGPATNEEVEKNNANSENANGLTDEKI-IEAPLDTKENSD 533

Query:    10 NEK 2
             ++K
Sbjct:   534 DDK 536


>gi|2367390 (U82512) random slug cDNA21 protein [Dictyostelium discoideum]
            Length = 515

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 3.4, Sum P(2) = 0.97
 Identities = 15/46 (32%), Positives = 25/46 (54%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +  NN N+N +N N +  +   IN N+N++ +   D     NNN+N
Sbjct:    59 NNNNNSNNNNNNNNNNNNNNNKINNNSNLILNSSVDSTTSSNNNNN 104

 Score = 80 (28.2 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 21/80 (26%), Positives = 37/80 (46%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN--FGEGQDIQNIHH 299
             +  NN N+N +N N +  +   IN N+N++ +   D     NNN+N    + Q  Q    
Sbjct:    59 NNNNNSNNNNNNNNNNNNNNNKINNNSNLILNSSVDSTTSSNNNNNKNSNDNQQPQQQPE 118

Query:   298 NV---YNNTPTDQNKKEYEE 248
              +    N    +++K  +EE
Sbjct:   119 EIEGELNRERLERDKMLHEE 138

 Score = 38 (13.4 bits), Expect = 3.4, Sum P(2) = 0.97
 Identities = 20/69 (28%), Positives = 37/69 (53%), Frame = -3

Query:   273 IRIKKNMKKNQVASIIYNMIIL*KVLSTNIWIII----MSL*MNGLEMHMKRN*IIYLLI 106
             +RI+  +  N+   + ++   L KV+ T++W I+    + L  N L+   K    I LL+
Sbjct:   288 LRIQ-TVANNKSTKLSFSNCWL-KVIPTDVWSILELRDLDLSANQLKKVSKS---IGLLV 342

Query:   105 K*KIIMM-HNHIKA 67
               K + + HN + A
Sbjct:   343 HLKRLRLNHNQLTA 356


>pir||S36956 cytochrome-c oxidase (EC 1.9.3.1) chain III - Herpetomonas
            mariadeanei mitochondrion (SGC6)
            Length = 288

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 3.5, P = 0.97
 Identities = 26/109 (23%), Positives = 54/109 (49%), Frame = +2

Query:    26 FIIIFFQKNGFVIYAFI*LCIIIIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTF 205
             F +IF   +G  ++ F+ L  + I +F+  +I  F+ +C    F++ D+  +  FV   F
Sbjct:     4 FRVIFVGVSG--VFLFLSLPAVCIVFFVVIWIG-FMILCFGS-FVFVDLGFVFFFVLGLF 59

Query:   206 HSIIMLYIIEAT*FFFIFFFILISRCIIIYIMMYIL--YVLSFTKIVIIIF 352
               + ++  +    F  IF F+   RC+    + +++  +VL F     ++F
Sbjct:    60 CILFLMCDLFCDIFRGIFDFVSFIRCLQYCFLWFVISEFVL-FVTFFAVVF 109


>sp|P13568|MDR_PLAFF MULTIDRUG RESISTANCE PROTEIN (CHLOROQUINE RESISTANCE
            PROTEIN) >pir||DVZQF multidrug resistance protein - Plasmodium
            falciparum >gi|9936 (X56851) P-glycoprotein homologue [Plasmodium
            falciparum] >gi|160399 (M29154) multidrug resistance protein
            [Plasmodium falciparum]
            Length = 1419

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 3.5, Sum P(2) = 0.97
 Identities = 35/142 (24%), Positives = 59/142 (41%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV 293
             S  NN N+N  N N +  +   IN   + +      D   KN N  +    + Q I  N 
Sbjct:   641 SDNNNNNNNDDNNNNNNNNNNKINNEGSYIIEQGTHDSLMKNKNGIYHLMINNQKISSNK 700

Query:   292 YNNTPTDQ---NKKE-YEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKE- 128
              +N   D    NK   Y++  +G N+  + N++    ++++ +N    N    +  EK  
Sbjct:   701 SSNNGNDNGSDNKSSAYKDSDTG-NDADNMNSLSIHENENISNNRNCKNTAENEKEEKVP 759

Query:   127 -LNNIFVNKIKNNNDAQS-YKGI 65
                 +F  K K  N+ +  YK I
Sbjct:   760 FFKRMFRRKKKAPNNLRIIYKEI 782

 Score = 39 (13.7 bits), Expect = 3.5, Sum P(2) = 0.97
 Identities = 11/30 (36%), Positives = 19/30 (63%), Frame = -2

Query:   103 IKNN-NDAQSYKGINNKTIFLEENNDERYNQ 14
             +KN+  + Q Y+  NN ++ L+ N +E  NQ
Sbjct:  1187 LKNDMTNFQDYQNNNNNSLVLK-NVNEFSNQ 1216


>sp|P53036|SAP4_YEAST SIT4-ASSOCIATING PROTEIN SAP4 >pir||S64251 SAP4 protein -
            yeast (Saccharomyces cerevisiae) >gnl|PID|e243890 (Z72751) ORF
            YGL229c [Saccharomyces cerevisiae] >gi|1345146 (U50562) Sap4p
            [Saccharomyces cerevisiae]
            Length = 818

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 3.6, P = 0.97
 Identities = 29/123 (23%), Positives = 60/123 (48%), Frame = -2

Query:   484 EPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNI 305
             E I  T++   D + ++N  +K ++N+N N+N + S+  +D   K NN++  +  D Q  
Sbjct:   466 EKIARTRDKCRDTL-DQNSLEKAMKNLNINDNTITSNTLED---KCNNNDSNDSNDNQKQ 521

Query:   304 HHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP--GDAHEK 131
               N+        + + Y    +  +NI  D+ M   +    +  N+ I + P  GD  + 
Sbjct:   522 KKNIKKKF---HDNELYSTFDTSDDNIDDDDDMSFEIPYVSETQNLKIRKNPTIGDLFKI 578

Query:   130 ELNNI 116
             +L+++
Sbjct:   579 KLHDL 583


>sp|P36123|SAP3_YEAST SIT4-ASSOCIATING PROTEIN SAP190 >gi|1345144 (U50561)
            Sap190p [Saccharomyces cerevisiae]
            Length = 1033

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 3.6, P = 0.97
 Identities = 34/145 (23%), Positives = 65/145 (44%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF-GEGQDIQN--IHHNVYNN 284
             ND  S+ +V    I+N + + +I+G  + ++ +    ND     G D  N  +++N +NN
Sbjct:   770 NDQESDDDV----IRN-SDSEDIIGDTEGNENYGNGENDELLSNGHDSGNMDLYYN-FNN 823

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNK 104
                ++N+++Y E S   N   ++N   +  D   D           D   K   + F +K
Sbjct:   824 NENEENEEDYAEYSDVDNKNYYNNVETNDDDYDSD-----------DGKSKSAESEFTDK 872

Query:   103 IKNNNDAQSYKGINNKTIFLEENNDERY 20
             I  + D  S    +N     +EN  +++
Sbjct:   873 ISEHRDGNSLYNEDN-----DENGSDKW 895


>pir||S43574 C05B5.3 protein (clone C05B5) - Caenorhabditis elegans
            Length = 364

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 3.8, P = 0.98
 Identities = 35/144 (24%), Positives = 60/144 (41%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN+N N SN+N+++ + Q   QN N+  S      FF N N         QN   N  N 
Sbjct:   122 NNQNQN-SNQNLNQNNFQ---QNQNLGASSG----FFNNQNQ--------QNSQQNQVNG 165

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV-PINEWPGDAHEKELNNIFVN 107
               +  + ++   ++SGF N Q+    ++      + N V P +    +   +     F N
Sbjct:   166 PTSGFSNQQTSNQNSGFFNNQNQQNGQN-FGNSGNQNGVNPYSGAFSNGQNQNQQGFFGN 224

Query:   106 KIKNNNDAQSY-KGINNKTIFLEENN 32
                N  ++    +G  N  I+ +  N
Sbjct:   225 NQNNQQNSNGQVQGSQNNQIWNQNQN 250


>pir||S38100 hypothetical protein YKR028w - yeast (Saccharomyces cerevisiae)
            >gi|486457 (Z28253) ORF YKR028w [Saccharomyces cerevisiae]
            Length = 1098

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 3.8, P = 0.98
 Identities = 34/145 (23%), Positives = 65/145 (44%), Frame = -2

Query:   454 NDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF-GEGQDIQN--IHHNVYNN 284
             ND  S+ +V    I+N + + +I+G  + ++ +    ND     G D  N  +++N +NN
Sbjct:   770 NDQESDDDV----IRN-SDSEDIIGDTEGNENYGNGENDELLSNGHDSGNMDLYYN-FNN 823

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKELNNIFVNK 104
                ++N+++Y E S   N   ++N   +  D   D           D   K   + F +K
Sbjct:   824 NENEENEEDYAEYSDVDNKNYYNNVETNDDDYDSD-----------DGKSKSAESEFTDK 872

Query:   103 IKNNNDAQSYKGINNKTIFLEENNDERY 20
             I  + D  S    +N     +EN  +++
Sbjct:   873 ISEHRDGNSLYNEDN-----DENGSDKW 895


>prf||1708291A thrombospondin related protein [Plasmodium falciparum]
            Length = 559

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 3.9, P = 0.98
 Identities = 39/165 (23%), Positives = 66/165 (40%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNVHKKDIQNINQN---NNIVGSDQXDDIFFKNNNDNFGEG 323
             V +EP D     R DN S +   +  I N  Q    N   G D+  + F  + N      
Sbjct:   295 VPDEPEDDQPRPRGDNSSVQKPEENIIDNNPQEPSPNPEEGKDENPNGFDLDENPENPPN 354

Query:   322 QDIQ----NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
              DI     NI  +     P+D  K   ++    F+        K P + H + NN+P ++
Sbjct:   355 PDIPEQKPNIPEDSEKEVPSDVPKNPEDDREENFD------IPKKPENLHDNQNNLPNDK 408

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDER-YNQENE 5
                +     L    ++  +  +D QS     N+ +   E+ + R + + NE
Sbjct:   409 SDRNIPYSPLPPKVLDNERKQSDPQSQDNNGNRHVPNSEDRETRPHGRNNE 459


>gi|1527182 (U67764) PfTRAP [Plasmodium falciparum]
            Length = 562

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 3.9, P = 0.98
 Identities = 43/168 (25%), Positives = 70/168 (41%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNIS----NKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNNDNF 332
             V +EP D     R DN S     +N+   + Q  + N  N   G D+  + F  + N   
Sbjct:   295 VPQEPEDDQPRPRGDNSSVQKPEENIIDNNPQEPSPNPPNPEEGKDENPNGFDLDENPEN 354

Query:   331 GEGQDIQ----NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVP 164
                 DI     NI  +     P+D  K   ++    F+        K P +KH + NN+P
Sbjct:   355 PPNPDIPQQEPNIPEDSEKEVPSDVPKNPEDDREENFD------IPKKPENKHDNQNNLP 408

Query:   163 INEWPGDAHEKELN-NIFVNKIKNNNDAQSYKGINNKTIFLEENNDER-YNQENE 5
              ++         L  N+  N+ K + D QS     N+ +   E+ + R + + NE
Sbjct:   409 NDKSDRYIPYSPLPPNVLDNERKQS-DPQSQDNNGNRHVPNSEDRETRPHGRNNE 462


>sp|P41001|TOP2_PLAFK DNA TOPOISOMERASE II
            Length = 1398

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 23/74 (31%), Positives = 40/74 (54%), Frame = -2

Query:   466 KNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYN 287
             K+N NDN +NK   + D  N N NNN   ++Q +D    + ++   +G   +N ++N  N
Sbjct:   258 KDNSNDNKNNKG--QNDNNNNNNNNNDENANQNNDNLDVSLSNEPADGTPTKNNNNN-NN 314

Query:   286 NTPTDQNKKEYEEE 245
             N   D+  K +E++
Sbjct:   315 NNDEDEIVKIHEKQ 328

 Score = 85 (29.9 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 24/75 (32%), Positives = 39/75 (52%), Frame = -2

Query:   499 TYVD---EEPIDSTKNNRNDNISNKNVHKKDIQNINQNN-NI---VGSDQXDDIFFKNNN 341
             +YVD   ++  +  KNN+  N +N N +  + +N NQNN N+   + ++  D    KNNN
Sbjct:   251 SYVDLYLKDNSNDNKNNKGQNDNNNNNNNNNDENANQNNDNLDVSLSNEPADGTPTKNNN 310

Query:   340 DNFGEGQD--IQNIH 302
             +N     +  I  IH
Sbjct:   311 NNNNNNDEDEIVKIH 325

 Score = 42 (14.8 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 11/44 (25%), Positives = 19/44 (43%), Frame = -2

Query:   145 DAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQ 14
             D+ E  +N + + K  N     S   +NN    L + +D   N+
Sbjct:  1248 DSSEFLVNTLNIKKNTNKKTTTSSNNVNNSKKRLRKADDLNSNE 1291


>gi|940755 (X85939) invasive associated protein [Listeria monocytogenes]
           Length = 90

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 3.9, P = 0.98
 Identities = 19/60 (31%), Positives = 28/60 (46%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             +NK NT  +    ++  NN N N  +KN +     N N N+N   ++Q       NNN N
Sbjct:    24 ANKTNTNTNT---NTNTNNTNTNTPSKNTNTNSNTNTNTNSN-TNANQGSS----NNNSN 75


>gi|343949 (J01525) var1(40.0) [Saccharomyces cerevisiae]
           Length = 396

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 4.3, P = 0.99
 Identities = 25/64 (39%), Positives = 38/64 (59%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNV-YN 287
             NN N NI+N N +   I  +N NNNI  ++      + NNN+N+  G +I NI++N+  +
Sbjct:   260 NNIN-NINN-NKYNNIINLLNNNNNINNNNN-----YNNNNNNY-IG-NINNIYNNITID 310

Query:   286 NTPTD 272
             N P D
Sbjct:   311 NIPID 315

 Score = 79 (27.8 bits), Expect = 7.3, P = 1.0
 Identities = 25/61 (40%), Positives = 33/61 (54%), Frame = -2

Query:   454 ND-NISNKNVHKKDIQNINQN--NNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             ND NIS   ++  +I NIN N  NNI+     ++    NNN N      I NI+ N+YNN
Sbjct:   250 NDHNISINYIN--NINNINNNKYNNIINLLNNNNNINNNNNYNNNNNNYIGNIN-NIYNN 306

Query:   283 TPTD 272
                D
Sbjct:   307 ITID 310


>sp|P51022|PNT1_DROME ETS-LIKE PROTEIN POINTED P1 (D-ETS-2) >pir||S33167 gene
            pointed-P1 protein - fruit fly (Drosophila melanogaster) >gi|288080
            (X69166) ETS like protein [Drosophila melanogaster]
            Length = 623

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 4.4, P = 0.99
 Identities = 32/141 (22%), Positives = 56/141 (39%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNF-GEGQDIQNIHHN 296
             +T NN    +S+       +   N     VG       ++ +++ NF   G +  N H  
Sbjct:   182 ATANNLVGALSSSTAASLGLGYFNDMAPFVGDANA---YYTDSDVNFFSSGYNTSNTHDR 238

Query:   295 VYNNTPTDQNKKEYEE-ESSGFNNIQHDNTMKSP-VDKHMDHNNVPINEWPGDAHEKELN 122
             + N+TP  Q + +      SG  +  ++N+M  P V +  + NN   N    + +    N
Sbjct:   239 INNSTPPQQQQSQQPTVNGSGSASSNNNNSMLPPAVQQSNNENN---NTSSSNTNNSSNN 295

Query:   121 NIFVNKIKNNNDAQSYKGINNKTI 50
             N       N+N   +    NN  I
Sbjct:   296 NNNSGGSNNSNAGSNNNNNNNNNI 319


>sp|Q60303|YY04_METJA HYPOTHETICAL PROTEIN MJECS04 >pir||D64516 hypothetical
            protein MJECS04 - Methanococcus jannaschii plasmid pURB801
            >gi|1500692 (L77119) M. jannaschii predicted coding region MJECS04
            [Methanococcus jannaschii]
            Length = 135

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 4.5, P = 0.99
 Identities = 20/71 (28%), Positives = 34/71 (47%), Frame = -2

Query:   463 NNRNDNISNK-NVHKKDIQNIN-QNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             N + DN  N+ N  KK+I+ I  + NN++ S+  D +  K  ND   +   +  + + + 
Sbjct:    37 NKKLDNFENELNFIKKEIERIQLEFNNVINSNNNDYVSKKELNDIVNQLNTLSTLVNGLI 96

Query:   289 NNTPTDQNKKE 257
              N     N KE
Sbjct:    97 INISHGNNLKE 107


>prf||1602249A SWI4 gene [Saccharomyces cerevisiae]
            Length = 1093

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 28/114 (24%), Positives = 44/114 (38%), Frame = -2

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NNNDN        +  HN+ NN   + N+    ++    +    +N   S   K +    
Sbjct:   229 NNNDNHTTMNFNNDTRHNLINNISNNSNQSTIIQQQKSIHENSFNNNY-SATQKPLQFFP 287

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +P N         +  N+ +N   NNND+ SY   N   +    NN+   N  N
Sbjct:   288 IPTN--------LQNKNVALNN-PNNNDSNSYSH-NIDNVINSSNNNNNGNNNN 331

 Score = 86 (30.3 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 38/163 (23%), Positives = 71/163 (43%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQN-NNIVGSDQXDDIFFKNNNDNF-----GEGQDIQNIH 302
             N +N N++  N +  D  + + N +N++ S   ++     NN+N      G  Q  Q  H
Sbjct:   291 NLQNKNVALNNPNNNDSNSYSHNIDNVINSSNNNN---NGNNNNLIIVPDGPMQSQQQQH 347

Query:   301 HNVY--NN-------TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWP 149
             H+ Y  NN       + T+ N K+  ++ +  N  Q  N  +  + +H      P+  W 
Sbjct:   348 HHEYLTNNFNHSMMDSITNGNSKKRRKKLNQSNEQQFYNQQEK-IQRHFKLMKQPLL-WQ 405

Query:   148 GDAHEKELNNIFV--NKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
                +  + +N +   N   NNN+  +  G ++  +F    ND   N  +
Sbjct:   406 SFQNPNDHHNEYCDSNGSNNNNNTIASNG-SSIEVFSSNENDNSMNMSS 453

 Score = 38 (13.4 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 6/18 (33%), Positives = 12/18 (66%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNV 428
             P D   +N+ DN +++N+
Sbjct:     2 PFDVLISNQKDNTNHQNI 19


>gi|666106 (X51606) regulatory protein SWI4 [Saccharomyces cerevisiae]
           Length = 1093

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 28/114 (24%), Positives = 44/114 (38%), Frame = -2

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NNNDN        +  HN+ NN   + N+    ++    +    +N   S   K +    
Sbjct:   229 NNNDNHTTMNFNNDTRHNLINNISNNSNQSTIIQQQKSIHENSFNNNY-SATQKPLQFFP 287

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +P N         +  N+ +N   NNND+ SY   N   +    NN+   N  N
Sbjct:   288 IPTN--------LQNKNVALNN-PNNNDSNSYSH-NIDNVINSSNNNNNGNNNN 331

 Score = 38 (13.4 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 6/18 (33%), Positives = 12/18 (66%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNV 428
             P D   +N+ DN +++N+
Sbjct:     2 PFDVLISNQKDNTNHQNI 19


>sp|P25302|SWI4_YEAST REGULATORY PROTEIN SWI4 (CELL-CYCLE BOX FACTOR, CHAIN
            SWI4) (ART1 PROTEIN) >pir||S50614 regulatory protein SWI4 - yeast
            (Saccharomyces cerevisiae) >gi|603350 (U18916) Swi4p: transcription
            factor [Saccharomyces cerevisiae]
            Length = 1093

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 28/114 (24%), Positives = 44/114 (38%), Frame = -2

Query:   349 NNNDNFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             NNNDN        +  HN+ NN   + N+    ++    +    +N   S   K +    
Sbjct:   229 NNNDNHTTMNFNNDTRHNLINNISNNSNQSTIIQQQKSIHENSFNNNY-SATQKPLQFFP 287

Query:   169 VPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQEN 8
             +P N         +  N+ +N   NNND+ SY   N   +    NN+   N  N
Sbjct:   288 IPTN--------LQNKNVALNN-PNNNDSNSYSH-NIDNVINSSNNNNNGNNNN 331

 Score = 38 (13.4 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 6/18 (33%), Positives = 12/18 (66%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNV 428
             P D   +N+ DN +++N+
Sbjct:     2 PFDVLISNQKDNTNHQNI 19


>sp|P34291|YKO3_CAEEL HYPOTHETICAL 45.3 KD PROTEIN C05B5.3 IN CHROMOSOME III
            >gi|1066879 (Z32679) C05B5.3 [Caenorhabditis elegans]
            Length = 417

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 4.6, P = 0.99
 Identities = 35/144 (24%), Positives = 60/144 (41%), Frame = -2

Query:   463 NNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNN 284
             NN+N N SN+N+++ + Q   QN N+  S      FF N N         QN   N  N 
Sbjct:   159 NNQNQN-SNQNLNQNNFQ---QNQNLGASSG----FFNNQNQ--------QNSQQNQVNG 202

Query:   283 TPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNV-PINEWPGDAHEKELNNIFVN 107
               +  + ++   ++SGF N Q+    ++      + N V P +    +   +     F N
Sbjct:   203 PTSGFSNQQTSNQNSGFFNNQNQQNGQN-FGNSGNQNGVNPYSGAFSNGQNQNQQGFFGN 261

Query:   106 KIKNNNDAQSY-KGINNKTIFLEENN 32
                N  ++    +G  N  I+ +  N
Sbjct:   262 NQNNQQNSNGQVQGSQNNQIWNQNQN 287


>sp|P46760|RT13_ACACA MITOCHONDRIAL RIBOSOMAL PROTEIN S13 >pir||S53856
            ribosomal protein S13 - Acanthamoeba castellanii mitochondrion
            (SGC6) >gi|562060 (U12386) ribosomal protein S13 [Acanthamoeba
            castellanii]
            Length = 119

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 4.6, P = 0.99
 Identities = 32/113 (28%), Positives = 58/113 (51%), Frame = -2

Query:   463 NNRNDNISN--KNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFG--EGQDI--QNIH 302
             +N+N NI +  K++H  +++ IN+   ++G D+ + +    N + F   + Q I   N+ 
Sbjct:    13 DNKNKNIFSALKDIHGVNLKKINKMGLVMGLDKFEKVS-SMNFELFSLIKKQAIFFYNLE 71

Query:   301 HN-VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAHEKEL 125
              N ++NN     NKK+  +  +G  +I     +K PV     H N    + P    +KEL
Sbjct:    72 ENKIFNNV----NKKKKIKNYTGMRHI-----LKLPVRGQRTHTNA---KTPSKNIKKEL 119


>gnl|PID|e349490 (Z82275) K01G12.b [Caenorhabditis elegans]
            Length = 245

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 4.6, P = 0.99
 Identities = 26/103 (25%), Positives = 49/103 (47%), Frame = -2

Query:   478 IDSTKNNRNDNISNKNVHKKDI-QNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             +DS+ NN  DN  N++ +  D+ QN  Q      +D  +   +  ++++  E  + ++  
Sbjct:     7 LDSS-NNSPDNADNEDENVTDVVQNAGQAE---ANDWNEPEDYDEDSEDEEEDYEEESDR 62

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNN 170
             +NV  N    +N+K   E+SS  +  + +   K P D   D  N
Sbjct:    63 NNVNGNADGGKNEKHGAEDSSKKDEQRDEARDKDPQDSREDVEN 106


>gi|2353256 (AF016024) cytochrome oxidase II [Trachymyrmex cf. saussurei]
            Length = 96

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 4.6, P = 0.99
 Identities = 15/59 (25%), Positives = 37/59 (62%), Frame = +2

Query:   296 IMMYILYV--LSFTKIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANVVISIIF 466
             +MM+++++  L  + ++++I+ K I   +  H +I ++  ++ +F+ IFIA   I I++
Sbjct:    26 MMMFLIFITTLILSIMIMMIYNKLINRFLLEHQLIEIIWTISPMFILIFIAIPSIKILY 84


>gi|1698593 (U61846) 3' end, includes homeodomain [Helobdella sp.]
            Length = 188

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 4.7, P = 0.99
 Identities = 15/42 (35%), Positives = 24/42 (57%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNN 389
             SN  N  +    +++  NN N+NI+N N++  +  N N NNN
Sbjct:   113 SNSNNNII----LNNNSNNNNNNINNNNININNSNNNNSNNN 150


>gnl|PID|e307036 (Y11396) erythrocyte binding protein [Plasmodium cynomolgi]
            Length = 1045

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 4.7, P = 0.99
 Identities = 40/172 (23%), Positives = 75/172 (43%), Frame = -2

Query:   505 GNTYVD--EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSD--QXDDI--FFKNN 344
             GN  V   EE  DS+ N     +   N + +  +N  +NNN+   D  Q +      K  
Sbjct:   732 GNKIVGSKEENEDSSVNKDGATVVGGNTNDRT-ENDTENNNLPAPDNKQSEGATPLSKTE 790

Query:   343 NDNFGEG--QDIQNIHHNVYN-NTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN 173
             N    E   +   +  H++ N N  ++++ ++++ E++   N + +    +  + H  H 
Sbjct:   791 NLELNERVHRTTNDTTHSLKNKNGGSEKDLQKHDFENNDMLNAEPNYGQTTDAEGH--HR 848

Query:   172 NVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             +   N+  G+   K +N     K  NNN   S+  +NN  + ++E      N   EK
Sbjct:   849 DSIQND-KGE-WRKHMNKGAFTKNPNNNHLNSHNNLNNGKLDIKEYKYRDVNATREK 903


>gi|2598948 (AF027143) zinc finger protein [Homo sapiens]
            Length = 74

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 4.8, P = 0.99
 Identities = 12/34 (35%), Positives = 19/34 (55%), Frame = +1

Query:   121 YLIPFHVHLQAIHL*GHYYDPYVCRQDFS*YYHV 222
             Y+   H+H Q +H+    Y  YVC ++FS   H+
Sbjct:    22 YISALHIH-QRVHMGEKCYKCYVCGKEFSQSSHL 54


>gi|393266 (M90693) glycerol ester hydrolase [Staphylococcus aureus]
           >prf||2110238A lipase [Staphylococcus aureus]
           Length = 682

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 5.0, P = 0.99
 Identities = 43/162 (26%), Positives = 77/162 (47%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGE-GQDI-QNIHH 299
             S +N+R  +  NK+  K D +    N NI    Q D    KNNN N  +  Q + Q I+ 
Sbjct:    92 SEENHRKTDDLNKDQLKDDKKASLNNKNI----QRDTT--KNNNANPSDVNQGLEQAIND 145

Query:   298 NVYNNTPTDQNKKEYE--EESSGFNNIQHDNTMK-SPVDKHMDHNNVP--INEWPGDAHE 134
                +   + Q  KE +  ++S+  NN+   + +K +P    +D  +    +NE   +  +
Sbjct:   146 GKQSKVASQQQSKEADNSQDSNANNNLPSQSRIKEAPSLNKLDQTSQREIVNETEIEKVQ 205

Query:   133 KELNNIFVNKIKN---NNDAQSYKGINNKTIFLEE-NNDERYNQENEK 2
              + NN   +KI N   NN+ +     + KT+ + +  N+++   E  K
Sbjct:   206 PQQNNQANDKITNYNFNNEQEVKPQKDEKTLSVSDLKNNQKSPVEPTK 253


>sp|P34855|NU5M_APIME NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >gi|829007
            (L06178) NADH dehydrogenase subunit 5 [Apis mellifera ligustica]
            Length = 554

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 5.0, P = 0.99
 Identities = 34/139 (24%), Positives = 75/139 (53%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFIL 271
             +IF  +N  ++    + I +  +++ +IM+ + +   F+ +I+L        +F   F+ 
Sbjct:   427 LIFNLMNFNLLGINLLMIYKLMVFK-MIMVGLIMGFNFYKLILL---NNKIGYFKMSFLF 482

Query:   272 ISRCIIIYIMMYI-LYVLSFTKIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANV 448
             ++   +IY ++Y  + ++ FT  V I  +K II ++ S  + + +NI  +   N+ I N+
Sbjct:   483 MN---LIYKIIYKKIIMMMFTYEVYI--EKSIIEILSSKFMSVTLNIYELKISNLMI-NI 536

Query:   449 VISIIFG*INWFLIYISISF 508
              ++I+   I + LIY+ I+F
Sbjct:   537 YLTILIYLI-YLLIYL-INF 554


>pir||S52967 NADH dehydrogenases chain 5 - honeybee mitochondrion (SGC4)
            Length = 554

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 5.0, P = 0.99
 Identities = 34/139 (24%), Positives = 75/139 (53%), Frame = +2

Query:    92 IIFYFINKYII*FLFMCISRPFIYRDIIMIHMFVDRTFHSIIMLYIIEAT*FFFIFFFIL 271
             +IF  +N  ++    + I +  +++ +IM+ + +   F+ +I+L        +F   F+ 
Sbjct:   427 LIFNLMNFNLLGINLLMIYKLMVFK-MIMVGLIMGFNFYKLILL---NNKIGYFKMSFLF 482

Query:   272 ISRCIIIYIMMYI-LYVLSFTKIVIIIFKKDIIXLI*SHNIIILVNILNILFMNIFIANV 448
             ++   +IY ++Y  + ++ FT  V I  +K II ++ S  + + +NI  +   N+ I N+
Sbjct:   483 MN---LIYKIIYKKIIMMMFTYEVYI--EKSIIEILSSKFMSVTLNIYELKISNLMI-NI 536

Query:   449 VISIIFG*INWFLIYISISF 508
              ++I+   I + LIY+ I+F
Sbjct:   537 YLTILIYLI-YLLIYL-INF 554


>gi|1468983 (U64830) protein tyrosine kinase [Dictyostelium discoideum]
            Length = 1338

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 5.1, Sum P(2) = 0.99
 Identities = 25/102 (24%), Positives = 44/102 (43%), Frame = -2

Query:   310 NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMK-SPVDKHMDHNNVPIN-EWPGDAH 137
             N HH+ + +   + ++      +SG      D+T+  SP       +    N   P   H
Sbjct:   447 NHHHHHHQHNHHNHHQGHNNINNSGHIRKSADDTVTLSPTLSSGSSSTSSSNPHHPNHNH 506

Query:   136 EKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENN--DERYNQ 14
             +K LNN  + K+      + Y+ I  K   +E+ N  DE Y++
Sbjct:   507 QKGLNNKTLEKLSCTRK-EIYELIEKKESLIEKQNLIDEGYSE 548

 Score = 64 (22.5 bits), Expect = 5.1, Sum P(2) = 0.99
 Identities = 19/50 (38%), Positives = 28/50 (56%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDI-QNINQNN---NIVGSDQXDDIFFKNNNDNF 332
             +  NN N++IS+ +    +   NIN NN   N V S+   +I   N+NDNF
Sbjct:   276 NNNNNNNNSISSPSSSINNSGNNINLNNSGNNNVNSNNNTNII-NNSNDNF 325


>gi|160712 (M96806) thrombospondin related anonymous protein [Plasmodium
           falciparum]
           Length = 559

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 5.1, P = 0.99
 Identities = 39/165 (23%), Positives = 65/165 (39%), Frame = -2

Query:   493 VDEEPIDSTKNNRNDNISNKNVHKKDIQNINQN---NNIVGSDQXDDIFFKNNNDNFGEG 323
             V +EP D     R DN + +   K  I N  Q    N   G  +  + F  + N      
Sbjct:   295 VPQEPEDDQPRPRGDNFAVEKPEKNIIDNNPQEPSPNPEEGKGENPNGFDLDENPENPPN 354

Query:   322 QDIQ----NIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINE 155
              DI     NI  +     P+D  K   ++    F+        K P +KH + NN+P ++
Sbjct:   355 PDIPERKPNIPEDSEKEVPSDVPKNPEDDREENFD------IPKKPENKHDNQNNLPNDK 408

Query:   154 WPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDER-YNQENE 5
                      L    ++  +  +D QS     N+ +   E+ + R + + NE
Sbjct:   409 SDRYIPYSPLPPKVLDNERKQSDPQSQDNNGNRHVPNSEDRETRPHGRNNE 459


>pir||JH0163 No-on-transient A protein form II - fruit fly (Drosophila
            melanogaster) >gi|157979 (M33496) no-on-transient A product form II
            [Drosophila melanogaster]
            Length = 698

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 5.1, P = 0.99
 Identities = 37/146 (25%), Positives = 57/146 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             + K N   D  P +  +     N  N+N      QN NQN  + G      +   N N N
Sbjct:    35 AQKQNDSADGGPAEKKQRFGGPNAQNQN------QNQNQNGGVTGGGGA--VGGPNQNKN 86

Query:   334 FG--EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             FG  +G  + N + N  NN   +QN+      +S  N   ++ T K+     +  NN P 
Sbjct:    87 FGNNKGGFVGNRNRN--NNRAGNQNRTFPGNNNS--NQKPNNETSKADGPNALAKNNEPA 142

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQS 77
                 G     +  N   N+ +  N  Q+
Sbjct:   143 TAAAGQNQANQNANKGQNQRQGQNQNQN 170


>gnl|PID|e1169961 (AJ002383) MybS protein [Dictyostelium discoideum]
            Length = 699

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 5.1, P = 0.99
 Identities = 26/88 (29%), Positives = 41/88 (46%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQX--DDIFFKNNNDNFGEGQDIQNIHH 299
             +  NN N+N +N N +  +  N N NNNI  S     ++  + NNN+N     +I N + 
Sbjct:   160 NNNNNNNNNNNNNNSNSNNNINNNNNNNIKRSYSAMMEENNYPNNNNN-NNNNNIINNNI 218

Query:   298 NVYNNTPTDQNKKEYEEESSGFNNIQHDN 212
             N   +  +  N    E++ S  N  Q  N
Sbjct:   219 NSSGSISSYSNNSCIEDDYSSENIAQIKN 247


>sp|Q04047|NONA_DROME NO-ON-TRANSIENT A PROTEIN >pir||JH0162 No-on-transient A
            protein form I - fruit fly (Drosophila melanogaster) >gi|157978
            (M33496) no-on-transient A product form I [Drosophila melanogaster]
            Length = 700

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 5.1, P = 0.99
 Identities = 37/146 (25%), Positives = 57/146 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             + K N   D  P +  +     N  N+N      QN NQN  + G      +   N N N
Sbjct:    35 AQKQNDSADGGPAEKKQRFGGPNAQNQN------QNQNQNGGVTGGGGA--VGGPNQNKN 86

Query:   334 FG--EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             FG  +G  + N + N  NN   +QN+      +S  N   ++ T K+     +  NN P 
Sbjct:    87 FGNNKGGFVGNRNRN--NNRAGNQNRTFPGNNNS--NQKPNNETSKADGPNALAKNNEPA 142

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQS 77
                 G     +  N   N+ +  N  Q+
Sbjct:   143 TAAAGQNQANQNANKGQNQRQGQNQNQN 170


>pir||A48334 no-on transient A protein - fruit fly (Drosophila melanogaster)
            >gi|7662 (X55902) Bj6 protein [Drosophila melanogaster]
            Length = 700

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 5.1, P = 0.99
 Identities = 37/146 (25%), Positives = 57/146 (39%), Frame = -2

Query:   514 SNKGNTYVDEEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             + K N   D  P +  +     N  N+N      QN NQN  + G      +   N N N
Sbjct:    35 AQKQNDSADGGPAEKKQRFGGPNAQNQN------QNQNQNGGVTGGGGA--VGGPNQNKN 86

Query:   334 FG--EGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPI 161
             FG  +G  + N + N  NN   +QN+      +S  N   ++ T K+     +  NN P 
Sbjct:    87 FGNNKGGFVGNRNRN--NNRAGNQNRTFPGNNNS--NQKPNNETSKADGPNALAKNNEPA 142

Query:   160 NEWPGDAHEKELNNIFVNKIKNNNDAQS 77
                 G     +  N   N+ +  N  Q+
Sbjct:   143 TAAAGQNQANQNANKGQNQRQGQNQNQN 170


>pir||B44863 R45 antigen - Plasmodium falciparum (fragment)
            Length = 319

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 5.3, P = 1.0
 Identities = 22/72 (30%), Positives = 38/72 (52%), Frame = -2

Query:   472 STKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHH-N 296
             S  N+++DN  + + HK D +  N NNN   +D  DD    + +D   E + +++    N
Sbjct:    24 SDHNHKSDNNKSDHNHKSDHKK-NNNNNDNKNDDNDD---SDASDAVDEDEILESYSDLN 79

Query:   295 VYNNTPTDQNKKE 257
              +N   T+QNK +
Sbjct:    80 KFNEMLTEQNKNK 92


>sp|P41453|LEF3_NPVAC LATE EXPRESSION FACTOR 3 >pir||A40677 late expression
            factor 3 - Autographa californica nuclear polyhedrosis virus
            >gi|349020 (L18873) late expression factor [Autographa californica
            nuclear polyhedrosis virus] >gi|559136 (L22858) late expression
            factor 3 [Autographa californica nuclear polyhedrosis virus]
            Length = 385

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 5.4, P = 1.0
 Identities = 42/151 (27%), Positives = 73/151 (48%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTKNNRNDNISNK-NVHKKDIQNINQNNNIVGSDQXDDIF--FKNNN 341
             N G   V  E +    N+  D +  + +V+ K + N+ +NN I GSD  +++F   K+N 
Sbjct:   145 NSGLYKVVFEVVYKNLNDDPDVVQVECSVNAKTLINLFKNN-IKGSDDINEVFKYLKDNE 203

Query:   340 DNFGEGQDI--QNIHH--NVYNN-TPTDQNKKEYEE--ESSGFNNIQHDNTMK---SPVD 191
             +       I  Q I +  NVY N    +  + E  E  ES  ++N+Q+    K   S  +
Sbjct:   204 NQIFTIYSIKCQQIFNGSNVYMNWNVVNSTRIELCEAKESEAYSNLQNCTNAKINISRSN 263

Query:   190 KHMDHNNVPINEWPGDAHEKEL-NNIFVNKIKNN 92
             KH+   NV  N    +  E ++ +N F+ + K++
Sbjct:   264 KHVASYNV--NVLKSELEENDMGDNKFIVQFKSD 295


>gi|1151158 (U43145) repeat organellar protein [Plasmodium chabaudi]
            Length = 1939

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 5.5, P = 1.0
 Identities = 37/169 (21%), Positives = 76/169 (44%), Frame = -2

Query:   508 KGNTYVDEEPIDSTKNNRN--DNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDN 335
             K NTY + E + +    R   D++  +N+ + D++    N  +  S +  +    + NDN
Sbjct:  1171 KENTYKNSEMVVNENKERIIVDSVCKENISESDVEGKGGNLKMTLSLKKKERNIFSINDN 1230

Query:   334 FGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDH-NNVPIN 158
               E  ++ +   + Y N   +  KKE E+      ++++     S    ++++  NV  +
Sbjct:  1231 KNESSELVDTIKSAYINK-IEMYKKEIEDNGKNIEDLKNKILDLSNELINLENMKNVLTD 1289

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENEK 2
             E      E E+ +  +N+ K  N+      +N+  I L++   E +  E EK
Sbjct:  1290 ENNNLKKEIEIKDNKLNE-KEKNENTEILNLNDDIIKLKKEISE-WKDEEEK 1339


>gi|552190 (M57498) circumsporozoite protein [Plasmodium falciparum]
           Length = 393

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 5.5, P = 1.0
 Identities = 25/94 (26%), Positives = 41/94 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N +     N N N N   +   +     N N N    ++ Q   +   +N 
Sbjct:   225 NANPN-ANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQG--NGQGHNM 281

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             P D N+    +E++  NN   +N  + P DKH++
Sbjct:   282 PNDPNRNV--DENANANNAVKNNNNEEPSDKHIE 313


>sp|P16463|F801_SCHMA FEMALE SPECIFIC 800 PROTEIN (FS800) >gi|160990 (J03999)
            female-specific 800 protein [Schistosoma mansoni]
            Length = 238

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 5.7, P = 1.0
 Identities = 28/118 (23%), Positives = 48/118 (40%), Frame = -2

Query:   358 FFKNNNDNFGEGQDIQNIHHNVYNNTPTD-QNKKEYEE-ESSGFNNIQHDNTMKSPVDKH 185
             ++ NNN N    Q+  + HH   NN   + Q+K  + E E + +N    +N      D++
Sbjct:    24 YYDNNNQN----QNQYSYHHTYNNNNQGNYQSKNVHSESEQNSYNKETRNNNDDDDDDEN 79

Query:   184 MDHNNVPINEWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQENE 5
              + N   I       H     N  +    N+    SY   +  T F   +  +RY + N+
Sbjct:    80 FERNKKSIRS---RYHGYTYRNDQIQSRGNSAKGGSY---SESTYFTLHSGTDRYGRRND 133

 Score = 76 (26.8 bits), Expect = 7.5, P = 1.0
 Identities = 43/158 (27%), Positives = 65/158 (41%), Frame = -2

Query:   469 TKNNRND-NISNKNVHKKDIQN-INQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHN 296
             T NN N  N  +KNVH +  QN  N+       D  DD  F+ N       + I++ +H 
Sbjct:    40 TYNNNNQGNYQSKNVHSESEQNSYNKETRNNNDDDDDDENFERNK------KSIRSRYHG 93

Query:   295 -VYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPINEWPGDAH---EKE 128
               Y N   DQ +        G  +     T+ S  D++   N+    +  G ++   E  
Sbjct:    94 YTYRN---DQIQSRGNSAKGGSYSESTYFTLHSGTDRYGRRNDYSRFQTRGRSNGYRENM 150

Query:   127 LNNIF--VNKIKNN-NDAQSYKGINNKTIFLEE--NNDERYNQENEK 2
               N+F  V  IK   N  +  K   N     ++  NN +     NEK
Sbjct:   151 FLNVFDVVGNIKTTRNKRKITKSEKNGRYIKKDHMNNRDSNTNINEK 197


>sp|Q05854|YL78_YEAST PUTATIVE 151.3 KD TRANSCRIPTIONAL REGULATORY PROTEIN
            >pir||S50366 probable membrane protein YLR278c - yeast
            (Saccharomyces cerevisiae) >gi|596040 (U17243) Serine, glutamine,
            asparagine rich central portion of protein [Saccharomyces
            cerevisiae]
            Length = 1341

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 5.8, Sum P(2) = 1.0
 Identities = 28/109 (25%), Positives = 49/109 (44%), Frame = -2

Query:   337 NFGEGQDIQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHNNVPIN 158
             +F   Q+ +N+  NV NN            E +  +N  +DN   +  + +  +NN  +N
Sbjct:   888 SFPSSQE-KNLKINV-NNDNNGMTISSVNREHNNNHNNNNDNNNNNNNNNNNSNNNNNVN 945

Query:   157 EWPGDAHEKELNNIFVNKIKNNNDAQSYKGINNKTIFLEENNDERYNQE 11
                 +++ +   N   N   N N++Q Y   NN T+   EN+ ER  Q+
Sbjct:   946 NNDNESNSRSTTN---NSCNNGNNSQ-YVRNNNVTM---ENDVERPIQD 987

 Score = 53 (18.7 bits), Expect = 5.8, Sum P(2) = 1.0
 Identities = 19/51 (37%), Positives = 21/51 (41%), Frame = -2

Query:   511 NKGNTYVDEEPIDSTK--NNRNDNISNKNVHKKDIQ----NINQNNNIVGS 377
             N  N  +   P  S K   N N+N SN N    D      NIN NN I  S
Sbjct:   216 NSSNMVILPLPSPSNKPLENTNNNGSNVNAATNDTSASTNNINNNNAICQS 266


>gi|294134 (M83172) circumsporozoite protein [Plasmodium falciparum]
           Length = 416

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 6.0, P = 1.0
 Identities = 25/94 (26%), Positives = 41/94 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N +     N N N N   +   +     N N N    ++ Q   +   +N 
Sbjct:   248 NANPN-ANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQG--NGQGHNM 304

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             P D N+    +E++  NN   +N  + P DKH++
Sbjct:   305 PNDPNRNV--DENANANNAVKNNNNEEPSDKHIE 336


>sp|Q04978|YMF3_YEAST HYPOTHETICAL 23.9 KD PROTEIN IN CYB2-SUR7 INTERGENIC
            REGION >pir||S49807 hypothetical protein YML053c - yeast
            (Saccharomyces cerevisiae) >gi|577143 (Z46729) unknown
            [Saccharomyces cerevisiae]
            Length = 212

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 6.0, P = 1.0
 Identities = 25/73 (34%), Positives = 34/73 (46%), Frame = -2

Query:   469 TKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVY 290
             +K  + D++S K        N+N NNN        +I   NNN+N     +  N +HN  
Sbjct:    55 SKRTKRDSVSTKFSVGSGCANLNNNNN--------NIIINNNNNN---NNNNNNHNHNNS 103

Query:   289 NNTPTDQN---KKEYE 251
             NNT T  N   KK  E
Sbjct:   104 NNTATYNNIHYKKNIE 119


>sp|P15305|DYHC_ONCMY DYNEIN HEAVY CHAIN (DYHC) >pir||S09598 dynein heavy chain
            - rainbow trout (fragment) >gi|64319 (X15476) dynein (515 AA)
            [Oncorhynchus mykiss]
            Length = 515

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 6.1, P = 1.0
 Identities = 35/128 (27%), Positives = 59/128 (46%), Frame = +1

Query:     7 HFLDYTFHHYFLPKKWFCYLCLYMIVHHYYFLFY*QIYYLIPFHVHLQAIHL*GHYYDPY 186
             H + Y+ H   + +    ++  Y I+H   +  +  I Y I  HV   +IH+    Y  +
Sbjct:   380 HVIQYSIH---VIQYSILHVIQYSILHVIQYSIH-VIQYSI-LHVIQYSIHV--IQYSIH 432

Query:   187 VCRQDFS*YYHVVYY*SHLI---LLHILFYSDQ*VYYYIHYDVYFVCLVLHQNCHYYF*K 357
             V +       HV+ Y  H+I   +LH++ YS   + Y IH   Y +  V+  + H     
Sbjct:   433 VIQYSI---LHVIQYSIHVIQYSILHVIQYSIHVIQYSIHVIQYSILHVIQYSIHVI--- 486

Query:   358 RYHXLDLIPQY 390
             +Y  L +I QY
Sbjct:   487 QYSILHVI-QY 496


>gi|552191 (M57499) circumsporozoite protein [Plasmodium falciparum]
           Length = 424

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 6.1, P = 1.0
 Identities = 25/94 (26%), Positives = 41/94 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N +     N N N N   +   +     N N N    ++ Q   +   +N 
Sbjct:   256 NANPN-ANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQG--NGQGHNM 312

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             P D N+    +E++  NN   +N  + P DKH++
Sbjct:   313 PNDPNRNV--DENANANNAVKNNNNEEPSDKHIE 344


>gi|294129 (M83169) circumsporozoite protein [Plasmodium falciparum] >gi|294140
           (M83149) circumsporozoite protein [Plasmodium falciparum]
           Length = 424

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 6.1, P = 1.0
 Identities = 25/94 (26%), Positives = 41/94 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N +     N N N N   +   +     N N N    ++ Q   +   +N 
Sbjct:   256 NANPN-ANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQG--NGQGHNM 312

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             P D N+    +E++  NN   +N  + P DKH++
Sbjct:   313 PNDPNRNV--DENANANNAVKNNNNEEPSDKHIE 344


>sp|P13814|CSP_PLAFT CIRCUMSPOROZOITE PROTEIN PRECURSOR (CS) >pir||A54533
            circumsporozoite protein - Plasmodium falciparum (strain T4,
            Thailand) >gi|160217 (M19752) circumsporozoite protein [Plasmodium
            falciparum]
            Length = 424

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 6.1, P = 1.0
 Identities = 25/94 (26%), Positives = 41/94 (43%), Frame = -2

Query:   460 NRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIHHNVYNNT 281
             N N N +N N +     N N N N   +   +     N N N    ++ Q   +   +N 
Sbjct:   256 NANPN-ANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQG--NGQGHNM 312

Query:   280 PTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMD 179
             P D N+    +E++  NN   +N  + P DKH++
Sbjct:   313 PNDPNRNV--DENANANNAVKNNNNEEPSDKHIE 344


>pir||S28832 microtubule-associated protein H1 (clone KS3.1) - longfin squid
            (fragment) >prf||1908250B microtubule-associated protein
            H1:ISOTYPE=KS3.1 [Loligo pealei]
            Length = 292

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 6.2, P = 1.0
 Identities = 36/155 (23%), Positives = 71/155 (45%), Frame = -2

Query:   481 PIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIFFKNNNDNFGEGQDIQNIH 302
             P+    N+ N N S  N  KK + ++N  N+ + +     +   N+ +N    + ++   
Sbjct:    51 PMKKLVNHCNSNSSLNNPMKKPVNHLN--NSSLNNPMKKPV---NHLNNSSLNKPMKKPA 105

Query:   301 HNVYNNTPTDQNKKEYEEESSGFNNIQHDNTMKSPVDKHMDHN--NVPINEWPGDAHEKE 128
             +++ N++  +  KK         NN   +  MK PV+ H++++  N P+ +     +   
Sbjct:   106 NHLNNSSLNNPMKKPVNH----LNNSSLNKPMKKPVN-HLNNSSLNNPMKKLVNHFNSNS 160

Query:   127 -LNNIF--VNKIKNNNDAQSYKGINNKTIFLEENNDERYN 17
              LNN+   VN +KNN+     K +     +L  N+    N
Sbjct:   161 SLNNMKKPVNHLKNNSSLN--KPMKKLVNYLNNNSSSLNN 198


>sp|Q02653|ATP8_PODAN ATP SYNTHASE PROTEIN 8 >gi|1334563 (X55026) ATPase 8
            [Podospora anserina]
            Length = 50

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 6.2, P = 1.0
 Identities = 12/46 (26%), Positives = 27/46 (58%), Frame = +2

Query:    89 IIIFYFINKYII*FLFMCISRPFIYRDII--MIHMFVDRTFHSIIM 220
             ++ FYF+N+    F+ + I+   + + I+   + +F+ RTF S ++
Sbjct:     4 LVPFYFVNEITFTFIILAITVYILSKYILPRFVRLFLSRTFISKLL 49


>gi|994809 (Z37724) pid:e118903 [Plasmodium falciparum]
           Length = 664

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 6.3, P = 1.0
 Identities = 31/111 (27%), Positives = 55/111 (49%), Frame = -2

Query:   487 EEPIDSTKNNRNDNISNKNVHKKDIQNINQNNNIVGSDQXDDIF-FKNNN--DNFGEGQD 317
             + P+ +  +    + S+KN   +    IN  +NI  ++   ++F F ++N  +  GEG  
Sbjct:   547 QSPLFNNLSTEGYDSSSKN---RRTPRINAPSNIHNNNDSSNVFSFDHDNYHNEGGEGS- 602

Query:   316 IQNIHHNVYNNTPTDQNKKEYEEESSGFNNIQHDNT-MKSPVDKHMDHN-NVPINE 155
                 +++ Y N   D  + EY  E    NN +  N  +KSP D  + +N +  INE
Sbjct:   603 FDQAYYDEYTNEKYDNEENEYHTEYIENNNDEDTNGYIKSPND--LTYNTDSSINE 656


WARNING:  HSPs involving 31 database sequences were not reported due to the
          limiting value of parameter B = 250.


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.94
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.361   0.164   0.552
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.369   0.176   0.577
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.361   0.170   0.711
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.451   0.206    1.24
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.304   0.127   0.359    same    same    same
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.356   0.161   0.490
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      171       170      10. 62 3  12 22    0.11 34
                                                  31    0.11 37
   +2      0      171       170      10. 62 3  12 22    0.11 34
                                                  31    0.11 37
   +1      0      171       170      10. 62 3  12 22    0.11 34
                                                  31    0.11 37
   -1      0      171       170      10. 62 3  12 22    0.11 34
                                                  31    0.11 37
   -2      0      171       170      10. 64 3  12 23    0.12 35
                                                  31    0.11 37
   -3      0      171       170      10. 62 3  12 22    0.11 34
                                                  31    0.11 37


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  281
  No. of states in DFA:  590 (58 KB)
  Total size of DFA:  201 KB (256 KB)
  Time to generate neighborhood:  0.02u 0.00s 0.02t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  130.63u 0.59s 131.22t  Elapsed: 00:00:37
  Total cpu time:  131.84u 0.66s 132.50t  Elapsed: 00:00:39
  Start:  Sat Feb  7 00:21:36 1998   End:  Sat Feb  7 00:22:15 1998

WARNINGS ISSUED:  1

Date: 16:16:32 on Sun 17 Dec 117.