blastx_gbnr_files/1200665_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1200665
        (663 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A sp|P31380|YAB9_YEAST HYPOTHETICAL 128.5 KD HELICASE IN... -1   158  7.3e-12   3
A sp|P32863|RA54_YEAST DNA REPAIR AND RECOMBINATION PROT... -1   177  1.1e-11   1
A gi|2213862           (AF003086) PfSNF2L [Plasmodium fa... -1   133  8.1e-11   2
A pir||A56559          enhancer-trap-locus-1 protein - m... -1   158  2.1e-10   2
A gnl|PID|d1021605     (AB002307) KIAA0309 [Homo sapiens]   -1   155  1.4e-09   2
A sp|P41410|RA54_SCHPO DNA REPAIR PROTEIN RAD54 >pir||S4... -1   158  6.6e-09   1
A gnl|PID|e325327      (Z97208) Rad54p [Schizosaccharomy... -1   158  6.6e-09   1
A sp|P53115|YGP0_YEAST HYPOTHETICAL 171.5 KD HELICASE IN... -1   129  2.2e-08   2
A sp|P40352|RA26_YEAST DNA REPAIR AND RECOMBINATION PROT... -1   143  5.0e-08   2
A gi|550429            (X81635) RAD26 [Saccharomyces cer... -1   143  5.0e-08   2
A gnl|PID|e349022      (Z54236) C27B7.4 [Caenorhabditis ... -1   145  9.4e-08   2
A gnl|PID|e334244      (Z98595) hypothetical protein [Sc... -1   143  1.2e-07   2
A pir||S51910          cryptogene protein G4 - Sauroleis... +1   126  2.1e-07   1
A pir||S62430          RAD8 protein - fission yeast (Sch... -1   125  2.2e-07   2
A sp|P36607|RAD8_SCHPO DNA REPAIR PROTEIN RAD8 >pir||S41... -1   125  2.5e-07   2
A gi|2306766           (U75653) zinc finger helicase [Ho... -1   130  6.5e-07   2
A sp|Q03468|ERC6_HUMAN EXCISION REPAIR PROTEIN ERCC-6 >p... -1   147  6.9e-07   1
A pir||I54367          X-linked nuclear protein - human ... -1   130  1.1e-06   2
A gi|1905887           (U92461) putative recombination f... -1   142  1.3e-06   1
A pir||JC4666          lymphocyte specific helicase - mo... -1   141  1.3e-06   1
A gnl|PID|e246056      (X97795) RAD54 gene product [Homo... -1   142  1.3e-06   1
A pir||S70099          hypothetical protein YDR334w - ye... -1   133  1.6e-06   2
A gnl|PID|e246057      (X97796) RAD54 gene product [Mus ... -1   141  1.8e-06   1
A sp|P46100|RA54_HUMAN X-LINKED HELICASE II (X-LINKED NU... -1   130  1.8e-06   2
A gi|1778307           (U72936) putative DNA dependent A... -1   130  2.2e-06   2
A gi|1778311           (U72938) putative DNA dependent A... -1   130  2.3e-06   2
A gi|1778309           (U72937) putative DNA dependent A... -1   130  2.4e-06   2
A gi|2306809           (U97103) X-linked nuclear protein... -1   130  2.4e-06   2
A gnl|PID|e315493      (Z95334) unknown [Schizosaccharom... -1   140  2.6e-06   2
A sp|P32333|MOT1_YEAST PROBABLE HELICASE MOT1 >pir||S227... -1   135  4.5e-06   2
A pir||C30010          hypothetical ORF-6 protein - Saur... +1   130  4.8e-06   1
A gnl|PID|e281743      (Z81089) F53H4.1 [Caenorhabditis ... -1   131  5.2e-06   2
A gi|172764            (M83755) STH1 protein [Saccharomy... -1   138  5.5e-06   2
A sp|P32597|STH1_YEAST NUCLEAR PROTEIN STH1/NPS1 >pir||S... -1   138  5.5e-06   2
A sp|P38086|YBS3_YEAST HYPOTHETICAL 108.0 KD HELICASE IN... -1   138  5.8e-06   1
A gnl|PID|e349697      (Z99292) dna repair protein [Schi... -1   134  7.6e-06   2
A gnl|PID|e290080      (Y10229) RAD54 [Drosophila melano... -1   136  8.0e-06   1
A sp|P25439|BRM_DROME  HOMEOTIC GENE REGULATOR (BRAHMA P... -1   139  8.3e-06   1
A pir||S45251          SNF2alpha protein - human >gnl|PI... -1   138  1.0e-05   1
A sp|P51531|SN22_HUMAN POSSIBLE GLOBAL TRANSCRIPTION ACT... -1   138  1.1e-05   1
A gi|340613            (L07545) A 'c' was inserted after... +1   130  1.3e-05   1
A gi|996020            (X91638) BRM protein [Gallus gallus] -1   139  1.4e-05   2
A sp|P43610|YFK8_YEAST HYPOTHETICAL 88.7 KD HELICASE IN ... -1   112  2.8e-05   2
A gi|1490417           (U45025) 89B helicase [Drosophila... -1   124  3.7e-05   2
A gi|2408043           (Z99164) hypothetical protein [Sc... -1   129  3.7e-05   1
A gi|728695            (Z48618) DNA helicase type protei... -1   129  4.3e-05   2
A sp|P32657|YEZ4_YEAST HYPOTHETICAL 168.2 KD PROTEIN IN ... -1   125  6.4e-05   2
A gnl|PID|e348652      (Z68341) F01G4.1 [Caenorhabditis ... -1   129  7.3e-05   1
A pir||I53078          homeotic gene regulator - mouse (... -1   129  8.0e-05   1
A gi|790390            (Z49128) M03C11.8 [Caenorhabditis... -1   115  9.3e-05   1
A pir||A56533          iswi protein - fruit fly (Drosoph... -1   120  9.6e-05   2
A bbs|179938           (S83324) Rhp16=nucleotide excisio... -1   127  0.00011   1
A gnl|PID|e16326       (X15081) MURF2 protein (AA 1-348)... +1   122  0.00011   1
A gnl|PID|e267084      (Z80344) F15D4.1 [Caenorhabditis ... -1   122  0.00012   1
A gi|1439631           (U64598) coded for by C. elegans ... -1   128  0.00013   1
A sp|P41877|SN2L_CAEEL POSSIBLE GLOBAL TRANSCRIPTION ACT... -1   120  0.00014   2
A gi|996018            (X91637) BRG1 protein [Gallus gal... -1   129  0.00014   1
A sp|P51532|SN23_HUMAN POSSIBLE GLOBAL TRANSCRIPTION ACT... -1   129  0.00014   1
A pir||S67208          hypothetical protein YOR304w - ye... -1   129  0.00015   2
A gi|436923            (U01849) ORF1 [Trypanosoma brucei]   +1   105  0.00017   1
A gi|2388586           (AC000098) Similar to Saccharomyc... -1   104  0.00018   2
A sp|P15605|YM04_PARTE HYPOTHETICAL 18.8 KD PROTEIN (ORF... +1   108  0.00023   1
A gi|897642            (M14820) ORF2 bases 1807-2850; fi... +1   117  0.00027   1
A sp|P32849|RAD5_YEAST DNA REPAIR PROTEIN RAD5 >pir||S64... -1   100  0.00028   2
A sp|Q10332|YD92_SCHPO HYPOTHETICAL 93.9 KD HELICASE C19... -1    96  0.00030   2
A pir||A05235          hypothetical protein A-288 - Tryp... +1   117  0.00031   1
A gnl|PID|d1019392     (D90916) helicase of the snf2/rad... -1   124  0.00031   1
A gi|454844            (M74170) ORF 3 [Schistosoma mansoni] +1   119  0.00032   1
A sp|P22082|SNF2_YEAST TRANSCRIPTION REGULATORY PROTEIN ... -1   123  0.00032   2
A prf||1718318A        GAM1 gene [Saccharomyces cerevisiae] -1   123  0.00032   2
A pir||F22845          hypothetical protein 6 - Trypanos... +1   118  0.00034   1
A gi|1655930           (U66564) RUSH-1alpha [Oryctolagus... -1   123  0.00040   1
A gi|1703553           (U80033) coded for by C. elegans ... -1   123  0.00041   1
A gi|552200            (M63270) malaria antigen [Plasmod... -1    97  0.00045   1
A pir||S51908          cryptogene protein G1(ND9) - Saur... +1   111  0.00052   1
A pir||A56095          HIP116 protein - human >gi|531196... -1   122  0.00052   1
A pir||S55492          rad8 protein - fission yeast (Sch... -1    96  0.00058   1
A sp|P15583|NU5M_LEITA NADH-UBIQUINONE OXIDOREDUCTASE CH... +1    95  0.00076   1
A sp|P38144|YB95_YEAST HYPOTHETICAL 131.1 KD HELICASE IN... -1   114  0.00080   3
A pir||S46122          SNF2 protein homolog YBR245c - ye... -1   114  0.00083   3
A gi|1280116           (U55373) coded for by C. elegans ... -1   109  0.00089   2
A gnl|PID|e349623      (Z92970) H06O01.2 [Caenorhabditis... -1   100  0.00093   2
A gi|2443887           (AC002294) Similar to transcripti... -1   111  0.00093   2
A pir||S43955          CR5 protein - Trypanosoma brucei ... +1   103  0.00095   1
A pir||B30010          hypothetical ORF-5 protein - Saur... +1    94  0.00098   1
A gnl|PID|e280495      (Z46606) helicase-like transcript... -1   119  0.0010    1
A pir||B26696          hypothetical protein 1 (CYb-COII ... +1   115  0.0012    1
A pir||S39059          protein BRG1 - human                 -1   121  0.0012    1
A prf||1924378A        nucler protein GRB1 [Homo sapiens]   -1   121  0.0012    1
A pir||S49618          helicase-like transcription facto... -1   119  0.0012    1
A gnl|PID|e1169985     (AJ001017) TAFII170 [Homo sapiens]   -1   120  0.0014    2
A gi|501027            (U01849) ORF2 [Trypanosoma brucei]   +1    99  0.0016    1
A gi|1065711           (Z67884) T14G8.1 [Caenorhabditis ... -1   120  0.0017    1
A sp|P31244|RA16_YEAST DNA REPAIR PROTEIN RAD16 >pir||S2... -1   109  0.0018    2
A pir||E22845          hypothetical protein 4 - Trypanos... +1   113  0.0020    1
A pir||F30010          NADH dehydrogenase (ubiquinone) (... +1   112  0.0026    1
A gnl|PID|e275074      (X98455) SNF [Bacillus cereus]       -1   113  0.0030    2
A pir||S67083          hypothetical protein YOR191w - ye... -1   117  0.0035    1
A sp|P14546|COX3_LEITA CYTOCHROME C OXIDASE POLYPEPTIDE ... +1   108  0.0035    1
A gi|340588            (L07539) cytochrome oxidase [Leis... +1   108  0.0036    1
A gnl|PID|e276379      (Y08924) AARP2 protein [Plasmodiu... -1   116  0.0037    1
A pir||I50372          ORF2 - chicken >gnl|PID|d1003771 ... -1   103  0.0039    2
A gi|1107696           (X86691) Mi-2 protein [Homo sapiens] -1   108  0.0040    2
A pir||I64201          helicase (mot1) homolog - Mycopla... -1   110  0.0042    1
A gi|172320            (M83553) excision repair protein ... -1   109  0.0048    1
A sp|P47264|Y018_MYCGE HYPOTHETICAL HELICASE MG018          -1   110  0.0052    1
A pir||S41482          rad8 protein - fission yeast (Sch... -1   101  0.0067    1
A gnl|PID|e347760      (Z73102) F54E12.2 [Caenorhabditis... -1    97  0.010     1
A gi|2501846           (AF004397) chromo-helicase-DNA-bi... -1   103  0.011     2
A sp|P24499|ATP6_TRYBB ATP SYNTHASE A CHAIN (PROTEIN 6)     +1   102  0.011     1
A pir||A47392          chromodomain-helicase-DNA-binding... -1   103  0.015     2
A sp|P40201|CHD1_MOUSE CHROMODOMAIN-HELICASE-DNA-BINDING... -1   103  0.015     2
A gi|2291218           (AF016425) contains similarity to... -1   100  0.018     2
A gnl|PID|e289150      (Z83337) member of the SNF2 helic... -1   108  0.018     1
A gi|452428            (X65740) ATPase 3 [Plasmodium fal... -1   105  0.019     1
A gi|2281697           (AF010138) transcription factor [... -1   108  0.022     1
A sp|P34739|LDS_DROME  PROBABLE HELICASE LODESTAR           -1   108  0.023     1
A pir||A25877          cytochrome-c oxidase (EC 1.9.3.1)... +1   101  0.024     1
A gnl|PID|e255509      (X99021) putative helicase [Schiz... -1   109  0.024     1
A gi|414322            (L11172) [Plasmodium falciparum R... -1   112  0.024     1
A pir||A35349          H+-transporting ATP synthase (EC ... +1    98  0.028     1
A sp|P38439|LEO1_YEAST LEO1 PROTEIN >pir||S45363 LEO1 pr... -1   103  0.030     1
A gi|1255425           (U53154) C33G8.2 gene product [Ca... -1   102  0.030     1
A pir||S34959          NADH dehydrogenase (ubiquinone) (... +1   102  0.036     1
A sp|P18160|KYK1_DICDI NON-RECEPTOR TYROSINE KINASE SPOR... -1   108  0.036     1
A sp|P14196|AAC2_DICDI AAC-RICH MRNA CLONE AAC11 PROTEIN... -1   102  0.037     1
A pir||S47661          topoisomerase II - Plasmodium fal... -1    93  0.041     1
A gi|1620150           (U42580) Phe-rich [Paramecium bur... +1    79  0.045     1
A gi|1931638           (U95973) transcription factor RUS... -1    97  0.046     2
A pir||C22845          NADH dehydrogenase (ubiquinone) (... +1   101  0.047     1
A sp|P48935|C560_CYACA SUCCINATE DEHYDROGENASE CYTOCHROM... +1    88  0.054     1
A gi|1407719           (U60409) L2759-20 [Leishmania major] -1   104  0.056     1
A gi|343539            (M14820) NADH dehydrogenase subun... +1   100  0.060     1
A gnl|PID|d1000902     (D00570) open reading frame (251 ... +1    96  0.067     1
A sp|P04540|NU5M_TRYBB NADH-UBIQUINONE OXIDOREDUCTASE CH... +1   101  0.070     1
A pir||S43288          MURF4 protein - Herpetomonas musc... +1    77  0.074     1
A pir||C26696          hypothetical protein (CYb-COII in... +1    94  0.078     1
A sp|Q05854|YL78_YEAST PUTATIVE 151.3 KD TRANSCRIPTIONAL... -1   104  0.084     1
A gnl|PID|e311435      (Y08926) AARP1 protein [Plasmodiu... -1   108  0.090     1
A pir||S35458          SNF2 protein homolog - human (fra... -1    93  0.091     2
A sp|P34780|YCX5_ASTLO HYPOTHETICAL 13.3 KD PROTEIN IN R... +1    76  0.094     1
A gi|456385            (U05813) 3'-end [Blastocrithidia ... +1    76  0.094     1
A pir||S59078          hypothetical protein 262 - red al... +1    95  0.096     1
A pir||A45612          ATPase 6 - Sauroleishmania tarent... +1    94  0.097     1
A gi|2408073           (Z99167) helicase [Schizosaccharo... -1   107  0.10      2
A sp|P75093|Y018_MYCPN HYPOTHETICAL HELICASE MG018/MG017... -1   102  0.10      1
A sp|P54682|D7_DICDI   CAMP-INDUCIBLE PRESPORE PROTEIN D... -1   101  0.11      1
A gi|1947112           (AF000196) strong similarity to t... -1    96  0.11      2
A sp|Q03100|CYAA_DICDI ADENYLATE CYCLASE, AGGREGATION SP... -1   105  0.11      2
A gi|499325            (Z26314) STARP antigen [Plasmodiu... -1    99  0.12      1
A gi|1294789           (L76261) ND3 gene product [Meloid... +1    75  0.12      1
A gi|160385            (M63277) malaria antigen [Plasmod... -1    93  0.12      1
A gi|1022918           (U38184) ATPase subunit 6 [Trypan... +1    93  0.12      1
A gi|2447053           (U42580) similar to Caenorhabditi... -1    97  0.14      1
A sp|P28370|SN21_HUMAN POSSIBLE GLOBAL TRANSCRIPTION ACT... -1    93  0.15      2
A pir||S23692          hypothetical protein 9 - Plasmodi... -1    97  0.16      1
A gi|343544            (M33228) ATPase 6 [Trypanosoma br... +1    92  0.16      1
A pir||S34960          NADH dehydrogenase (ubiquinone) (... +1    97  0.17      2
A gi|1216394           (U40265) ATPase subunit 6 [Trypan... +1    89  0.17      1
A pir||S54157          extensin-like protein - cowpea (f... +3    93  0.17      1
A pir||S53808          hypothetical protein B - Acantham... +1    86  0.17      1
A sp|P08116|PVA_PLAFA  PROCESSED VARIABLE ANTIGEN >pir||... -1    91  0.19      1
A pir||S51911          cryptogene protein G5(ND3) - Saur... +1    73  0.19      1
A gnl|PID|e220245      (X95275) frameshift [Plasmodium f... +1    99  0.20      1
A pir||S50977          hypothetical protein YDL005c - ye... -1    95  0.20      1
A sp|P54673|P3K1_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 1 (... -1   101  0.20      1
A gi|1448983           (L77907) chromodomain-helicase-DN... -1   106  0.24      2
A gi|453517            (L28677) ORF3 [Tetrahymena pyrifo... +1    72  0.24      1
A pir||S23689          hypothetical protein 6 - Plasmodi... -1    72  0.24      1
A pir||S49604          hypothetical protein 126 - euglen... +1    82  0.24      1
A sp|P27625|RPC1_PLAFA DNA-DIRECTED RNA POLYMERASE III L... -1   107  0.27      2
A pir||A45597          DNA-directed RNA polymerase (EC 2... -1   107  0.27      2
A gi|2315689           (AF016674) No definition line fou... -1    91  0.29      1
A gi|453389            (U05814) cytochrome C oxidase sub... +1    91  0.29      1
A pir||S21342          ring-infected erythrocyte surface... -1    91  0.32      1
A gnl|PID|e316524      (Y13119) pleiotropic effects on c... -1    96  0.32      1
A gi|2393951           (AF012944) ORF DG1053 [Dictyostel... -1    91  0.33      2
A gi|2425143           (AF020407) WimA [Dictyostelium di... -1    91  0.33      2
A gi|552163            (J03986) 10b antigen [Plasmodium ... -1    92  0.34      1
A gnl|PID|e8900        (X05182) RESA FC27 Ag46 (1 is 3rd... -1    91  0.34      1
A sp|P04371|COX1_TRYBB CYTOCHROME C OXIDASE POLYPEPTIDE ... +1    94  0.34      1
A gi|2078309           (U67264) HOAR [Helicoverpa zea nu... -1    95  0.36      1
A sp|P54637|PTP3_DICDI PROTEIN-TYROSINE PHOSPHATASE 3 (P... -1    85  0.37      2
A gi|1762998           (U67260) RING-finger protein [Hel... -1    91  0.39      1
A sp|P34857|NU6M_APIME NADH-UBIQUINONE OXIDOREDUCTASE CH... +1    85  0.40      1
A sp|P54677|PI4K_DICDI PHOSPHATIDYLINOSITOL 4-KINASE (PI... -1    96  0.43      1
A pir||B45600          asparagine-rich blood stage antig... -1    92  0.44      1
A pir||S36956          cytochrome-c oxidase (EC 1.9.3.1)... +1    89  0.45      1
A gi|456389            (U05816) 3'-end [Crithidia fascic... +1    69  0.45      1
A sp|O10302|GTA_NPVOP  PROBABLE GLOBAL TRANSACTIVATOR >g... -1    92  0.46      1
A pir||S69562          hypothetical protein YDR504c - ye... +1    80  0.48      1
A sp|P54683|TAGB_DICDI PRESTALK-SPECIFIC PROTEIN TAGB PR... -1    94  0.48      2
A pir||S26025          NADH dehydrogenase (ubiquinone) (... +1    92  0.48      1
A pir||S52053          cytochrome-c oxidase (EC 1.9.3.1)... +1    92  0.50      1
A sp|P24884|NU5M_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CH... +1    92  0.50      1
A gi|467292            (U07817) glutamine-asparagine ric... -1    93  0.53      1
A gi|1658493           (U75508) unknown [Marinococcus ha... +1    68  0.53      1
A gnl|PID|d1021481     (AB001684) ORF67 [Chlorella vulga... +1    68  0.53      1
A gi|2447150           (U42580) a580R [Paramecium bursar... +1    68  0.53      1
A gi|552199            (M63269) malaria antigen [Plasmod... -1    81  0.54      1
A gi|2102728           (U96194) Pax-B [Hydra littoralis]    -1    92  0.55      1
A sp|P14248|RPB1_PLAFD DNA-DIRECTED RNA POLYMERASE II LA... -1    98  0.55      1
A sp|P18015|COP_CLOPE  COPY NUMBER PROTEIN (ORF4) >pir||... +1    85  0.56      1
A gi|2258300           (AF001783) AgrC [Staphylococcus a... +1    90  0.57      1
A gi|535260            (Z30339) STARP antigen [Plasmodiu... -1    92  0.58      1
A bbs|112163           (S44213) YKL529 [Saccharomyces ce... -1    91  0.58      1
A gi|1109830           (U41534) coded for by C. elegans ... -1    93  0.61      1
A sp|P41001|TOP2_PLAFK DNA TOPOISOMERASE II                 -1    95  0.62      1
A pir||S67132          hypothetical protein YOR239w - ye... -1    87  0.62      1
A sp|P32343|YKM4_YEAST HYPOTHETICAL 65.1 KD PROTEIN IN R... -1    91  0.62      1
A bbs|137318           DNA polymerase alpha, DNAPol alph... -1   101  0.62      2
A pir||S41649          DNA polymerase - Plasmodium falci... -1   101  0.62      2
A gi|563136            (U11682) unassigned reading frame... +1    67  0.63      1
A sp|P04017|VE5A_HPV11 PROBABLE E5A PROTEIN >pir||W5WL11... +1    67  0.63      1
A sp|P20970|VE5A_HPV6C PROBABLE E5A PROTEIN >gi|333132 (... +1    67  0.63      1
A pir||A05236          hypothetical protein B-114 - Tryp... +1    76  0.63      1
A sp|P40021|YEM3_YEAST HYPOTHETICAL 119.3 KD PROTEIN IN ... -1    85  0.65      2
A sp|Q57898|Y456_METJA HYPOTHETICAL PROTEIN MJ0456 >pir|... +1    88  0.65      1
A gi|2367390           (U82512) random slug cDNA21 prote... -1    90  0.66      1
A pir||I30010          NADH dehydrogenase (ubiquinone) (... +1    86  0.67      2
A gi|683670            (Z48432) unknown [Saccharomyces c... +1    86  0.68      1
A pir||B21124          Bkm-like sex-determining region h... +1    73  0.73      1
A sp|P32900|YHU9_YEAST HYPOTHETICAL 81.8 KD PROTEIN IN M... -1    91  0.73      1
A gi|476024            (L32150) carbamoyl phosphate synt... -1    96  0.73      1
A pir||S36955          cytochrome-c oxidase (EC 1.9.3.1)... +1    86  0.73      1
A gi|1041785           (U36927) rhoptry protein [Plasmod... -1    96  0.73      1
A sp|P15577|NU2M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CH... +1    83  0.74      1
A pir||JS0233          NADH dehydrogenase (ubiquinone) (... +1    83  0.74      1
A pir||S53834          NADH dehydrogenase chain 4 - Acan... +1    89  0.74      1
A gi|437639            (L04159) [Plasmodium falciparum 3... -1    89  0.74      1
A gi|1658333           (U40232) exported serine/threonin... -1    96  0.75      1
A pir||S23691          hypothetical protein 8 - Plasmodi... -1    85  0.75      1
A gnl|PID|e274726      (Y07786) Rfc-like protein [Vibrio... +1    87  0.76      1
A gi|2258370           (AF007261) haem lyase [Reclinomon... +1    90  0.76      1
A gi|769835            (U09185) unknown [Buchnera aphidi... +1    86  0.76      1
A pir||S43286          MURF4 protein - Trypanosoma cruzi... +1    65  0.81      1
A gi|309695            (M77713) major merozoite surface ... -1    83  0.81      1
A gi|1022332           (X83707) protein kinase [Plasmodi... -1    91  0.81      1
A gi|886923            (X87941) ORF 115 [Saccharomyces c... +1    75  0.81      1
A sp|Q09772|YA83_SCHPO HYPOTHETICAL 89.2 KD HELICASE SPA... -1    90  0.84      1
A sp|P04931|ARP_PLAFA  ASPARAGINE-RICH PROTEIN (AG319) (... -1    88  0.85      1
A sp|P13824|ARP2_PLAFA CLUSTERED-ASPARAGINE-RICH PROTEIN... -1    87  0.86      1
A pir||S14469          asparagine-rich protein (clone 17... -1    83  0.87      1
A bbs|170479           (S79359) arabinogalactan-protein,... -1    87  0.87      1
A pir||S49313          protein kinase - slime mold (Dict... -1    91  0.87      1
A sp|P11673|YCX1_OENBE HYPOTHETICAL 8.5 KD PROTEIN (ORF ... +2    64  0.88      1
A gi|1142588           (U05313) CR3 [Trypanosoma brucei]    +1    64  0.88      1
A gi|1840435           (U50282) SH protein [Mumps virus]    +1    64  0.88      1
A gnl|PID|e353197      (Z99707) cysteine proteinase [Ara... -1    85  0.88      1
sp|P54674|P3K2_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 2 (... -1    93  0.89      1
gi|1816500           (L06303) 8b2 protein [Plasmodium ... -1    84  0.89      1
pir||S36953          cytochrome-c oxidase (EC 1.9.3.1)... +1    84  0.89      1
sp|P40467|YIN0_YEAST PUTATIVE 108.8 KD TRANSCRIPTIONAL... -1    90  0.90      1
pir||S67559          probable membrane protein YDL027c... +1    86  0.90      1
pir||S61312          cap protein 1, merozoite - Plasmo... -1    85  0.91      1
pir||S70790          lipA protein - Mycoplasma pulmoni... -1    83  0.91      1
pir||A54523          histidine-rich protein - Plasmodi... +3    77  0.93      1
gi|1620042           (U42580) a370R [Paramecium bursar... +1    63  0.93      1
gi|1294785           (L76262) ND3 gene product [Meloid... +1    70  0.94      1
gi|309708            (M77720) major merozoite surface ... -1    81  0.94      1
pir||S36954          cytochrome-c oxidase (EC 1.9.3.1)... +1    83  0.95      1
gi|160409            (M69183) mature-parasite-infected... -1    91  0.95      1
gi|2425113           (AF019981) HelE [Dictyostelium di... -1    89  0.95      1
pir||A45605          mature-parasite-infected erythroc... -1    91  0.95      1
pir||S67568          probable membrane protein YDL035c... -1    89  0.95      1
sp|P24873|NU6M_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CH... +1    77  0.95      1
gi|1762996           (U67259) RING-finger protein [Hel... -1    84  0.95      1
gi|2460283           (AF024654) hybrid histidine kinas... -1    92  0.95      1
sp|P21059|VA36_VACCV PROTEIN A36 PRECURSOR >pir||B4252... -1    81  0.95      1
sp|P54675|P3K3_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 3 (... -1    91  0.95      1
gi|1526991           (U41289) K7 kinesin-like protein ... -1    90  0.96      1
pir||A61055          E5a protein - human papillomaviru... +1    65  0.96      1
pir||S14535          asparagine-rich protein (clone 25... -1    87  0.96      1
sp|P25979|UBF1_XENLA NUCLEOLAR TRANSCRIPTION FACTOR 1 ... -1    87  0.96      1
sp|Q03101|CYAG_DICDI ADENYLATE CYCLASE, GERMINATION SP... -1    88  0.97      1
pir||A42239          adenylate cyclase (EC 4.6.1.1) ge... -1    88  0.97      1
gnl|PID|e309969      (Z93389) T13F3.e [Caenorhabditis ... -1    78  0.97      1
gi|343949            (J01525) var1(40.0) [Saccharomyce... -1    84  0.97      1
sp|P41447|GTA_NPVAC  PROBABLE GLOBAL TRANSACTIVATOR >g... -1    85  0.98      1
gi|2149437           (U85963) asparigine-rich protein ... -1    86  0.98      1
sp|P36043|YKU1_YEAST 64.6 KD PROTEIN IN TOR2-PAS1 INTE... -1    85  0.98      1
gi|1374721           (U29872) cellobiohydrolase precur... -1    73  0.99      2
gi|2246532           (U93872) ORF 73, contains large c... -1    88  0.99      1
pir||JC4114          Ca2+-transporting ATPase (EC 3.6.... -1    88  0.99      1
gnl|PID|d1021467     (AB001684) ORF49b [Chlorella vulg... -3    39  0.99      2
gi|160373            (M63271) malaria antigen [Plasmod... -1    61  0.99      1
gi|2447092           (U42580) A619L [Paramecium bursar... -1    80  0.99      1
gi|295139            (L13334) ORFB [Staphylococcus lug... +1    81  0.990     1
gi|1633572           (U52064) Herpesvirus saimiri ORF7... -1    88  0.992     1
gi|567922            (L36903) varI gene product [Sacch... -1    83  0.992     1
pir||C45600          asparagine-rich blood stage antig... -1    83  0.992     1
pir||S28720          gene d-4 protein - slime mold (Di... -1    80  0.993     1
gi|1151158           (U43145) repeat organellar protei... -1    90  0.993     1
gi|1199606           (U39298) P-type ATPase [Plasmodiu... -1    88  0.994     1
gi|1513240           (U66370) ORFveg110 [Dictyostelium... -1    81  0.994     1
gi|581546            (X52543) agrB gene product [Staph... +1    83  0.994     1
gi|1763000           (U67261) RING-finger protein [Hel... -1    82  0.994     1
gi|1916243           (U85096) AgrC [Staphylococcus aur... +1    83  0.995     1
pir||S53830          NADH dehydrogenase chain 6 - Acan... +1    80  0.996     1
gi|2619013           (AF027868) sensor kinase [Bacillu... +1    82  0.996     1
sp|Q33568|CYB_TRYBO  CYTOCHROME B >pir||S52054 ubiquin... +1    82  0.996     1
gi|1236921           (U49822) Var1p [Saccharomyces dou... -1    82  0.996     1
sp|P14544|COX1_LEITA CYTOCHROME C OXIDASE POLYPEPTIDE ... +1    84  0.996     1
gi|1262910           (U51645) cytidine triphosphate sy... -1    86  0.997     1
gi|1049249           (U35149) putative glutamate and a... -1    88  0.997     1
pir||B35349          H+-transporting ATP synthase (EC ... +1    60  0.997     1
gnl|PID|e334109      (Z98532) amiloride resistance pro... -1    60  0.997     1
sp|P00164|CYB_TRYBB  CYTOCHROME B >pir||CBUTB ubiquino... +1    70  0.998     2
gi|527431            (Z35663) T04A8.13 [Caenorhabditis... -1    85  0.998     1
sp|P25976|UBF1_MOUSE NUCLEOLAR TRANSCRIPTION FACTOR 1 ... -1    85  0.998     1
pir||C60944          cytochrome b - Leishmania mexican... +1    72  0.999     2
pir||S59393          probable membrane protein YLR247c... -1    88  0.999     1
gi|2605924           (AF029726) histidine kinase C [Di... -1    87  0.999     1
gnl|PID|d1022919     (D85686) Pfj1 [Plasmodium falcipa... -1    84  0.999     1
pir||A29795          circumsporozoite protein - Plasmo... -1    76  0.999     1
gnl|PID|d1000903     (D00570) open reading frame (196 ... +1    77  0.9991    1
pir||S61977          RLM1 protein - yeast (Saccharomyc... -1    84  0.9993    1
gnl|PID|e283903      (Y08256) orf c02009 [Sulfolobus s... +1    77  0.9994    1
pir||S72690          probable membrane protein Q0270 -... +1    71  0.9994    1
gi|606881            (U12395) unknown [Trypanosoma bru... +1    59  0.9995    1
gnl|PID|d1017923     (D90904) hypothetical protein [Sy... -1    59  0.9995    1
pir||A44971          hypothetical protein 1 - Plasmodi... +3    66  0.9995    1
pir||A28782          cytochrome-c oxidase (EC 1.9.3.1)... +1    76  0.9995    1
gi|2367388           (U82511) random slug cDNA19 prote... -1    77  0.9996    1
gi|2317717           (AF012943) RblA [Dictyostelium di... -1    78  0.9996    1
gi|2502073           (AF026542) scnE gene product [Str... +1    78  0.9999    1
gi|862478            (U13194) major immediate-early pr... -1    86  0.9999    1
gi|1519536           (U66912) ORF DG1016; initially de... -1    83  0.9999    1
gi|2435414           (AF012247) unassigned reading fra... +1    74  0.9999    1
gi|994809            (Z37724) pid:e118903 [Plasmodium ... -1    83  0.9999    1
gi|1255424           (U53154) C33G8.3 gene product [Ca... -1    73  0.99990   1
gi|2429350           (AF019972) NE-rich protein [Plasm... -1    82  0.99992   1
sp|P34656|YOTA_CAEEL HYPOTHETICAL 51.8 KD PROTEIN ZK63... -1    81  0.99993   1
gi|555221            (M81388) helicase [Chilo iridesce... -1    82  0.99994   2
gnl|PID|d1007032     (D30801) TED3 [Zinnia elegans]       -1    79  0.99994   1
pir||S17700          hypothetical protein - midge (Chi... +1    58  0.99994   1
sp|P24886|NULM_CAEEL NADH-UBIQUINONE OXIDOREDUCTASE CH... +1    58  0.99994   1
gi|1907399           (U91564) beta-tubulin 3 [Nicotian... -1    58  0.99994   1
gnl|PID|d1021566     (AB001684) ORF51c [Chlorella vulg... +1    58  0.99994   1
pir||A25620          staphylocoagulase - Staphylococcu... -1    79  0.99995   1



>sp|P31380|YAB9_YEAST HYPOTHETICAL 128.5 KD HELICASE IN ATS1-TPD3 INTERGENIC
            REGION >pir||S22266 FUN30 protein - yeast (Saccharomyces
            cerevisiae) >gi|171856 (L05146) Fun30p [Saccharomyces cerevisiae]
            Length = 1131

  Minus Strand HSPs:

 Score = 158 (55.6 bits), Expect = 7.3e-12, Sum P(3) = 7.3e-12
 Identities = 29/53 (54%), Positives = 43/53 (81%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMDQ 31
             ++RLDGST   +RQ +I +F +D++I +F+LSTKAGG G+NL+ AN+VI+ DQ
Sbjct:   993 FLRLDGSTQVNDRQLLIDKFYEDKDIPIFILSTKAGGFGINLVCANNVIIFDQ 1045

 Score = 54 (19.0 bits), Expect = 6.3e-11, Sum P(2) = 6.3e-11
 Identities = 11/28 (39%), Positives = 19/28 (67%), Frame = -1

Query:   489 NVFIKEEQNYHDIGKE-TKRHDDNNNNN 409
             N+FI +++++  I K+  K  DDN N+N
Sbjct:   752 NLFISKKESFDAIFKQRAKTTDDNKNHN 779

 Score = 49 (17.2 bits), Expect = 7.3e-12, Sum P(3) = 7.3e-12
 Identities = 12/46 (26%), Positives = 23/46 (50%), Frame = -1

Query:   354 NDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSST--LSTSS 223
             +D   ED + ++  +D   +      D+DDE +    +T  +ST+S
Sbjct:   503 DDYEEEDEDYNDEEEDVEYDDGDDDDDDDDEFVATRKNTHVISTTS 548

 Score = 47 (16.5 bits), Expect = 3.3e-10, Sum P(2) = 3.3e-10
 Identities = 21/82 (25%), Positives = 37/82 (45%), Frame = -1

Query:   405 NDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTS 226
             ND DE +   +E++   +D  + D + +E T   N +  +  +  +D +I   S    T+
Sbjct:   248 NDNDEEE---EESMMTDDDDASGD-DYTESTPQINLD-EQVLQFINDSDIVDLSDLSDTT 302

Query:   225 SVGTQNDAGHQIYVRLDGSTNT 160
                 Q  A H+ Y  L+   NT
Sbjct:   303 MHKAQLIASHRPYSSLNAFVNT 324

 Score = 43 (15.1 bits), Expect = 8.6e-10, Sum P(2) = 8.6e-10
 Identities = 9/29 (31%), Positives = 21/29 (72%), Frame = -1

Query:   477 KEEQNYHDIGKETKRHDDNNNNNINDGDE 391
             +E+++Y+D  +E   +DD ++++ +D DE
Sbjct:   507 EEDEDYND-EEEDVEYDDGDDDD-DDDDE 533

 Score = 42 (14.8 bits), Expect = 7.3e-12, Sum P(3) = 7.3e-12
 Identities = 7/15 (46%), Positives = 10/15 (66%), Frame = -1

Query:   432 HDDNNNNNINDGDEN 388
             +DD NN+N N  + N
Sbjct:   412 NDDGNNDNNNSNNNN 426

 Score = 40 (14.1 bits), Expect = 1.8e-09, Sum P(2) = 1.8e-09
 Identities = 8/28 (28%), Positives = 12/28 (42%), Frame = -1

Query:   354 NDIYNEDMENSERTKDTNCEYNKKKKDE 271
             ND  N D  NS        +   K+K++
Sbjct:   412 NDDGNNDNNNSNNNNTAGADATSKEKED 439

 Score = 38 (13.4 bits), Expect = 1.9e-11, Sum P(3) = 1.9e-11
 Identities = 12/41 (29%), Positives = 21/41 (51%), Frame = -1

Query:   456 DIGKETKRHDDNNNNNIND-GDENKFCFKENIKKPNDIYNE 337
             D   +   +D+NN+NN N  G +     KE+ K   + ++E
Sbjct:   409 DDDNDDGNNDNNNSNNNNTAGADATSKEKEDTKAVVEGFDE 449


>sp|P32863|RA54_YEAST DNA REPAIR AND RECOMBINATION PROTEIN RAD54 >pir||JH0440
            RAD54 protein - yeast (Saccharomyces cerevisiae) >gi|172343
            (M63232) recombination and repair protein [Saccharomyces
            cerevisiae] >gi|728692 (Z48618) RAD54 [Saccharomyces cerevisiae]
            >gnl|PID|e243777 (Z72685) ORF YGL163c [Saccharomyces cerevisiae]
            Length = 898

  Minus Strand HSPs:

 Score = 177 (62.3 bits), Expect = 1.1e-11, P = 1.1e-11
 Identities = 52/136 (38%), Positives = 79/136 (58%), Frame = -1

Query:   423 NNNNNINDGDENKFCFKENIKKPNDIYN------EDMENSERTKDTNCE-YNKKKKDEDD 265
             N+ N +N  DE  F  +++++ P+D YN       D++     K +  E +  K K E D
Sbjct:   616 NHPNLLNFEDE--FDDEDDLELPDD-YNMPGSKARDVQTKYSAKFSILERFLHKIKTESD 672

Query:   264 EEICLTSS-TLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENI-FVFLLST 91
             ++I L S+ T +   +       H   VRLDG+ +  +RQK++ RF+  E   F+FLLS+
Sbjct:   673 DKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSS 732

Query:    90 KAGGVGLNLIAANHVILMD 34
             KAGG G+NLI AN +ILMD
Sbjct:   733 KAGGCGINLIGANRLILMD 751


>gi|2213862 (AF003086) PfSNF2L [Plasmodium falciparum]
            Length = 1422

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 8.1e-11, Sum P(2) = 8.1e-11
 Identities = 28/53 (52%), Positives = 39/53 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+R+DGST   ERQ  I +F++ +   F+FLLST+AGG+G+NL  A+ VIL D
Sbjct:   666 YLRIDGSTPGDERQVRINQFNEPNSKYFIFLLSTRAGGIGINLTTADIVILFD 718

 Score = 96 (33.8 bits), Expect = 8.1e-11, Sum P(2) = 8.1e-11
 Identities = 35/129 (27%), Positives = 69/129 (53%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             +D DY + +   K +  ++ ND I KE NN+N N+  ++  +  + G +   HD N + N
Sbjct:    51 EDKDY-EELDLKKLN--VSSND-ITKEGNNMNENMMNRKLNSSVEDGNDNN-HDKNVHRN 105

Query:   408 I-NDG----DENKFCFKENIKKPNDIYNEDMEN---SERTKDTNCEYNKKKKDEDDEEIC 253
             I ND     D+ +  + +N ++ ++  N++M+    +E + D N E   + K +D  E  
Sbjct:   106 IGNDTHVSYDDKRKSYLDNNEENSEQMNDNMKKRKLNEISYDNNEEDEFRNKKDDSME-- 163

Query:   252 LTSSTLSTSSVGTQND 205
             +      ++++ T ND
Sbjct:   164 MNDKEKGSTNMSTIND 179

 Score = 89 (31.3 bits), Expect = 4.3e-10, Sum P(2) = 4.3e-10
 Identities = 31/122 (25%), Positives = 61/122 (50%), Frame = -1

Query:   627 DIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIG 448
             D +++  L E  YD+++  D  +  K   S+  ND   KE+ + N++       N++D  
Sbjct:   134 DNMKKRKLNEISYDNNEE-DEFRN-KKDDSMEMND---KEKGSTNMSTINDNNNNHND-- 186

Query:   447 KETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDED 268
              ++  H+D++NN+ ND D N      N    ++ +N+D  N+   +D N  +N    + +
Sbjct:   187 -DSNNHNDDSNNH-ND-DSN------NHNDDSNNHNDD--NNNHNEDNN-NHNDDNNNHN 234

Query:   267 DE 262
             D+
Sbjct:   235 DD 236

 Score = 86 (30.3 bits), Expect = 8.7e-10, Sum P(2) = 8.7e-10
 Identities = 29/106 (27%), Positives = 52/106 (49%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             +D DY + +   K +  ++ ND I KE NN+N N+  ++  +  + G +   HD N + N
Sbjct:    51 EDKDY-EELDLKKLN--VSSND-ITKEGNNMNENMMNRKLNSSVEDGNDNN-HDKNVHRN 105

Query:   408 INDGDENKFCFKENIKKPNDIYN-EDM-ENSERTKDTNCEYNKKKKDE 271
             I +     +  K      N+  N E M +N ++ K     Y+  ++DE
Sbjct:   106 IGNDTHVSYDDKRKSYLDNNEENSEQMNDNMKKRKLNEISYDNNEEDE 153

 Score = 74 (26.0 bits), Expect = 1.5e-08, Sum P(2) = 1.5e-08
 Identities = 27/90 (30%), Positives = 48/90 (53%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQS-INKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNN 412
             DDS  M+  +   ++ S IN N+    +++N N N    ++ N H+   ++  H+D++NN
Sbjct:   159 DDSMEMNDKEKGSTNMSTINDNNNNHNDDSN-NHN----DDSNNHN--DDSNNHNDDSNN 211

Query:   411 NINDGDENKFCFKENIKKPNDIYNEDME-NSE 319
             + ND + N      N    N+ +N+D   NSE
Sbjct:   212 H-NDDNNNHNEDNNNHNDDNNNHNDDNNYNSE 242

 Score = 72 (25.3 bits), Expect = 2.4e-08, Sum P(2) = 2.4e-08
 Identities = 30/116 (25%), Positives = 55/116 (47%), Frame = -1

Query:   591 YDDS--DYMDHIQTIKSSQSINKNDTICKEE-NNINVNVFIKEE-QNYHDIGKET--KRH 430
             YDD    Y+D+ +  ++S+ +N  D + K + N I+ +   ++E +N  D   E   K  
Sbjct:   114 YDDKRKSYLDNNE--ENSEQMN--DNMKKRKLNEISYDNNEEDEFRNKKDDSMEMNDKEK 169

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMEN----SERTKDTNCEYNKKKKDEDDE 262
                N + IND + N      N    ++ +N+D  N    S    D N  +N+   + +D+
Sbjct:   170 GSTNMSTINDNNNNHNDDSNNHNDDSNNHNDDSNNHNDDSNNHNDDNNNHNEDNNNHNDD 229

 Score = 66 (23.2 bits), Expect = 1.0e-07, Sum P(2) = 1.0e-07
 Identities = 25/88 (28%), Positives = 45/88 (51%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQS-INKNDTICKEE-NNIN--VNVFIKEEQNYHDIGKETKRHDDN 421
             DDS  M+  +   ++ S IN N+    ++ NN N   N    +  N++D   ++  H+D+
Sbjct:   159 DDSMEMNDKEKGSTNMSTINDNNNNHNDDSNNHNDDSNNHNDDSNNHND---DSNNHNDD 215

Query:   420 NNNNINDGDENKFCFKENIKKPNDIYNEDMEN 325
             NNN+ N+ + N      N    N+  +E+  N
Sbjct:   216 NNNH-NEDNNNHNDDNNNHNDDNNYNSEEKPN 246

 Score = 63 (22.2 bits), Expect = 2.0e-07, Sum P(2) = 2.0e-07
 Identities = 21/74 (28%), Positives = 35/74 (47%), Frame = -1

Query:   549 SSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNN--NINDGDENKFCF 376
             +  S N ND      ++ N +    ++ N H+        D+NN+N  N N  D+N +  
Sbjct:   185 NDDSNNHNDDSNNHNDDSNNH---NDDSNNHNDDNNNHNEDNNNHNDDNNNHNDDNNYNS 241

Query:   375 KENIKKPNDIYNEDME 328
             +E   KPN +  E +E
Sbjct:   242 EE---KPNYL-QEKLE 253

 Score = 62 (21.8 bits), Expect = 2.6e-07, Sum P(2) = 2.6e-07
 Identities = 21/105 (20%), Positives = 43/105 (40%), Frame = -1

Query:   567 HIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNIND---G 397
             H+      +S   N+    E+ N N+      E +Y +  ++  R+  +++  +ND   G
Sbjct:   111 HVSYDDKRKSYLDNNEENSEQMNDNMKKRKLNEISYDNNEEDEFRNKKDDSMEMNDKEKG 170

Query:   396 DENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDE 262
               N     +N    ND  N   ++S    D +  +N    + +D+
Sbjct:   171 STNMSTINDNNNNHNDDSNNHNDDSNNHNDDSNNHNDDSNNHNDD 215

 Score = 55 (19.4 bits), Expect = 1.4e-06, Sum P(2) = 1.4e-06
 Identities = 28/129 (21%), Positives = 52/129 (40%), Frame = -1

Query:   546 SQSINKNDTICKEEN----NINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFC 379
             +  INK D   +E +    N++ N   KE  N ++     K +    + N N+ D+N   
Sbjct:    45 NNGINKEDKDYEELDLKKLNVSSNDITKEGNNMNENMMNRKLNSSVEDGNDNNHDKN--- 101

Query:   378 FKENIKKPNDIYNEDMENS--ERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQND 205
                NI     +  +D   S  +  ++ + + N   K     EI   ++         + D
Sbjct:   102 VHRNIGNDTHVSYDDKRKSYLDNNEENSEQMNDNMKKRKLNEISYDNN--EEDEFRNKKD 159

Query:   204 AGHQIYVRLDGSTN 163
                ++  +  GSTN
Sbjct:   160 DSMEMNDKEKGSTN 173

 Score = 49 (17.2 bits), Expect = 5.6e-06, Sum P(2) = 5.6e-06
 Identities = 20/70 (28%), Positives = 30/70 (42%), Frame = -1

Query:   471 EQNYHDIGKETKR--HDDNNNN-NINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTN 301
             ++N  +  KE+    H D NN  N  D D  +   K+     NDI  E    +E     N
Sbjct:    26 DENTENYDKESNGFVHRDFNNGINKEDKDYEELDLKKLNVSSNDITKEGNNMNENMM--N 83

Query:   300 CEYNKKKKDEDD 265
              + N   +D +D
Sbjct:    84 RKLNSSVEDGND 95

 Score = 45 (15.8 bits), Expect = 1.4e-05, Sum P(2) = 1.4e-05
 Identities = 8/15 (53%), Positives = 12/15 (80%), Frame = -1

Query:   657 IIFSQFTTFLDIIEE 613
             ++FSQ T  LDII++
Sbjct:   643 LLFSQMTRLLDIIDD 657

 Score = 42 (14.8 bits), Expect = 2.9e-05, Sum P(2) = 2.9e-05
 Identities = 11/45 (24%), Positives = 26/45 (57%), Frame = -1

Query:   342 NEDMENSERTKD--TNCEYNK--KKKDEDDEEICLTSSTLSTSSV 220
             +E+ EN ++  +   + ++N    K+D+D EE+ L    +S++ +
Sbjct:    26 DENTENYDKESNGFVHRDFNNGINKEDKDYEELDLKKLNVSSNDI 70


>pir||A56559 enhancer-trap-locus-1 protein - mouse (fragment) >gi|50866
            (X69942) enhancer-trap-locus-1 [Mus musculus]
            Length = 1136

  Minus Strand HSPs:

 Score = 158 (55.6 bits), Expect = 2.1e-10, Sum P(2) = 2.1e-10
 Identities = 40/106 (37%), Positives = 59/106 (55%), Frame = -1

Query:   345 YNEDME---NSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLD 175
             Y  DM+   +S + +   C  ++ K+ + D  +  +  T+    +          Y+RLD
Sbjct:   953 YQLDMDLILDSGKFRALGCSLSELKQ-KGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLD 1011

Query:   174 GSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             G T   ER  +I  F+ D +IFVFLLSTKAGG+G+NL +AN VIL D
Sbjct:  1012 GKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHD 1058

 Score = 49 (17.2 bits), Expect = 2.1e-10, Sum P(2) = 2.1e-10
 Identities = 12/76 (15%), Positives = 37/76 (48%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVFI-----KEEQNYHDIGKETKRHDDNNNNNI 406
             ++I     ++ ++ N +   +E   + +  I      E++  HD+   T+R+D +   ++
Sbjct:   206 EYIDLSSDTEDVSPNCSSTVQEKKFSKDTVIIVSEPSEDEESHDLPSVTRRNDSSELEDL 265

Query:   405 NDGDENKFCFKENIKK 358
             ++ ++ K    + +K+
Sbjct:   266 SELEDLKDAKLQTLKE 281


>gnl|PID|d1021605 (AB002307) KIAA0309 [Homo sapiens]
            Length = 1668

  Minus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 1.4e-09, Sum P(2) = 1.4e-09
 Identities = 29/56 (51%), Positives = 43/56 (76%), Frame = -1

Query:   201 GHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             GH +Y+RLDGST   +RQ +++RF+ D+ IF F+LST++GGVG+NL  A+ V+  D
Sbjct:   521 GH-LYLRLDGSTRVEQRQALMERFNADKRIFCFILSTRSGGVGVNLTGADTVVFYD 575

 Score = 52 (18.3 bits), Expect = 1.4e-09, Sum P(2) = 1.4e-09
 Identities = 9/19 (47%), Positives = 14/19 (73%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY 601
             +IF+Q T  LD++E+ L Y
Sbjct:   501 LIFTQMTRMLDVLEQFLTY 519


>sp|P41410|RA54_SCHPO DNA REPAIR PROTEIN RAD54 >pir||S41886 DNA repair protein
            - fission yeast (Schizosaccharomyces pombe) >gi|452690 (Z29640) DNA
            repair protein [Schizosaccharomyces pombe]
            Length = 852

  Minus Strand HSPs:

 Score = 158 (55.6 bits), Expect = 6.6e-09, P = 6.6e-09
 Identities = 38/84 (45%), Positives = 55/84 (65%), Frame = -1

Query:   279 KDEDDEEICLTSSTLSTSSVGTQ--NDAGHQIYVRLDGSTNTIERQKIIKRFSKDE-NIF 109
             K E D++I L S+  ST  +  Q     G++  +RLDG+ N  +RQ+++  F+  E + F
Sbjct:   623 KQETDDKIVLISNYTSTLDLFEQLCRARGYKA-LRLDGTMNVNKRQRLVDTFNDPEKDAF 681

Query:   108 VFLLSTKAGGVGLNLIAANHVILMD 34
             VFLLS+KAGG G+NLI AN +IL D
Sbjct:   682 VFLLSSKAGGCGINLIGANRLILFD 706


>gnl|PID|e325327 (Z97208) Rad54p [Schizosaccharomyces pombe]
            Length = 852

  Minus Strand HSPs:

 Score = 158 (55.6 bits), Expect = 6.6e-09, P = 6.6e-09
 Identities = 38/84 (45%), Positives = 55/84 (65%), Frame = -1

Query:   279 KDEDDEEICLTSSTLSTSSVGTQ--NDAGHQIYVRLDGSTNTIERQKIIKRFSKDE-NIF 109
             K E D++I L S+  ST  +  Q     G++  +RLDG+ N  +RQ+++  F+  E + F
Sbjct:   623 KQETDDKIVLISNYTSTLDLFEQLCRARGYKA-LRLDGTMNVNKRQRLVDTFNDPEKDAF 681

Query:   108 VFLLSTKAGGVGLNLIAANHVILMD 34
             VFLLS+KAGG G+NLI AN +IL D
Sbjct:   682 VFLLSSKAGGCGINLIGANRLILFD 706


>sp|P53115|YGP0_YEAST HYPOTHETICAL 171.5 KD HELICASE IN LYS5-ARO2 INTERGENIC
            REGION >pir||S60416 DNA helicase YGL150c - yeast (Saccharomyces
            cerevisiae) >gnl|PID|e243594 (Z72672) ORF YGL150c [Saccharomyces
            cerevisiae]
            Length = 1489

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 2.2e-08, Sum P(2) = 2.2e-08
 Identities = 25/52 (48%), Positives = 38/52 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             ++RLDGS+   +R+ ++  +  +  IFVFLLST+AGG+G+NL AA+ VI  D
Sbjct:  1342 HIRLDGSSKLEDRRDLVHDWQTNPEIFVFLLSTRAGGLGINLTAADTVIFYD 1393

 Score = 78 (27.5 bits), Expect = 2.2e-08, Sum P(2) = 2.2e-08
 Identities = 26/75 (34%), Positives = 39/75 (52%), Frame = -1

Query:   480 IKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTN 301
             IK++Q + D    T   D+N + N N  DE+     EN    ND  NE+ EN +   D +
Sbjct:   198 IKDDQTHADT-VVTVNGDENEDGN-NGEDEDNDNDNEN-NNDNDNDNEN-EN-DNDSDND 252

Query:   300 CEYNKKKKDEDDEEI 256
              E    ++DE++EEI
Sbjct:   253 DEEENGEEDEEEEEI 267

 Score = 71 (25.0 bits), Expect = 1.2e-07, Sum P(2) = 1.2e-07
 Identities = 21/88 (23%), Positives = 43/88 (48%), Frame = -1

Query:   510 EENNINVNVFIKEEQNYH-DIGKETKRHDDNNNNNINDGD---ENKFCFKENIKKPNDIY 343
             ++ + +  V +  ++N   + G++    +DN NNN ND D   EN      + ++ N   
Sbjct:   201 DQTHADTVVTVNGDENEDGNNGEDEDNDNDNENNNDNDNDNENENDNDSDNDDEEENGEE 260

Query:   342 NEDMENSERTKDTNCEYNKKKKDEDDEE 259
             +E+ E  E   + +    +++ D DDE+
Sbjct:   261 DEEEEEIEDLDEEDFAAFEEQDDNDDED 288

 Score = 53 (18.7 bits), Expect = 8.2e-06, Sum P(2) = 8.2e-06
 Identities = 15/59 (25%), Positives = 28/59 (47%), Frame = -1

Query:   492 VNVFIKEEQNY-HDIGKETKRHD-DNNNNNINDGDENK-FCFKENIKKPNDIYNEDMEN 325
             +N  + + + Y H IG++ K ++ + NN + ND +  K           ND +  D +N
Sbjct:   581 LNFLLTQTELYSHFIGRKIKTNELEGNNVSSNDSESQKNIDISALAPNKNDFHAIDFDN 639

 Score = 53 (18.7 bits), Expect = 8.2e-06, Sum P(2) = 8.2e-06
 Identities = 16/70 (22%), Positives = 33/70 (47%), Frame = -1

Query:   468 QNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCE-- 295
             Q +  I +  ++  D   +N ND  +  F   + + +   + N++    +  K+ N    
Sbjct:    79 QEFELISEWNQQSKDWQFDNTNDSQDLHF---KKLYRDMSMINKEWAEYQSFKNANLSDI 135

Query:   294 YNKKKKDEDDEE 259
              N+K  DED+E+
Sbjct:   136 INEKDADEDEED 147

 Score = 52 (18.3 bits), Expect = 1.0e-05, Sum P(2) = 1.0e-05
 Identities = 17/64 (26%), Positives = 29/64 (45%), Frame = -1

Query:   567 HIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNN--NNINDGD 394
             H++ +K   +  K +   +E    NV +   +  N  D  +  KR   NNN  N  +D +
Sbjct:   381 HVKRLKKLINDAKREREREEALKNNVGLDGNDLDNDEDGSESHKRRKLNNNTANGADDAN 440

Query:   393 ENKF 382
             + KF
Sbjct:   441 KRKF 444

 Score = 38 (13.4 bits), Expect = 0.00028, Sum P(2) = 0.00028
 Identities = 8/12 (66%), Positives = 9/12 (75%), Frame = -1

Query:   573 MDHIQTIKSSQS 538
             +D  Q IKSSQS
Sbjct:   840 LDEAQAIKSSQS 851


>sp|P40352|RA26_YEAST DNA REPAIR AND RECOMBINATION PROTEIN RAD26 >pir||JC2227
            probable helicase RAD26 - yeast (Saccharomyces cerevisiae)
            >gi|506419 (L26910) gtA1085 [Saccharomyces cerevisiae] >gi|1015683
            (Z49535) ORF YJR035w [Saccharomyces cerevisiae]
            Length = 1085

  Minus Strand HSPs:

 Score = 143 (50.3 bits), Expect = 5.0e-08, Sum P(2) = 5.0e-08
 Identities = 28/63 (44%), Positives = 45/63 (71%), Frame = -1

Query:   222 VGTQN-DAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHV 46
             + T++ D  H  Y+R+DG+TN   RQ ++ RF+ +E+  VFLL+T+ GG+G+NL  AN +
Sbjct:   687 ISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFN-NESFDVFLLTTRVGGLGVNLTGANRI 745

Query:    45 ILMD 34
             I+ D
Sbjct:   746 IIFD 749

 Score = 53 (18.7 bits), Expect = 5.0e-08, Sum P(2) = 5.0e-08
 Identities = 15/29 (51%), Positives = 18/29 (62%), Frame = -1

Query:   396 DENKFCFKENI---KKPNDIYNEDMENSERTK 310
             DEN     EN+    KP+D   ED +NS RTK
Sbjct:   393 DENDL---ENLIMNSKPSDFSYEDWKNSTRTK 421

 Score = 42 (14.8 bits), Expect = 6.8e-07, Sum P(2) = 6.8e-07
 Identities = 12/56 (21%), Positives = 26/56 (46%), Frame = -1

Query:   426 DNNNNNINDGDENKFCFKENIKKPNDIYNEDM-ENSERTKDTNCEYNKKKKDEDDEE 259
             D  N      DE K    E+ +   +   E++ +  +   D + + + K+ ++D+EE
Sbjct:   163 DTANREYAKNDEQK---DEDFEMATEQMVENLTDEDDNLSDQDYQMSGKESEDDEEE 216


>gi|550429 (X81635) RAD26 [Saccharomyces cerevisiae]
           Length = 1085

  Minus Strand HSPs:

 Score = 143 (50.3 bits), Expect = 5.0e-08, Sum P(2) = 5.0e-08
 Identities = 28/63 (44%), Positives = 45/63 (71%), Frame = -1

Query:   222 VGTQN-DAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHV 46
             + T++ D  H  Y+R+DG+TN   RQ ++ RF+ +E+  VFLL+T+ GG+G+NL  AN +
Sbjct:   687 ISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFN-NESFDVFLLTTRVGGLGVNLTGANRI 745

Query:    45 ILMD 34
             I+ D
Sbjct:   746 IIFD 749

 Score = 53 (18.7 bits), Expect = 5.0e-08, Sum P(2) = 5.0e-08
 Identities = 15/29 (51%), Positives = 18/29 (62%), Frame = -1

Query:   396 DENKFCFKENI---KKPNDIYNEDMENSERTK 310
             DEN     EN+    KP+D   ED +NS RTK
Sbjct:   393 DENDL---ENLIMNSKPSDFSYEDWKNSTRTK 421

 Score = 42 (14.8 bits), Expect = 6.8e-07, Sum P(2) = 6.8e-07
 Identities = 12/56 (21%), Positives = 26/56 (46%), Frame = -1

Query:   426 DNNNNNINDGDENKFCFKENIKKPNDIYNEDM-ENSERTKDTNCEYNKKKKDEDDEE 259
             D  N      DE K    E+ +   +   E++ +  +   D + + + K+ ++D+EE
Sbjct:   163 DTANREYAKNDEQK---DEDFEMATEQMVENLTDEDDNLSDQDYQMSGKESEDDEEE 216


>gnl|PID|e349022 (Z54236) C27B7.4 [Caenorhabditis elegans]
            Length = 1285

  Minus Strand HSPs:

 Score = 145 (51.0 bits), Expect = 9.4e-08, Sum P(2) = 9.4e-08
 Identities = 24/52 (46%), Positives = 42/52 (80%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDG+T+  +R+K+I RF+ +  + +FL+ST+AG +G+NL++AN  I++D
Sbjct:   845 YLRLDGTTSGADREKLINRFNSEPGLSLFLISTRAGSLGINLVSANRCIIID 896

 Score = 49 (17.2 bits), Expect = 9.4e-08, Sum P(2) = 9.4e-08
 Identities = 11/19 (57%), Positives = 14/19 (73%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K +IFSQ  T LD++EE L
Sbjct:   806 KILIFSQNLTALDMLEEIL 824

 Score = 44 (15.5 bits), Expect = 3.1e-07, Sum P(2) = 3.1e-07
 Identities = 8/25 (32%), Positives = 15/25 (60%), Frame = -1

Query:   330 ENSERTKDTNCEYNKKKKDEDDEEI 256
             +++++TK         K DE+DEE+
Sbjct:   737 KSAKKTKKPRGSKKAPKSDEEDEEV 761


>gnl|PID|e334244 (Z98595) hypothetical protein [Schizosaccharomyces pombe]
            Length = 1288

  Minus Strand HSPs:

 Score = 143 (50.3 bits), Expect = 1.2e-07, Sum P(2) = 1.2e-07
 Identities = 29/59 (49%), Positives = 43/59 (72%), Frame = -1

Query:   210 NDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             N  GH+ Y+RLDG+T   +RQ + +RF+ D+ I VF+LST++GG+G+NL  A+ VI  D
Sbjct:  1028 NIHGHR-YLRLDGATKIEQRQILTERFNNDDKIPVFILSTRSGGLGINLTGADTVIFYD 1085

 Score = 51 (18.0 bits), Expect = 1.2e-07, Sum P(2) = 1.2e-07
 Identities = 19/78 (24%), Positives = 39/78 (50%), Frame = -1

Query:   483 FIKEEQNY-HDIGKET---KRHD--D--NNNNNINDGDENKFCFKE--NIKKPNDIYNED 334
             F K+  N+  D+  E    K+ D  D  +   ++NDGD+N+    +  +    + +YNED
Sbjct:   335 FAKKSYNHVSDLDGEVIVMKKEDITDGVSTKKDLNDGDQNEVPLHDTGSSSSLSLLYNED 394

Query:   333 MENSERTKDTNCEYNKKK 280
             + + ++ +  +    +KK
Sbjct:   395 VASKKKRRVNDDGLARKK 412

 Score = 46 (16.2 bits), Expect = 3.9e-07, Sum P(2) = 3.9e-07
 Identities = 9/17 (52%), Positives = 13/17 (76%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEAL 607
             +IF+Q T  LDI+E+ L
Sbjct:  1011 LIFTQMTKVLDILEQFL 1027

 Score = 41 (14.4 bits), Expect = 1.3e-06, Sum P(2) = 1.3e-06
 Identities = 9/43 (20%), Positives = 23/43 (53%), Frame = -1

Query:   366 IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSST 238
             +K  N    +++E  E  ++T+ +     +DE++E+  +T  +
Sbjct:   265 LKYSNPDLIKNIEREEEAEETSDDEPLSSEDEENEDEDITEES 307


>pir||S51910 cryptogene protein G4 - Sauroleishmania tarentolae (strain LEM125)
            Length = 169

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.1e-07, P = 2.1e-07
 Identities = 26/93 (27%), Positives = 52/93 (55%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIF-IIYIIWFFYIFFKTKFIFIPIINIIIIVI-IMTF 438
             ++F FF++  F  CIF     F +F +  +++F YI F   F+ +  + I+++    + F
Sbjct:     8 VVFGFFMYY-FVCCIFYFCFFFCLFDLCVMVYFIYIAFVCLFVLVCYVVILLLCFDCIVF 66

Query:   439 CFFTYIMIILFFFYKHIYIYII-FFLTYGIIFIY 537
               FT I+I  F F   ++I+++ F+  +G +F +
Sbjct:    67 FLFTVIIIFFFLFIFWVFIFLLLFWFVFGFLFFF 100

 Score = 121 (42.6 bits), Expect = 3.2e-06, P = 3.2e-06
 Identities = 26/115 (22%), Positives = 63/115 (54%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F  +F+   +++  +  F  + +F +F + II FF++F    FIF+     ++   +  F
Sbjct:    44 FVCLFVLVCYVVILLLCFDCI-VFFLFTVIII-FFFLFIFWVFIFL-----LLFWFVFGF 96

Query:   439 CFFTYIMIILFFFYKHIYIYIIFFLTYG-IIFIYAL*TFNSLYMIHIITIIIYKFI 603
              FF + + +L F+++  +++++FF+  G ++F+  +  F S +++ ++      FI
Sbjct:    97 LFFFFYVCVLIFYFE--FLFMLFFVFCGFLLFVMFILFFISFFVLIVLVFCWLLFI 150

 Score = 113 (39.8 bits), Expect = 0.00010, P = 0.00010
 Identities = 30/125 (24%), Positives = 69/125 (55%), Frame = +1

Query:   256 YFFIIF-----IFFLFIIFTICIFSSL*IFHIFIIY---IIWFFY---IFFKTKFIFIPI 402
             +FF +F     ++F++I F +C+F  +    I ++    I++F +   I F   FIF   
Sbjct:    26 FFFCLFDLCVMVYFIYIAF-VCLFVLVCYVVILLLCFDCIVFFLFTVIIIFFFLFIFWVF 84

Query:   403 INIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYG-IIFIYAL*TFNSLYMIHII 579
             I +++   +  F FF + + +L F+++  +++++FF+  G ++F+  +  F S +++ ++
Sbjct:    85 IFLLLFWFVFGFLFFFFYVCVLIFYFE--FLFMLFFVFCGFLLFVMFILFFISFFVLIVL 142

Query:   580 TIIIYKFI 603
                   FI
Sbjct:   143 VFCWLLFI 150

 Score = 100 (35.2 bits), Expect = 0.0068, P = 0.0068
 Identities = 26/111 (23%), Positives = 57/111 (51%), Frame = +1

Query:   268 IFIF-FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT-FC 441
             + +F F    F  CIF     F +F + ++ +F I+     +F+ +  ++I+++      
Sbjct:     7 VVVFGFFMYYFVCCIFYFCFFFCLFDLCVMVYF-IYIAFVCLFVLVCYVVILLLCFDCIV 65

Query:   442 FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
             FF + +II+FFF   ++I+ +F     ++F +    F  L+    + ++I+ F
Sbjct:    66 FFLFTVIIIFFF---LFIFWVFIFL--LLFWFV---FGFLFFFFYVCVLIFYF 110

 Score = 98 (34.5 bits), Expect = 0.013, P = 0.012
 Identities = 19/68 (27%), Positives = 37/68 (54%), Frame = +1

Query:   271 FIF-FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             F+F FLF  F +C+     IF+   +++++F +  F    +FI       ++I++ FC+ 
Sbjct:    92 FVFGFLFFFFYVCVL----IFYFEFLFMLFFVFCGFLLFVMFILFFISFFVLIVLVFCWL 147

Query:   448 TYIMIILFF 474
              +I +  FF
Sbjct:   148 LFIFVFRFF 156

 Score = 76 (26.8 bits), Expect = 6.5, P = 1.0
 Identities = 26/102 (25%), Positives = 51/102 (50%), Frame = +1

Query:   316 SL*IFHIFIIYIIW--FFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHI 489
             S+ +F  F+ Y +   F++ FF   F    ++  I I  +  F    Y++I+L  F    
Sbjct:     6 SVVVFGFFMYYFVCCIFYFCFFFCLFDLCVMVYFIYIAFVCLFVLVCYVVILLLCFD--- 62

Query:   490 YIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGLLY 621
                I+FFL + +I I+    F  ++ + I  ++++ F+  G L+
Sbjct:    63 --CIVFFL-FTVIIIFF---FLFIFWVFIF-LLLFWFV-FGFLF 98


>pir||S62430 RAD8 protein - fission yeast (Schizosaccharomyces pombe)
            (fragment) >gi|1008986 (Z54308) Rad8 [Schizosaccharomyces pombe]
            Length = 1070

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 2.2e-07, Sum P(2) = 2.2e-07
 Identities = 24/52 (46%), Positives = 33/52 (63%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R DG+ +   R   ++ F  D ++ V ++S KAGGVGLNL  ANHV +MD
Sbjct:  1008 YARFDGTMSQQMRSTALETFRNDPDVNVLIISLKAGGVGLNLTCANHVFIMD 1059

 Score = 70 (24.6 bits), Expect = 2.2e-07, Sum P(2) = 2.2e-07
 Identities = 14/19 (73%), Positives = 16/19 (84%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K +IFSQFTTFLDII + L
Sbjct:   983 KVVIFSQFTTFLDIIADVL 1001


>sp|P36607|RAD8_SCHPO DNA REPAIR PROTEIN RAD8 >pir||S41478 RAD8 protein -
            fission yeast (Schizosaccharomyces pombe) >gi|443973 (X74615) rad8
            gene product [Schizosaccharomyces pombe]
            Length = 1133

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 2.5e-07, Sum P(2) = 2.5e-07
 Identities = 24/52 (46%), Positives = 33/52 (63%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R DG+ +   R   ++ F  D ++ V ++S KAGGVGLNL  ANHV +MD
Sbjct:  1008 YARFDGTMSQQMRSTALETFRNDPDVNVLIISLKAGGVGLNLTCANHVFIMD 1059

 Score = 70 (24.6 bits), Expect = 2.5e-07, Sum P(2) = 2.5e-07
 Identities = 14/19 (73%), Positives = 16/19 (84%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K +IFSQFTTFLDII + L
Sbjct:   983 KVVIFSQFTTFLDIIADVL 1001


>gi|2306766 (U75653) zinc finger helicase [Homo sapiens]
            Length = 2492

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 6.5e-07, Sum P(2) = 6.5e-07
 Identities = 26/54 (48%), Positives = 38/54 (70%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDGST    R+K  + F+ + N+   +F++STKAG +G+NL+AAN VI+ D
Sbjct:  2083 YYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFD 2136

 Score = 67 (23.6 bits), Expect = 6.5e-07, Sum P(2) = 6.5e-07
 Identities = 28/111 (25%), Positives = 51/111 (45%), Frame = -1

Query:   585 DSDYMDHIQ---TIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNN 415
             +SD M++ +   T  S +S +   +  K + +I V  ++ E  +   +  ET   D +N 
Sbjct:    53 NSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSI-VTKYV-ESDDEKPLDDETVNEDASNE 110

Query:   414 NNINDGDENKFCFKENIKKPNDIYNEDMENSE----RTKDTNCEYNKKKKDED 268
             N+ ND           I +P  + NED ++ +    R++      N KK+ ED
Sbjct:   111 NSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKTENLKKRGED 163

 Score = 61 (21.5 bits), Expect = 2.7e-06, Sum P(2) = 2.7e-06
 Identities = 17/58 (29%), Positives = 27/58 (46%), Frame = -1

Query:   393 ENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV 220
             +NK   K + +K N +Y      S +   +NC   +KK D+     C  S T S S++
Sbjct:   293 QNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDS----CSGSVTYSYSAL 346

 Score = 59 (20.8 bits), Expect = 4.3e-06, Sum P(2) = 4.3e-06
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = -1

Query:   513 KEENNINVNVFIKEEQNYHDIG--KETKRHDDNNNNNINDG-----DENKFCFKEN---- 367
             K  N   V+    E+ ++ + G  +E    +D              +EN+  +K+     
Sbjct:  1367 KGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRR 1426

Query:   366 -IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              IK   D  +E+  NSE  ++   E  +++++E++EE
Sbjct:  1427 RIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEE 1463

 Score = 48 (16.9 bits), Expect = 3.8e-05, Sum P(3) = 3.8e-05
 Identities = 17/57 (29%), Positives = 27/57 (47%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDG--DENK 385
             K   S  K   I KE+   ++    K +Q   DI   +    +D++ N+I +G  DE K
Sbjct:  1169 KQRTSSKKKAVIVKEKKRNSLRTSTKRKQA--DITSSSSSDIEDDDQNSIGEGSSDEQK 1225

 Score = 47 (16.5 bits), Expect = 7.3e-05, Sum P(2) = 7.3e-05
 Identities = 13/51 (25%), Positives = 27/51 (52%), Frame = -1

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK 277
             D++ +++    +  K   K+N + P D   ++  NSE   D++ E +KK +
Sbjct:  1287 DEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSE--SDSDSEESKKPR 1335

 Score = 43 (15.1 bits), Expect = 0.00019, Sum P(2) = 0.00019
 Identities = 18/92 (19%), Positives = 40/92 (43%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNIN--VNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             +T + S+ + K  T  K ++ ++     F+K++Q+      ET   D   +    +  + 
Sbjct:   941 ETKEKSKHL-KTKTCKKVQDGLSDIAEKFLKKDQS-----DETSEDDKKQSKKGTEEKKK 994

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTN--CEYNK 286
                FK+ + K    Y    + +E+  +    C + K
Sbjct:   995 PSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPK 1030

 Score = 42 (14.8 bits), Expect = 0.00024, Sum P(2) = 0.00024
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K ++FSQ    LD+IE+ L
Sbjct:  2036 KVLVFSQSLISLDLIEDFL 2054

 Score = 40 (14.1 bits), Expect = 3.8e-05, Sum P(3) = 3.8e-05
 Identities = 14/56 (25%), Positives = 29/56 (51%), Frame = -1

Query:   396 DENKFCFKEN-----IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE----- 259
             +EN+  +K+      IK   D  +E+  NSE  ++   E  +++++E++EE     
Sbjct:  1413 EENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDEND 1468

 Score = 39 (13.7 bits), Expect = 4.8e-05, Sum P(3) = 4.8e-05
 Identities = 7/26 (26%), Positives = 16/26 (61%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE 262
             E+ E  E  ++   E  ++++DE+D+
Sbjct:  1444 EEEEEKEEEEEEEEEEEEEEEDENDD 1469


>sp|Q03468|ERC6_HUMAN EXCISION REPAIR PROTEIN ERCC-6 >pir||A44224 DNA repair
            helicase ERCC6 - human >gi|182181 (L04791) excision repair protein
            [Homo sapiens]
            Length = 1493

  Minus Strand HSPs:

 Score = 147 (51.7 bits), Expect = 6.9e-07, P = 6.9e-07
 Identities = 25/52 (48%), Positives = 40/52 (76%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+++DG+T    RQ +I R+++D +IFVFLL+T+ GG+G+NL  AN V++ D
Sbjct:   882 YLKMDGTTTIASRQPLITRYNEDTSIFVFLLTTRVGGLGVNLTGANRVVIYD 933


>pir||I54367 X-linked nuclear protein - human >gi|530788 (L34363) X-linked
            nuclear protein [Homo sapiens] >prf||2209217A ATR-X gene [Homo
            sapiens]
            Length = 1298

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 1.1e-06, Sum P(2) = 1.1e-06
 Identities = 26/54 (48%), Positives = 38/54 (70%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDGST    R+K  + F+ + N+   +F++STKAG +G+NL+AAN VI+ D
Sbjct:   944 YYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFD 997

 Score = 59 (20.8 bits), Expect = 1.1e-06, Sum P(2) = 1.1e-06
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = -1

Query:   513 KEENNINVNVFIKEEQNYHDIG--KETKRHDDNNNNNINDG-----DENKFCFKEN---- 367
             K  N   V+    E+ ++ + G  +E    +D              +EN+  +K+     
Sbjct:   247 KGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRIYKQKKKRR 306

Query:   366 -IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              IK   D  +E+  NSE  ++   E  +++++E++EE
Sbjct:   307 RIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEE 343

 Score = 48 (16.9 bits), Expect = 5.0e-06, Sum P(3) = 5.0e-06
 Identities = 17/57 (29%), Positives = 27/57 (47%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDG--DENK 385
             K   S  K   I KE+   ++    K +Q   DI   +    +D++ N+I +G  DE K
Sbjct:    50 KQRTSSKKKAVIVKEKKRNSLRTSTKRKQA--DITSSSSSDIEDDDQNSIGEGSSDEQK 106

 Score = 42 (14.8 bits), Expect = 5.8e-05, Sum P(2) = 5.8e-05
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K ++FSQ    LD+IE+ L
Sbjct:   897 KVLVFSQSLISLDLIEDFL 915

 Score = 41 (14.4 bits), Expect = 7.4e-05, Sum P(2) = 7.4e-05
 Identities = 10/42 (23%), Positives = 21/42 (50%), Frame = -1

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDT 304
             D++ +++    +  K   K+N + P D   ++  NSE   D+
Sbjct:   168 DEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSESDSDS 209

 Score = 40 (14.1 bits), Expect = 5.0e-06, Sum P(3) = 5.0e-06
 Identities = 14/56 (25%), Positives = 29/56 (51%), Frame = -1

Query:   396 DENKFCFKEN-----IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE----- 259
             +EN+  +K+      IK   D  +E+  NSE  ++   E  +++++E++EE     
Sbjct:   293 EENQRIYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDEND 348

 Score = 39 (13.7 bits), Expect = 6.3e-06, Sum P(3) = 6.3e-06
 Identities = 7/26 (26%), Positives = 16/26 (61%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE 262
             E+ E  E  ++   E  ++++DE+D+
Sbjct:   324 EEEEEKEEEEEEEEEEEEEEEDENDD 349


>gi|1905887 (U92461) putative recombination factor GdRad54 [Gallus gallus]
            Length = 733

  Minus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 1.3e-06, P = 1.3e-06
 Identities = 30/84 (35%), Positives = 53/84 (63%), Frame = -1

Query:   279 KDEDDEEICLTSSTLSTSSVGTQNDAGHQ-IYVRLDGSTNTIERQKIIKRFSKDENI-FV 106
             K   ++++ L S+   T  +  +     + +YVRLDG+ +  +R K+++RF+   +  F+
Sbjct:   498 KSTSNDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKVVERFNSPSSPEFI 557

Query:   105 FLLSTKAGGVGLNLIAANHVILMD 34
             F+LS+KAGG GLNLI AN +++ D
Sbjct:   558 FMLSSKAGGCGLNLIGANRLVMFD 581


>pir||JC4666 lymphocyte specific helicase - mouse >gi|805296 (U25691)
            lymphocyte specific helicase [Mus musculus]
            Length = 603

  Minus Strand HSPs:

 Score = 141 (49.6 bits), Expect = 1.3e-06, P = 1.3e-06
 Identities = 28/53 (52%), Positives = 41/53 (77%), Frame = -1

Query:   192 IYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             I+ RLDGS +  ER+K I  F+ D ++F+FL+ST+AGG+G+NL AA+ VI+ D
Sbjct:   406 IFSRLDGSMSYSEREKNIYSFNTDPDVFLFLVSTRAGGLGINLTAADTVIIYD 458


>gnl|PID|e246056 (X97795) RAD54 gene product [Homo sapiens]
            Length = 747

  Minus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 1.3e-06, P = 1.3e-06
 Identities = 28/58 (48%), Positives = 42/58 (72%), Frame = -1

Query:   204 AGHQIYVRLDGSTNTIERQKIIKRFSKDENI-FVFLLSTKAGGVGLNLIAANHVILMD 34
             A   +YVRLDG+ +  +R K+++RF+   +  FVF+LS+KAGG GLNLI AN +++ D
Sbjct:   535 ARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFD 592


>pir||S70099 hypothetical protein YDR334w - yeast (Saccharomyces cerevisiae)
            >gi|1230661 (U51032) Ydr334wp [Saccharomyces cerevisiae]
            Length = 1514

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.6e-06, Sum P(2) = 1.6e-06
 Identities = 25/53 (47%), Positives = 39/53 (73%), Frame = -1

Query:   192 IYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +Y+RLDG+T   +RQ + +RF+ D  I VF+LS+++GG+G+NL  A+ VI  D
Sbjct:  1288 LYMRLDGATKIEDRQILTERFNTDSRITVFILSSRSGGLGINLTGADTVIFYD 1340

 Score = 55 (19.4 bits), Expect = 1.6e-06, Sum P(2) = 1.6e-06
 Identities = 10/26 (38%), Positives = 19/26 (73%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEALLYE-FIY 589
             +++IF+Q T  LD++E+ L Y  ++Y
Sbjct:  1264 RALIFTQMTKVLDVLEQFLNYHGYLY 1289

 Score = 47 (16.5 bits), Expect = 1.0e-05, Sum P(2) = 1.0e-05
 Identities = 31/134 (23%), Positives = 60/134 (44%), Frame = -1

Query:   540 SINKND---TICKEENNINVN-VFIKEEQN-YHDIGKETKRHDDNNNNNINDGDENKFCF 376
             S NK++   T+ K E++ + + V   EE + Y     E++  +D  +++          F
Sbjct:   547 SRNKDEKFPTLDKHESSSSESSVMTGEESSIYSSSENESQNENDRESDDKTPSVGLSALF 606

Query:   375 KENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSS--VGTQNDA 202
              +  +   D+  +D E+      ++ E  + +KD+ D     +++T   +   V TQN+ 
Sbjct:   607 GKGEESDGDLDLDDSEDFT-VNSSSVEGEELEKDQVDN----SAATFERAGDFVHTQNEN 661

Query:   201 GHQIY-VRLDGSTNTIERQ 148
                I  V  D  T   E Q
Sbjct:   662 RDDIKDVEEDAETKVQEEQ 680


>gnl|PID|e246057 (X97796) RAD54 gene product [Mus musculus]
            Length = 747

  Minus Strand HSPs:

 Score = 141 (49.6 bits), Expect = 1.8e-06, P = 1.8e-06
 Identities = 27/54 (50%), Positives = 41/54 (75%), Frame = -1

Query:   192 IYVRLDGSTNTIERQKIIKRFSKDENI-FVFLLSTKAGGVGLNLIAANHVILMD 34
             +YVRLDG+ +  +R K+++RF+   +  FVF+LS+KAGG GLNLI AN +++ D
Sbjct:   539 LYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFD 592


>sp|P46100|RA54_HUMAN X-LINKED HELICASE II (X-LINKED NUCLEAR PROTEIN) (XNP)
            >gi|606833 (U09820) helicase II [Homo sapiens]
            Length = 1641

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 1.8e-06, Sum P(2) = 1.8e-06
 Identities = 26/54 (48%), Positives = 38/54 (70%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDGST    R+K  + F+ + N+   +F++STKAG +G+NL+AAN VI+ D
Sbjct:  1225 YYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFD 1278

 Score = 59 (20.8 bits), Expect = 1.8e-06, Sum P(2) = 1.8e-06
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = -1

Query:   513 KEENNINVNVFIKEEQNYHDIG--KETKRHDDNNNNNINDG-----DENKFCFKEN---- 367
             K  N   V+    E+ ++ + G  +E    +D              +EN+  +K+     
Sbjct:   508 KGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRR 567

Query:   366 -IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              IK   D  +E+  NSE  ++   E  +++++E++EE
Sbjct:   568 RIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEE 604

 Score = 48 (16.9 bits), Expect = 1.1e-05, Sum P(3) = 1.1e-05
 Identities = 17/57 (29%), Positives = 27/57 (47%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDG--DENK 385
             K   S  K   I KE+   ++    K +Q   DI   +    +D++ N+I +G  DE K
Sbjct:   310 KQRTSSKKKAVIVKEKKRNSLRTSTKRKQA--DITSSSSSDIEDDDQNSIGEGSSDEQK 366

 Score = 47 (16.5 bits), Expect = 3.0e-05, Sum P(2) = 3.0e-05
 Identities = 13/51 (25%), Positives = 27/51 (52%), Frame = -1

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK 277
             D++ +++    +  K   K+N + P D   ++  NSE   D++ E +KK +
Sbjct:   428 DEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSE--SDSDSEESKKPR 476

 Score = 43 (15.1 bits), Expect = 7.7e-05, Sum P(2) = 7.7e-05
 Identities = 18/92 (19%), Positives = 40/92 (43%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNIN--VNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             +T + S+ + K  T  K ++ ++     F+K++Q+      ET   D   +    +  + 
Sbjct:    82 ETKEKSKHL-KTKTCKKVQDGLSDIAEKFLKKDQS-----DETSEDDKKQSKKGTEEKKK 135

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTN--CEYNK 286
                FK+ + K    Y    + +E+  +    C + K
Sbjct:   136 PSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPK 171

 Score = 42 (14.8 bits), Expect = 9.8e-05, Sum P(2) = 9.8e-05
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K ++FSQ    LD+IE+ L
Sbjct:  1178 KVLVFSQSLISLDLIEDFL 1196

 Score = 40 (14.1 bits), Expect = 1.1e-05, Sum P(3) = 1.1e-05
 Identities = 14/56 (25%), Positives = 29/56 (51%), Frame = -1

Query:   396 DENKFCFKEN-----IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE----- 259
             +EN+  +K+      IK   D  +E+  NSE  ++   E  +++++E++EE     
Sbjct:   554 EENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDEND 609

 Score = 39 (13.7 bits), Expect = 1.3e-05, Sum P(3) = 1.3e-05
 Identities = 7/26 (26%), Positives = 16/26 (61%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE 262
             E+ E  E  ++   E  ++++DE+D+
Sbjct:   585 EEEEEKEEEEEEEEEEEEEEEDENDD 610


>gi|1778307 (U72936) putative DNA dependent ATPase and helicase [Homo sapiens]
            >gi|1778353 (U72935) putative DNA dependent ATPase and helicase
            [Homo sapiens]
            Length = 2288

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 2.2e-06, Sum P(2) = 2.2e-06
 Identities = 26/54 (48%), Positives = 38/54 (70%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDGST    R+K  + F+ + N+   +F++STKAG +G+NL+AAN VI+ D
Sbjct:  1879 YYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFD 1932

 Score = 61 (21.5 bits), Expect = 2.2e-06, Sum P(2) = 2.2e-06
 Identities = 17/58 (29%), Positives = 27/58 (46%), Frame = -1

Query:   393 ENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV 220
             +NK   K + +K N +Y      S +   +NC   +KK D+     C  S T S S++
Sbjct:    89 QNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDS----CSGSVTYSYSAL 142

 Score = 59 (20.8 bits), Expect = 3.6e-06, Sum P(2) = 3.6e-06
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = -1

Query:   513 KEENNINVNVFIKEEQNYHDIG--KETKRHDDNNNNNINDG-----DENKFCFKEN---- 367
             K  N   V+    E+ ++ + G  +E    +D              +EN+  +K+     
Sbjct:  1163 KGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRR 1222

Query:   366 -IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              IK   D  +E+  NSE  ++   E  +++++E++EE
Sbjct:  1223 RIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEE 1259

 Score = 48 (16.9 bits), Expect = 3.0e-05, Sum P(3) = 3.0e-05
 Identities = 17/57 (29%), Positives = 27/57 (47%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDG--DENK 385
             K   S  K   I KE+   ++    K +Q   DI   +    +D++ N+I +G  DE K
Sbjct:   965 KQRTSSKKKAVIVKEKKRNSLRTSTKRKQA--DITSSSSSDIEDDDQNSIGEGSSDEQK 1021

 Score = 47 (16.5 bits), Expect = 6.1e-05, Sum P(2) = 6.1e-05
 Identities = 13/51 (25%), Positives = 27/51 (52%), Frame = -1

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK 277
             D++ +++    +  K   K+N + P D   ++  NSE   D++ E +KK +
Sbjct:  1083 DEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSE--SDSDSEESKKPR 1131

 Score = 43 (15.1 bits), Expect = 0.00016, Sum P(2) = 0.00016
 Identities = 18/92 (19%), Positives = 40/92 (43%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNIN--VNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             +T + S+ + K  T  K ++ ++     F+K++Q+      ET   D   +    +  + 
Sbjct:   737 ETKEKSKHL-KTKTCKKVQDGLSDIAEKFLKKDQS-----DETSEDDKKQSKKGTEEKKK 790

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTN--CEYNK 286
                FK+ + K    Y    + +E+  +    C + K
Sbjct:   791 PSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPK 826

 Score = 42 (14.8 bits), Expect = 0.00020, Sum P(2) = 0.00020
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K ++FSQ    LD+IE+ L
Sbjct:  1832 KVLVFSQSLISLDLIEDFL 1850

 Score = 40 (14.1 bits), Expect = 3.0e-05, Sum P(3) = 3.0e-05
 Identities = 14/56 (25%), Positives = 29/56 (51%), Frame = -1

Query:   396 DENKFCFKEN-----IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE----- 259
             +EN+  +K+      IK   D  +E+  NSE  ++   E  +++++E++EE     
Sbjct:  1209 EENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDEND 1264

 Score = 39 (13.7 bits), Expect = 3.7e-05, Sum P(3) = 3.7e-05
 Identities = 7/26 (26%), Positives = 16/26 (61%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE 262
             E+ E  E  ++   E  ++++DE+D+
Sbjct:  1240 EEEEEKEEEEEEEEEEEEEEEDENDD 1265


>gi|1778311 (U72938) putative DNA dependent ATPase and helicase [Homo sapiens]
            >gi|1778352 (U72935) putative DNA dependent ATPase and helicase
            [Homo sapiens]
            Length = 2337

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 2.3e-06, Sum P(2) = 2.3e-06
 Identities = 26/54 (48%), Positives = 38/54 (70%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDGST    R+K  + F+ + N+   +F++STKAG +G+NL+AAN VI+ D
Sbjct:  1928 YYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFD 1981

 Score = 61 (21.5 bits), Expect = 2.3e-06, Sum P(2) = 2.3e-06
 Identities = 17/58 (29%), Positives = 27/58 (46%), Frame = -1

Query:   393 ENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV 220
             +NK   K + +K N +Y      S +   +NC   +KK D+     C  S T S S++
Sbjct:   138 QNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDS----CSGSVTYSYSAL 191

 Score = 59 (20.8 bits), Expect = 3.8e-06, Sum P(2) = 3.8e-06
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = -1

Query:   513 KEENNINVNVFIKEEQNYHDIG--KETKRHDDNNNNNINDG-----DENKFCFKEN---- 367
             K  N   V+    E+ ++ + G  +E    +D              +EN+  +K+     
Sbjct:  1212 KGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRR 1271

Query:   366 -IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              IK   D  +E+  NSE  ++   E  +++++E++EE
Sbjct:  1272 RIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEE 1308

 Score = 48 (16.9 bits), Expect = 3.2e-05, Sum P(3) = 3.2e-05
 Identities = 17/57 (29%), Positives = 27/57 (47%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDG--DENK 385
             K   S  K   I KE+   ++    K +Q   DI   +    +D++ N+I +G  DE K
Sbjct:  1014 KQRTSSKKKAVIVKEKKRNSLRTSTKRKQA--DITSSSSSDIEDDDQNSIGEGSSDEQK 1070

 Score = 47 (16.5 bits), Expect = 6.4e-05, Sum P(2) = 6.4e-05
 Identities = 13/51 (25%), Positives = 27/51 (52%), Frame = -1

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK 277
             D++ +++    +  K   K+N + P D   ++  NSE   D++ E +KK +
Sbjct:  1132 DEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSE--SDSDSEESKKPR 1180

 Score = 43 (15.1 bits), Expect = 0.00016, Sum P(2) = 0.00016
 Identities = 18/92 (19%), Positives = 40/92 (43%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNIN--VNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             +T + S+ + K  T  K ++ ++     F+K++Q+      ET   D   +    +  + 
Sbjct:   786 ETKEKSKHL-KTKTCKKVQDGLSDIAEKFLKKDQS-----DETSEDDKKQSKKGTEEKKK 839

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTN--CEYNK 286
                FK+ + K    Y    + +E+  +    C + K
Sbjct:   840 PSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPK 875

 Score = 42 (14.8 bits), Expect = 0.00021, Sum P(2) = 0.00021
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K ++FSQ    LD+IE+ L
Sbjct:  1881 KVLVFSQSLISLDLIEDFL 1899

 Score = 40 (14.1 bits), Expect = 3.2e-05, Sum P(3) = 3.2e-05
 Identities = 14/56 (25%), Positives = 29/56 (51%), Frame = -1

Query:   396 DENKFCFKEN-----IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE----- 259
             +EN+  +K+      IK   D  +E+  NSE  ++   E  +++++E++EE     
Sbjct:  1258 EENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDEND 1313

 Score = 39 (13.7 bits), Expect = 4.0e-05, Sum P(3) = 4.0e-05
 Identities = 7/26 (26%), Positives = 16/26 (61%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE 262
             E+ E  E  ++   E  ++++DE+D+
Sbjct:  1289 EEEEEKEEEEEEEEEEEEEEEDENDD 1314


>gi|1778309 (U72937) putative DNA dependent ATPase and helicase [Homo sapiens]
            >gi|1778351 (U72935) putative DNA dependent ATPase and helicase
            [Homo sapiens]
            Length = 2375

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 2.4e-06, Sum P(2) = 2.4e-06
 Identities = 26/54 (48%), Positives = 38/54 (70%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDGST    R+K  + F+ + N+   +F++STKAG +G+NL+AAN VI+ D
Sbjct:  1966 YYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFD 2019

 Score = 61 (21.5 bits), Expect = 2.4e-06, Sum P(2) = 2.4e-06
 Identities = 17/58 (29%), Positives = 27/58 (46%), Frame = -1

Query:   393 ENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV 220
             +NK   K + +K N +Y      S +   +NC   +KK D+     C  S T S S++
Sbjct:   176 QNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDS----CSGSVTYSYSAL 229

 Score = 59 (20.8 bits), Expect = 3.9e-06, Sum P(2) = 3.9e-06
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = -1

Query:   513 KEENNINVNVFIKEEQNYHDIG--KETKRHDDNNNNNINDG-----DENKFCFKEN---- 367
             K  N   V+    E+ ++ + G  +E    +D              +EN+  +K+     
Sbjct:  1250 KGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRR 1309

Query:   366 -IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              IK   D  +E+  NSE  ++   E  +++++E++EE
Sbjct:  1310 RIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEE 1346

 Score = 48 (16.9 bits), Expect = 3.3e-05, Sum P(3) = 3.3e-05
 Identities = 17/57 (29%), Positives = 27/57 (47%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDG--DENK 385
             K   S  K   I KE+   ++    K +Q   DI   +    +D++ N+I +G  DE K
Sbjct:  1052 KQRTSSKKKAVIVKEKKRNSLRTSTKRKQA--DITSSSSSDIEDDDQNSIGEGSSDEQK 1108

 Score = 47 (16.5 bits), Expect = 6.6e-05, Sum P(2) = 6.6e-05
 Identities = 13/51 (25%), Positives = 27/51 (52%), Frame = -1

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK 277
             D++ +++    +  K   K+N + P D   ++  NSE   D++ E +KK +
Sbjct:  1170 DEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSE--SDSDSEESKKPR 1218

 Score = 43 (15.1 bits), Expect = 0.00017, Sum P(2) = 0.00017
 Identities = 18/92 (19%), Positives = 40/92 (43%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNIN--VNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             +T + S+ + K  T  K ++ ++     F+K++Q+      ET   D   +    +  + 
Sbjct:   824 ETKEKSKHL-KTKTCKKVQDGLSDIAEKFLKKDQS-----DETSEDDKKQSKKGTEEKKK 877

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTN--CEYNK 286
                FK+ + K    Y    + +E+  +    C + K
Sbjct:   878 PSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPK 913

 Score = 42 (14.8 bits), Expect = 0.00021, Sum P(2) = 0.00021
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K ++FSQ    LD+IE+ L
Sbjct:  1919 KVLVFSQSLISLDLIEDFL 1937

 Score = 40 (14.1 bits), Expect = 3.3e-05, Sum P(3) = 3.3e-05
 Identities = 14/56 (25%), Positives = 29/56 (51%), Frame = -1

Query:   396 DENKFCFKEN-----IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE----- 259
             +EN+  +K+      IK   D  +E+  NSE  ++   E  +++++E++EE     
Sbjct:  1296 EENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDEND 1351

 Score = 39 (13.7 bits), Expect = 4.2e-05, Sum P(3) = 4.2e-05
 Identities = 7/26 (26%), Positives = 16/26 (61%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE 262
             E+ E  E  ++   E  ++++DE+D+
Sbjct:  1327 EEEEEKEEEEEEEEEEEEEEEDENDD 1352


>gi|2306809 (U97103) X-linked nuclear protein [Homo sapiens]
            Length = 2375

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 2.4e-06, Sum P(2) = 2.4e-06
 Identities = 26/54 (48%), Positives = 38/54 (70%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDGST    R+K  + F+ + N+   +F++STKAG +G+NL+AAN VI+ D
Sbjct:  1966 YYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFD 2019

 Score = 61 (21.5 bits), Expect = 2.4e-06, Sum P(2) = 2.4e-06
 Identities = 17/58 (29%), Positives = 27/58 (46%), Frame = -1

Query:   393 ENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV 220
             +NK   K + +K N +Y      S +   +NC   +KK D+     C  S T S S++
Sbjct:   176 QNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDS----CSGSVTYSYSAL 229

 Score = 59 (20.8 bits), Expect = 3.9e-06, Sum P(2) = 3.9e-06
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = -1

Query:   513 KEENNINVNVFIKEEQNYHDIG--KETKRHDDNNNNNINDG-----DENKFCFKEN---- 367
             K  N   V+    E+ ++ + G  +E    +D              +EN+  +K+     
Sbjct:  1250 KGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRR 1309

Query:   366 -IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              IK   D  +E+  NSE  ++   E  +++++E++EE
Sbjct:  1310 RIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEE 1346

 Score = 48 (16.9 bits), Expect = 3.3e-05, Sum P(3) = 3.3e-05
 Identities = 17/57 (29%), Positives = 27/57 (47%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDG--DENK 385
             K   S  K   I KE+   ++    K +Q   DI   +    +D++ N+I +G  DE K
Sbjct:  1052 KQRTSSKKKAVIVKEKKRNSLRTSTKRKQA--DITSSSSSDIEDDDQNSIGEGSSDEQK 1108

 Score = 47 (16.5 bits), Expect = 6.6e-05, Sum P(2) = 6.6e-05
 Identities = 13/51 (25%), Positives = 27/51 (52%), Frame = -1

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK 277
             D++ +++    +  K   K+N + P D   ++  NSE   D++ E +KK +
Sbjct:  1170 DEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSE--SDSDSEESKKPR 1218

 Score = 43 (15.1 bits), Expect = 0.00017, Sum P(2) = 0.00017
 Identities = 18/92 (19%), Positives = 40/92 (43%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNIN--VNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             +T + S+ + K  T  K ++ ++     F+K++Q+      ET   D   +    +  + 
Sbjct:   824 ETKEKSKHL-KTKTCKKVQDGLSDIAEKFLKKDQS-----DETSEDDKKQSKKGTEEKKK 877

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTN--CEYNK 286
                FK+ + K    Y    + +E+  +    C + K
Sbjct:   878 PSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPK 913

 Score = 42 (14.8 bits), Expect = 0.00021, Sum P(2) = 0.00021
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K ++FSQ    LD+IE+ L
Sbjct:  1919 KVLVFSQSLISLDLIEDFL 1937

 Score = 40 (14.1 bits), Expect = 3.3e-05, Sum P(3) = 3.3e-05
 Identities = 14/56 (25%), Positives = 29/56 (51%), Frame = -1

Query:   396 DENKFCFKEN-----IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE----- 259
             +EN+  +K+      IK   D  +E+  NSE  ++   E  +++++E++EE     
Sbjct:  1296 EENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDEND 1351

 Score = 39 (13.7 bits), Expect = 4.2e-05, Sum P(3) = 4.2e-05
 Identities = 7/26 (26%), Positives = 16/26 (61%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE 262
             E+ E  E  ++   E  ++++DE+D+
Sbjct:  1327 EEEEEKEEEEEEEEEEEEEEEDENDD 1352


>gnl|PID|e315493 (Z95334) unknown [Schizosaccharomyces pombe]
            Length = 944

  Minus Strand HSPs:

 Score = 140 (49.3 bits), Expect = 2.6e-06, Sum P(2) = 2.6e-06
 Identities = 30/52 (57%), Positives = 37/52 (71%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             ++RLDGST    RQ++I  F  +EN  VFLLSTK+GG G+NL  AN VIL D
Sbjct:   807 FLRLDGSTPVETRQQLIDDFHTNENYKVFLLSTKSGGFGINLTCANIVILFD 858

 Score = 39 (13.7 bits), Expect = 2.6e-06, Sum P(2) = 2.6e-06
 Identities = 9/26 (34%), Positives = 17/26 (65%), Frame = -1

Query:   285 KKKDEDDEEICLTSSTLSTSSVGTQN 208
             K+KD + E IC+ SS+  ++ +  +N
Sbjct:     2 KRKD-NKELICIPSSSPPSTPIREEN 26


>sp|P32333|MOT1_YEAST PROBABLE HELICASE MOT1 >pir||S22775 MOT1 protein - yeast
            (Saccharomyces cerevisiae) >gi|171965 (M83224) Mot1 [Saccharomyces
            cerevisiae] >gi|1147612 (U41849) LPF4c; Mot1p is a probable
            helicase essential for vegetative growth on rich glucose medium at
            30 degree C: Swiss-Prot Accession number P32333; similar to S.
            cerevisiae RAD26 gene product: Swiss-Prot Accession number P40352
            [Saccharo...
            Length = 1867

  Minus Strand HSPs:

 Score = 135 (47.5 bits), Expect = 4.5e-06, Sum P(2) = 4.5e-06
 Identities = 25/52 (48%), Positives = 40/52 (76%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDGS +  +RQK++++F++D +I   LL+TK GG+GLNL  A+ VI ++
Sbjct:  1676 YMRLDGSIDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVE 1727

 Score = 50 (17.6 bits), Expect = 4.5e-06, Sum P(2) = 4.5e-06
 Identities = 10/27 (37%), Positives = 16/27 (59%), Frame = -1

Query:   399 GDENKFCFKENIKKPNDIYNEDMENSE 319
             GD  K  + +  KK  ++  +D+ENSE
Sbjct:  1529 GDLQKQLYMDFTKKQKNVVEKDIENSE 1555

 Score = 41 (14.4 bits), Expect = 3.8e-05, Sum P(2) = 3.8e-05
 Identities = 7/24 (29%), Positives = 15/24 (62%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEALLYEFI 592
             +++IF Q    LD++E  L  +++
Sbjct:  1648 RALIFCQLKDMLDMVENDLFKKYM 1671


>pir||C30010 hypothetical ORF-6 protein - Sauroleishmania tarentolae
            mitochondrion (SGC6)
            Length = 245

  Plus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 4.8e-06, P = 4.8e-06
 Identities = 38/118 (32%), Positives = 63/118 (53%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIF-IIYIIWFFYIF-FKTKFIFIPIINII--IIVI 426
             + + FIF  FI F+  + S   I ++F +I+  + F +F F   FIF  I  +I  + VI
Sbjct:    11 YLLCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCFIFFVIRCLFVI 70

Query:   427 IMTFCFFTYIMIILFFFYKHIYI-YIIFFLTY-GIIFIYAL*TFNSLYMIHIITIIIY 594
             I  F FF + + I F     IYI YI F L Y G IF +    F  +++++ + ++++
Sbjct:    71 IYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFIFVLNYVFLVLF 128

 Score = 128 (45.1 bits), Expect = 8.7e-06, P = 8.7e-06
 Identities = 47/161 (29%), Positives = 71/161 (44%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTYFFIIFIFFLFI 291
             Y+  F   F DF+SF++   S    IN+   VI C       S     ++FII   F FI
Sbjct:    11 YLLCF--IFIDFISFSNHLISYFGIINMFN-VIFC-------SYLFCLFYFIICFIFCFI 60

Query:   292 IFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIIL 468
              F I C+F    I + F+ +    +  F     I+I  I  ++I     F F T     +
Sbjct:    61 FFVIRCLFV---IIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFI 117

Query:   469 FFF-YKHIYIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITIIIY 594
             F   Y  + ++ +  L +G +F+ Y L TF   Y   +   IIY
Sbjct:   118 FVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLY--IIY 159

 Score = 126 (44.4 bits), Expect = 1.6e-05, P = 1.6e-05
 Identities = 45/153 (29%), Positives = 68/153 (44%), Frame = +1

Query:   136 FYDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTYFFIIFIFFLFIIFTI-CIF 312
             F DF+SF++   S    IN+   VI C       S     ++FII   F FI F I C+F
Sbjct:    17 FIDFISFSNHLISYFGIINMFN-VIFC-------SYLFCLFYFIICFIFCFIFFVIRCLF 68

Query:   313 SSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFF-YKHI 489
                 I + F+ +    +  F     I+I  I  ++I     F F T     +F   Y  +
Sbjct:    69 V---IIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFIFVLNYVFL 125

Query:   490 YIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITIIIY 594
              ++ +  L +G +F+ Y L TF   Y   +   IIY
Sbjct:   126 VLFFVLALFFGFLFLSYGLFTFLIYYFFWLY--IIY 159

 Score = 121 (42.6 bits), Expect = 6.5e-05, P = 6.5e-05
 Identities = 28/108 (25%), Positives = 56/108 (51%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINI----IIIV 423
             Y F++ +FF+  +F   +F S  +F   I Y  W + I+ ++ FI +  + I    +   
Sbjct:   122 YVFLV-LFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVVIFFKFLYFD 180

Query:   424 IIMTFCFFTYIMIILFF-FYKHIYIYI-IFFLTYGIIFIYAL*TFNSLY 564
             +   F F   + II FF F+   ++++ IFF  + ++ IY +  +++ Y
Sbjct:   181 VFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDVNNYSAFY 229

 Score = 116 (40.8 bits), Expect = 0.00027, P = 0.00027
 Identities = 27/102 (26%), Positives = 55/102 (53%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             FF++ +FF F+  +  +F+ L I++ F +YII+    F   + + I     +   +   F
Sbjct:   128 FFVLALFFGFLFLSYGLFTFL-IYYFFWLYIIYSRSCFILLQSVVI-FFKFLYFDVFFIF 185

Query:   439 CFFTYIMIILFF-FYKHIYIYI-IFFLTYGIIFIYAL*TFNSLY 564
              F   + II FF F+   ++++ IFF  + ++ IY +  +++ Y
Sbjct:   186 VFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDVNNYSAFY 229

 Score = 113 (39.8 bits), Expect = 0.00062, P = 0.00062
 Identities = 33/113 (29%), Positives = 52/113 (46%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             ++FII   F FI F I C+F    I + F+ +    +  F     I+I  I  ++I    
Sbjct:    49 FYFIICFIFCFIFFVIRCLFV---IIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGF 105

Query:   433 TFCFFTYIMIILFFF-YKHIYIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITIIIY 594
              F F T     +F   Y  + ++ +  L +G +F+ Y L TF   Y   +   IIY
Sbjct:   106 IFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLY--IIY 159

 Score = 100 (35.2 bits), Expect = 0.022, P = 0.022
 Identities = 37/125 (29%), Positives = 64/125 (51%), Frame = +1

Query:   262 FIIFIFFLFIIFTICI-FSSL*IFHI-FIIYI-IWFFYIF-FKTKFI-FIPIINIIIIVI 426
             F+I   FLF  F I I F    I +I +I ++ I+F +IF F T F  FI ++N + +V+
Sbjct:    68 FVIIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFIFVLNYVFLVL 127

Query:   427 IMTFC-FFTYIMII--LFFF--YKHIYIYII-----FFLTYGIIFIYAL*TFNSLYMIHI 576
                   FF ++ +   LF F  Y   ++YII     F L   ++  +    F+ ++ I +
Sbjct:   128 FFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVVIFFKFLYFD-VFFIFV 186

Query:   577 ITIIIY 594
               +I++
Sbjct:   187 FLLILF 192

 Score = 88 (31.0 bits), Expect = 0.57, P = 0.44
 Identities = 38/167 (22%), Positives = 72/167 (43%), Frame = +1

Query:   139 YDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTYFFIIFIFFLFIIFT--IC-I 309
             YDFL FN        YI+ + C I+  +            F +I+  F+F   T   C I
Sbjct:    72 YDFLFFN-----FDIYISFLMCDIIYIDY---------ICFLLIYFGFIFSFITGFFCFI 117

Query:   310 FSSL*IFHI-FIIYIIWFFYIFFKTK-FIFIPIINIIIIVIIMTFCFFTYIMIILFFFYK 483
             F    +F + F +  ++F ++F     F F+      + +I    CF     +++FF  K
Sbjct:   118 FVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVVIFF--K 175

Query:   484 HIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGLLYNIKKSS 639
              +Y + +FF+   ++ ++ +  F       +   I +      L+Y++   S
Sbjct:   176 FLY-FDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDVNNYS 226

 Score = 82 (28.9 bits), Expect = 2.8, P = 0.94
 Identities = 23/89 (25%), Positives = 44/89 (49%), Frame = +1

Query:   328 FHIFIIYIIWFFYIFFKTKFI-FIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYII 504
             F  +++  I+  +I F    I +  IIN+  ++    FC  +Y+  + +F    I+ +I 
Sbjct:     8 FFTYLLCFIFIDFISFSNHLISYFGIINMFNVI----FC--SYLFCLFYFIICFIFCFIF 61

Query:   505 FFLTYGIIFIYAL*TFN-SLYMIHIITIIIY 594
             F +    + IY    FN  +Y+  ++  IIY
Sbjct:    62 FVIRCLFVIIYDFLFFNFDIYISFLMCDIIY 92


>gnl|PID|e281743 (Z81089) F53H4.1 [Caenorhabditis elegans]
            Length = 1785

  Minus Strand HSPs:

 Score = 131 (46.1 bits), Expect = 5.2e-06, Sum P(2) = 5.2e-06
 Identities = 27/51 (52%), Positives = 36/51 (70%), Frame = -1

Query:   186 VRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             V L G+ +   R KIIK+F  D +I VFL++T+AGG+GLNL  AN VI+ D
Sbjct:   566 VSLTGADSAAARPKIIKKFEDDVSIKVFLMTTRAGGLGLNLTCANKVIIFD 616

 Score = 54 (19.0 bits), Expect = 5.2e-06, Sum P(2) = 5.2e-06
 Identities = 21/109 (19%), Positives = 50/109 (45%), Frame = -1

Query:   489 NVFIKEEQNYHDIGKETKRHDDNNNNNINDG-----DENKFCFKENIKKPNDIYNEDMEN 325
             ++ + E+QN     +   R  ++++++ ++      DE  FC  +       I ++  + 
Sbjct:    24 DIVVIEDQNTPKYREAALRRSNSSSSDFDEKWEPELDEEDFCENDADVLAEPISSKSRKK 83

Query:   324 SERTKDTNCEYNKKKKDEDDEEI-CLTSSTLSTSSVGTQNDAGHQIYVRLD 175
             S R+ D++ E+   ++ +DDEE   L  S       G+ + +    ++  D
Sbjct:    84 SRRS-DSS-EFVPSEESDDDEEYEVLEKSRKKGRKSGSSSRSSSDDFIESD 132


>gi|172764 (M83755) STH1 protein [Saccharomyces cerevisiae]
           Length = 1352

  Minus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 5.5e-06, Sum P(2) = 5.5e-06
 Identities = 29/53 (54%), Positives = 39/53 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDGST T ER +++  F+  D + F FLLST+AGG+GLNL  A+ VI+ D
Sbjct:   834 YMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFD 886

 Score = 42 (14.8 bits), Expect = 5.5e-06, Sum P(2) = 5.5e-06
 Identities = 7/28 (25%), Positives = 15/28 (53%), Frame = -1

Query:   369 NIKKPNDIYNEDMENSERTKDTNCEYNK 286
             NI +  DIY   ++   ++ D   +Y++
Sbjct:    85 NISRDQDIYETKLDTLRKSIDKGFQYDE 112


>sp|P32597|STH1_YEAST NUCLEAR PROTEIN STH1/NPS1 >pir||S49883 nuclear protein
            STH1 - yeast (Saccharomyces cerevisiae) >gnl|PID|d1001921 (D10595)
            nuclear protein [Saccharomyces cerevisiae] >gi|599991 (Z46833)
            nuclear protein [Saccharomyces cerevisiae] >gi|763220 (Z47047)
            Nps1p [Saccharomyces cerevisiae]
            Length = 1359

  Minus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 5.5e-06, Sum P(2) = 5.5e-06
 Identities = 29/53 (54%), Positives = 39/53 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDGST T ER +++  F+  D + F FLLST+AGG+GLNL  A+ VI+ D
Sbjct:   834 YMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFD 886

 Score = 42 (14.8 bits), Expect = 5.5e-06, Sum P(2) = 5.5e-06
 Identities = 7/28 (25%), Positives = 15/28 (53%), Frame = -1

Query:   369 NIKKPNDIYNEDMENSERTKDTNCEYNK 286
             NI +  DIY   ++   ++ D   +Y++
Sbjct:    85 NISRDQDIYETKLDTLRKSIDKGFQYDE 112


>sp|P38086|YBS3_YEAST HYPOTHETICAL 108.0 KD HELICASE IN HSP26-SEC18 INTERGENIC
            REGION >pir||S45466 probable DNA repair protein - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e264510 (X76294) ORF YBRO715;
            homologous to Rad54 Snf2 and Sth1 of S.cerevisiae [Saccharomyces
            cerevisiae] >gi|536326 (Z35942) ORF YBR073w [Saccharomyces
            cerevisiae]
            Length = 958

  Minus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 5.8e-06, P = 5.8e-06
 Identities = 38/116 (32%), Positives = 63/116 (54%), Frame = -1

Query:   378 FKENIK--KPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV-GTQN 208
             +K +IK  +  D Y+  + NS + K         +K   ++ + +++ T +   +    N
Sbjct:   644 YKSHIKDTQSQDSYSRSL-NSGKLKVLMTLLEGIRKGTKEKVVVVSNYTQTLDIIENLMN 702

Query:   207 DAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
              AG   + RLDGS    +R  I+  F+++  IF FLLS K+GGVGLNL+  + +IL D
Sbjct:   703 MAGMS-HCRLDGSIPAKQRDSIVTSFNRNPAIFGFLLSAKSGGVGLNLVGRSRLILFD 759


>gnl|PID|e349697 (Z99292) dna repair protein [Schizosaccharomyces pombe]
            Length = 897

  Minus Strand HSPs:

 Score = 134 (47.2 bits), Expect = 7.6e-06, Sum P(2) = 7.6e-06
 Identities = 26/52 (50%), Positives = 37/52 (71%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +VR DG+ +  +RQK +  F+ D+++ V L+S KAG VGLNL  ANHVIL +
Sbjct:   768 HVRYDGTMSANQRQKSLHSFNNDKDVLVMLVSLKAGSVGLNLTIANHVILQE 819

 Score = 42 (14.8 bits), Expect = 7.6e-06, Sum P(2) = 7.6e-06
 Identities = 20/76 (26%), Positives = 37/76 (48%), Frame = -1

Query:   636 TFLDIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYH 457
             T L ++  ALL+++  + S  + H  + K S  I+   T  K  ++  ++ +      Y 
Sbjct:   302 TNLIVVSVALLHQWAEELSTKV-H-PSKKLSVYIHHGSTK-KNLDSYELSQYDVVLTTYS 358

Query:   456 DIGKETKRHDDNNNNN 409
              +  E K++D  NNNN
Sbjct:   359 MLAYEMKQNDAFNNNN 374


>gnl|PID|e290080 (Y10229) RAD54 [Drosophila melanogaster]
            Length = 784

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 8.0e-06, P = 8.0e-06
 Identities = 31/82 (37%), Positives = 51/82 (62%), Frame = -1

Query:   273 EDDEEICLTSSTLSTSSVGTQNDAGHQI-YVRLDGSTNTIERQKIIKRFSKDEN-IFVFL 100
             E ++++ L S+   T  +  Q     +  +VRLDG+ +  +R K++ RF+  E+  F+F+
Sbjct:   514 EGNDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFNDPESDSFLFM 573

Query:    99 LSTKAGGVGLNLIAANHVILMD 34
             LS+KAGG GLNLI AN + + D
Sbjct:   574 LSSKAGGCGLNLIGANRLFMFD 595


>sp|P25439|BRM_DROME HOMEOTIC GENE REGULATOR (BRAHMA PROTEIN) >pir||A42091
            transcriptional activator SNF2/SWI2 homolog brm - fruit fly
            (Drosophila melanogaster) >gi|157012 (M85049) brahma protein
            [Drosophila melanogaster]
            Length = 1638

  Minus Strand HSPs:

 Score = 139 (48.9 bits), Expect = 8.3e-06, P = 8.3e-06
 Identities = 26/53 (49%), Positives = 42/53 (79%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFS-KDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDG+T   +R +++++F+ K  ++FVFLLST+AGG+GLNL  A+ V++ D
Sbjct:  1141 YLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFD 1193


>pir||S45251 SNF2alpha protein - human >gnl|PID|d1005684 (D26155) hSNF2a [Homo
            sapiens]
            Length = 1572

  Minus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 1.0e-05, P = 1.0e-05
 Identities = 26/54 (48%), Positives = 42/54 (77%), Frame = -1

Query:   192 IYVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +Y+RLDG+T + +R  ++K+F++     F+FLLST+AGG+GLNL AA+ V++ D
Sbjct:  1092 LYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAAHTVVIFD 1145


>sp|P51531|SN22_HUMAN POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L2
            (SNF2-ALPHA) >pir||S39580 HBRM protein - human >gi|414117 (X72889)
            HBRM [Homo sapiens]
            Length = 1586

  Minus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 26/54 (48%), Positives = 42/54 (77%), Frame = -1

Query:   192 IYVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +Y+RLDG+T + +R  ++K+F++     F+FLLST+AGG+GLNL AA+ V++ D
Sbjct:  1088 LYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFD 1141


>gi|340613 (L07545) A 'c' was inserted after nt 369 (=nt 10459 in genomic
           sequence (M10126)) to correct -1 frameshift probably due to gel
           compression [Leishmania tarentolae]
           Length = 355

  Plus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 38/118 (32%), Positives = 63/118 (53%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIF-IIYIIWFFYIF-FKTKFIFIPIINII--IIVI 426
             + + FIF  FI F+  + S   I ++F +I+  + F +F F   FIF  I  +I  + VI
Sbjct:   121 YLLCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCFIFFVIRCLFVI 180

Query:   427 IMTFCFFTYIMIILFFFYKHIYI-YIIFFLTY-GIIFIYAL*TFNSLYMIHIITIIIY 594
             I  F FF + + I F     IYI YI F L Y G IF +    F  +++++ + ++++
Sbjct:   181 IYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFIFVLNYVFLVLF 238

 Score = 128 (45.1 bits), Expect = 2.2e-05, P = 2.2e-05
 Identities = 47/161 (29%), Positives = 71/161 (44%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTYFFIIFIFFLFI 291
             Y+  F   F DF+SF++   S    IN+   VI C       S     ++FII   F FI
Sbjct:   121 YLLCF--IFIDFISFSNHLISYFGIINMFN-VIFC-------SYLFCLFYFIICFIFCFI 170

Query:   292 IFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIIL 468
              F I C+F    I + F+ +    +  F     I+I  I  ++I     F F T     +
Sbjct:   171 FFVIRCLFV---IIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFI 227

Query:   469 FFF-YKHIYIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITIIIY 594
             F   Y  + ++ +  L +G +F+ Y L TF   Y   +   IIY
Sbjct:   228 FVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLY--IIY 269

 Score = 121 (42.6 bits), Expect = 0.00015, P = 0.00015
 Identities = 28/108 (25%), Positives = 56/108 (51%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINI----IIIV 423
             Y F++ +FF+  +F   +F S  +F   I Y  W + I+ ++ FI +  + I    +   
Sbjct:   232 YVFLV-LFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVVIFFKFLYFD 290

Query:   424 IIMTFCFFTYIMIILFF-FYKHIYIYI-IFFLTYGIIFIYAL*TFNSLY 564
             +   F F   + II FF F+   ++++ IFF  + ++ IY +  +++ Y
Sbjct:   291 VFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDVNNYSAFY 339

 Score = 116 (40.8 bits), Expect = 0.00061, P = 0.00061
 Identities = 27/102 (26%), Positives = 55/102 (53%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             FF++ +FF F+  +  +F+ L I++ F +YII+    F   + + I     +   +   F
Sbjct:   238 FFVLALFFGFLFLSYGLFTFL-IYYFFWLYIIYSRSCFILLQSVVI-FFKFLYFDVFFIF 295

Query:   439 CFFTYIMIILFF-FYKHIYIYI-IFFLTYGIIFIYAL*TFNSLY 564
              F   + II FF F+   ++++ IFF  + ++ IY +  +++ Y
Sbjct:   296 VFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDVNNYSAFY 339

 Score = 113 (39.8 bits), Expect = 0.0014, P = 0.0014
 Identities = 33/113 (29%), Positives = 52/113 (46%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             ++FII   F FI F I C+F    I + F+ +    +  F     I+I  I  ++I    
Sbjct:   159 FYFIICFIFCFIFFVIRCLFV---IIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGF 215

Query:   433 TFCFFTYIMIILFFF-YKHIYIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITIIIY 594
              F F T     +F   Y  + ++ +  L +G +F+ Y L TF   Y   +   IIY
Sbjct:   216 IFSFITGFFCFIFVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLY--IIY 269

 Score = 110 (38.7 bits), Expect = 0.0031, P = 0.0031
 Identities = 32/103 (31%), Positives = 53/103 (51%), Frame = +1

Query:   250 KTYFFIIFIFFL-FIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFI--FIPIINIIII 420
             ++Y FI++ F L FI++       + I  IF+  + +F  IFF   F+  FI    +  +
Sbjct:    25 RSYDFILWWFDLDFILYDFVFDFVVCITFIFVFVLGFFLRIFFSFVFVLLFIVFFGLFSL 84

Query:   421 VIIMT--FCFFTYIM--IILFFFYKHIYIYIIFFLTYGIIFIY 537
               + T  F ++ YI+   I +FF   I +Y I F TY + FI+
Sbjct:    85 SFLYTGYFIYYIYILYNFICYFFCFSIALYYIEFFTYLLCFIF 127

 Score = 109 (38.4 bits), Expect = 0.0041, P = 0.0041
 Identities = 33/111 (29%), Positives = 62/111 (55%), Frame = +1

Query:   271 FIFFLFIIFT-ICIFS--SL*IFHI-FIIYIIWFFYI-F--FKTKFI-FIPIINIIIIVI 426
             FI++++I++  IC F   S+ +++I F  Y++ F +I F  F    I +  IIN+  ++ 
Sbjct:    92 FIYYIYILYNFICYFFCFSIALYYIEFFTYLLCFIFIDFISFSNHLISYFGIINMFNVI- 150

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFN-SLYMIHIITIIIY 594
                FC  +Y+  + +F    I+ +I F +    + IY    FN  +Y+  ++  IIY
Sbjct:   151 ---FC--SYLFCLFYFIICFIFCFIFFVIRCLFVIIYDFLFFNFDIYISFLMCDIIY 202

 Score = 100 (35.2 bits), Expect = 0.045, P = 0.044
 Identities = 31/115 (26%), Positives = 54/115 (46%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIF---FKTKFIFIPIINIIIIVIIM 432
             F++ I F+F+ F +  F  +    +F++  I FF +F   F     FI  I I+   I  
Sbjct:    47 FVVCITFIFV-FVLGFFLRIFFSFVFVLLFIVFFGLFSLSFLYTGYFIYYIYILYNFICY 105

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIF--FLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
              FCF   +  I FF Y   +I+I F  F  + I +   +  FN ++  ++  +  +
Sbjct:   106 FFCFSIALYYIEFFTYLLCFIFIDFISFSNHLISYFGIINMFNVIFCSYLFCLFYF 161

 Score = 100 (35.2 bits), Expect = 0.045, P = 0.044
 Identities = 37/125 (29%), Positives = 64/125 (51%), Frame = +1

Query:   262 FIIFIFFLFIIFTICI-FSSL*IFHI-FIIYI-IWFFYIF-FKTKFI-FIPIINIIIIVI 426
             F+I   FLF  F I I F    I +I +I ++ I+F +IF F T F  FI ++N + +V+
Sbjct:   178 FVIIYDFLFFNFDIYISFLMCDIIYIDYICFLLIYFGFIFSFITGFFCFIFVLNYVFLVL 237

Query:   427 IMTFC-FFTYIMII--LFFF--YKHIYIYII-----FFLTYGIIFIYAL*TFNSLYMIHI 576
                   FF ++ +   LF F  Y   ++YII     F L   ++  +    F+ ++ I +
Sbjct:   238 FFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVVIFFKFLYFD-VFFIFV 296

Query:   577 ITIIIY 594
               +I++
Sbjct:   297 FLLILF 302

 Score = 98 (34.5 bits), Expect = 0.077, P = 0.074
 Identities = 30/115 (26%), Positives = 59/115 (51%), Frame = +1

Query:   259 FFIIFIFFLFIIFTIC-IFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             F ++FI F F +F++  +++   I++I+I+Y    ++  F     +I     ++  I + 
Sbjct:    71 FVLLFIVF-FGLFSLSFLYTGYFIYYIYILYNFICYFFCFSIALYYIEFFTYLLCFIFID 129

Query:   436 FCFFTYIMIILFFF---YKHIYIYIIFFLTYGII-FIYAL*TFNSLYMIHIITIIIYKFI 603
             F  F+  +I  F     +  I+   +F L Y II FI+        ++I  + +IIY F+
Sbjct:   130 FISFSNHLISYFGIINMFNVIFCSYLFCLFYFIICFIFCF----IFFVIRCLFVIIYDFL 185

 Score = 97 (34.1 bits), Expect = 0.10, P = 0.095
 Identities = 27/114 (23%), Positives = 57/114 (50%), Frame = +1

Query:   268 IFIFFLFIIFTICIFSSL*IFHIFII----YIIWFF---YIFFKTKFIFIPIINIIIIVI 426
             +F  F  ++F +C F    +F +  +    +I+W+F   +I +   F F+  I  I + +
Sbjct:     1 MFGCFNLVLF-LC-FDCSRVFDLLCVRSYDFILWWFDLDFILYDFVFDFVVCITFIFVFV 58

Query:   427 IMTFC--FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             +  F   FF+++ ++LF  +  ++     +  Y I +IY L  +N +      +I +Y
Sbjct:    59 LGFFLRIFFSFVFVLLFIVFFGLFSLSFLYTGYFIYYIYIL--YNFICYFFCFSIALY 114

 Score = 88 (31.0 bits), Expect = 1.1, P = 0.66
 Identities = 38/167 (22%), Positives = 72/167 (43%), Frame = +1

Query:   139 YDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTYFFIIFIFFLFIIFT--IC-I 309
             YDFL FN        YI+ + C I+  +            F +I+  F+F   T   C I
Sbjct:   182 YDFLFFN-----FDIYISFLMCDIIYIDY---------ICFLLIYFGFIFSFITGFFCFI 227

Query:   310 FSSL*IFHI-FIIYIIWFFYIFFKTK-FIFIPIINIIIIVIIMTFCFFTYIMIILFFFYK 483
             F    +F + F +  ++F ++F     F F+      + +I    CF     +++FF  K
Sbjct:   228 FVLNYVFLVLFFVLALFFGFLFLSYGLFTFLIYYFFWLYIIYSRSCFILLQSVVIFF--K 285

Query:   484 HIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGLLYNIKKSS 639
              +Y + +FF+   ++ ++ +  F       +   I +      L+Y++   S
Sbjct:   286 FLY-FDVFFIFVFLLILFIICFFGFFLKDFLFLNIFFDMFSVLLIYDVNNYS 336


>gi|996020 (X91638) BRM protein [Gallus gallus]
           Length = 1568

  Minus Strand HSPs:

 Score = 139 (48.9 bits), Expect = 1.4e-05, Sum P(2) = 1.4e-05
 Identities = 27/54 (50%), Positives = 42/54 (77%), Frame = -1

Query:   192 IYVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +Y+RLDG+T + +R  ++K+F++     F+FLLST+AGG+GLNL AA+ VI+ D
Sbjct:  1088 LYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVIIFD 1141

 Score = 38 (13.4 bits), Expect = 1.4e-05, Sum P(2) = 1.4e-05
 Identities = 10/28 (35%), Positives = 16/28 (57%), Frame = -1

Query:   342 NEDMENSERTKDTNCEYNKKKKDEDDEE 259
             N   E + R+ D+  E   + ++EDDEE
Sbjct:   619 NPGYEVAPRS-DSEDESGSEYEEEDDEE 645


>sp|P43610|YFK8_YEAST HYPOTHETICAL 88.7 KD HELICASE IN CDC26-SAP155 INTERGENIC
            REGION >pir||S56293 probable membrane protein YFR038w - yeast
            (Saccharomyces cerevisiae) >gnl|PID|d1009918 (D50617) unknown
            [Saccharomyces cerevisiae] >gnl|PID|d1008640 (D44602) unknown
            [Saccharomyces cerevisiae]
            Length = 778

  Minus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 2.8e-05, Sum P(2) = 2.8e-05
 Identities = 24/51 (47%), Positives = 38/51 (74%), Frame = -1

Query:   183 RLDGSTNTIERQKIIKRF--SKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             R+DGS N   R+  +++F  SKD++  +FLLST+A G+G+NL+ A+ V+L D
Sbjct:   648 RIDGSVNNETRKDQLEKFNSSKDKHN-IFLLSTRAAGLGINLVGADTVVLFD 698

 Score = 62 (21.8 bits), Expect = 2.8e-05, Sum P(2) = 2.8e-05
 Identities = 20/68 (29%), Positives = 30/68 (44%), Frame = -1

Query:   492 VNVFIKEEQNYHDIGKETKRHDDN---NNN---NINDGDENKFCFKENIKKPN--DIYNE 337
             +N F+++ Q Y  I  +T  H  N   N N   N N  DE     K   KK +  D + +
Sbjct:   133 LNEFVRQSQVYSSIIADTLLHRSNEVANANTKDNSNSDDEEHSSKKRKTKKKSITDFFKK 192

Query:   336 DMENSERT 313
               +N + T
Sbjct:   193 QKKNEDTT 200

 Score = 50 (17.6 bits), Expect = 0.00047, Sum P(2) = 0.00047
 Identities = 9/17 (52%), Positives = 13/17 (76%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEE 613
             K +I+SQF   LD+IE+
Sbjct:   621 KVLIYSQFVNMLDLIED 637

 Score = 43 (15.1 bits), Expect = 0.0024, Sum P(2) = 0.0024
 Identities = 16/71 (22%), Positives = 30/71 (42%), Frame = -1

Query:   426 DNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEY-NKKKKDEDDEEICL 250
             ++N +   D D      ++++    DI   D E+   T+    +  +K  KD   E+  L
Sbjct:    56 EDNKHGKGDNDTAPIWLQDDVHSDEDI-QLDSEDDSDTEAVQAQVVDKLAKDTKSEQKSL 114

Query:   249 TS--STLSTSSV 220
                 S + T +V
Sbjct:   115 DDELSEMDTKTV 126


>gi|1490417 (U45025) 89B helicase [Drosophila melanogaster]
            Length = 920

  Minus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 3.7e-05, Sum P(2) = 3.7e-05
 Identities = 25/52 (48%), Positives = 35/52 (67%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDGS    +RQ I+  F+ D +I V LL+T  GG+GLNL  A+ VI ++
Sbjct:   740 YLRLDGSVPASQRQDIVNNFNSDPSIDVLLLTTMVGGLGLNLTGADTVIFVE 791

 Score = 48 (16.9 bits), Expect = 3.7e-05, Sum P(2) = 3.7e-05
 Identities = 9/20 (45%), Positives = 14/20 (70%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEALL 604
             +++IF Q    LDI+E+ LL
Sbjct:   712 RALIFCQLKAMLDIVEQDLL 731


>gi|2408043 (Z99164) hypothetical protein [Schizosaccharomyces pombe]
            Length = 570

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 3.7e-05, P = 3.7e-05
 Identities = 25/52 (48%), Positives = 37/52 (71%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDGS+   +R+ ++  +     +FVFLLST+AGG+G+NL AA+ VI  D
Sbjct:   438 YLRLDGSSKISQRRDMVTEWQTRPELFVFLLSTRAGGLGINLTAADTVIFYD 489


>gi|728695 (Z48618) DNA helicase type protein [Saccharomyces cerevisiae]
           Length = 674

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 25/52 (48%), Positives = 38/52 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             ++RLDGS+   +R+ ++  +  +  IFVFLLST+AGG+G+NL AA+ VI  D
Sbjct:   527 HIRLDGSSKLEDRRDLVHDWQTNPEIFVFLLSTRAGGLGINLTAADTVIFYD 578

 Score = 38 (13.4 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 8/12 (66%), Positives = 9/12 (75%), Frame = -1

Query:   573 MDHIQTIKSSQS 538
             +D  Q IKSSQS
Sbjct:    25 LDEAQAIKSSQS 36


>sp|P32657|YEZ4_YEAST HYPOTHETICAL 168.2 KD PROTEIN IN RAD4-PAB1 INTERGENIC
            REGION >pir||S30818 hypothetical protein YER164w - yeast
            (Saccharomyces cerevisiae) >gi|603404 (U18917) Chd1p:
            transcriptional regulator [Saccharomyces cerevisiae]
            Length = 1468

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 6.4e-05, Sum P(2) = 6.4e-05
 Identities = 26/53 (49%), Positives = 38/53 (71%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRF-SKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             + RLDG+  + +R+  I  F S D N FVFLLST+AGG+G+NL+ A+ V++ D
Sbjct:   738 FQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFD 790

 Score = 49 (17.2 bits), Expect = 6.4e-05, Sum P(2) = 6.4e-05
 Identities = 13/59 (22%), Positives = 30/59 (50%), Frame = -1

Query:   432 HDDNNNNNINDGDENKFCFKENIKKPNDIYNED--MENSERTKDTNCEYNKKKKDEDDE 262
             H  N  N+ +D D+     +   K+   I +++   E+ E  +D+  + +++  +EDD+
Sbjct:    28 HQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEEDFEEDDD 86

 Score = 43 (15.1 bits), Expect = 0.00026, Sum P(2) = 0.00026
 Identities = 17/72 (23%), Positives = 27/72 (37%), Frame = -1

Query:   567 HIQT-IKSSQSINKNDTICKEENNINVNVFIKEEQNYHDI-GKETKRHDDNNNNNINDGD 394
             H Q     S   +  D I K+     +     +E  + D  G+E    D++  +   D D
Sbjct:    28 HQQNYFNDSDDEDDEDNI-KQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEEDFEEDDD 86

Query:   393 ENKFCFKENIKKP 355
                   K+N  KP
Sbjct:    87 YYGSPIKQNRSKP 99

 Score = 38 (13.4 bits), Expect = 0.00085, Sum P(2) = 0.00085
 Identities = 8/17 (47%), Positives = 11/17 (64%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEAL 607
             +IFSQ    LDI+ + L
Sbjct:   715 LIFSQMVRMLDILGDYL 731

 Score = 38 (13.4 bits), Expect = 0.00085, Sum P(2) = 0.00085
 Identities = 11/38 (28%), Positives = 17/38 (44%), Frame = -1

Query:   372 ENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
             E ++ P ++Y   +  S R       Y     DEDDE+
Sbjct:     9 EVLQNP-ELYG--LRRSHRAAAHQQNYFNDSDDEDDED 43


>gnl|PID|e348652 (Z68341) F01G4.1 [Caenorhabditis elegans]
            Length = 947

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 7.3e-05, P = 7.3e-05
 Identities = 26/53 (49%), Positives = 40/53 (75%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDGST   ER  ++ +F+  + ++F+F+LST+AGG+GLNL  A+ VI+ D
Sbjct:   366 YLRLDGSTKPDERGDLLTQFNAPNSDLFLFMLSTRAGGLGLNLQTADTVIIFD 418


>pir||I53078 homeotic gene regulator - mouse (fragment) >bbs|142383 (S68108)
            homeotic gene regulator=brg1 [mice, embryo, erythroleukemia cell
            line CB7, Peptide Partial, 1022 aa] [Mus sp.]
            Length = 1022

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 8.0e-05, P = 8.0e-05
 Identities = 26/53 (49%), Positives = 39/53 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDG+T   +R  ++K F++     F+FLLST+AGG+GLNL +A+ VI+ D
Sbjct:   531 YLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFD 583


>gi|790390 (Z49128) M03C11.8 [Caenorhabditis elegans]
           Length = 179

  Minus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 9.3e-05, P = 9.3e-05
 Identities = 20/37 (54%), Positives = 31/37 (83%), Frame = -1

Query:   144 IIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +I  F+  +++FVFLLST+AGG+G+NL +ANH+I+ D
Sbjct:     1 MINEFNLSKDLFVFLLSTRAGGLGINLTSANHIIIHD 37


>pir||A56533 iswi protein - fruit fly (Drosophila melanogaster) >gi|439197
            (L27127) ISWI protein [Drosophila melanogaster]
            Length = 1027

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 9.6e-05, Sum P(2) = 9.6e-05
 Identities = 25/53 (47%), Positives = 37/53 (69%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENI-FVFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDG T   +R + I+ F+ D +  F+F+LST+AGG+G+NL  A+ VI+ D
Sbjct:   474 YCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYD 526

 Score = 50 (17.6 bits), Expect = 9.6e-05, Sum P(2) = 9.6e-05
 Identities = 23/93 (24%), Positives = 36/93 (38%), Frame = -1

Query:   537 INKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKK 358
             ++K DT   E    N N    +       G++    D    N I      +F F   + K
Sbjct:     1 MSKTDTAAVEATEENSNETTSDAATSSS-GEKEAEFD----NKIEADRSRRFDF---LLK 52

Query:   357 PNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
               +I+   M NS ++        KK KD+D E+
Sbjct:    53 QTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEK 85

 Score = 48 (16.9 bits), Expect = 0.00015, Sum P(2) = 0.00015
 Identities = 9/15 (60%), Positives = 12/15 (80%), Frame = -1

Query:   657 IIFSQFTTFLDIIEE 613
             +IFSQ T  LDI+E+
Sbjct:   451 LIFSQMTRMLDILED 465

 Score = 44 (15.5 bits), Expect = 0.00039, Sum P(2) = 0.00039
 Identities = 8/31 (25%), Positives = 18/31 (58%), Frame = -1

Query:   333 MENSERTKDTNCEYNKKKKDEDDEEICLTSS 241
             +++ ++ KD     ++K + E+DEE+    S
Sbjct:    78 IKDKDKEKDVADHRHRKTEQEEDEELLAEDS 108


>bbs|179938 (S83324) Rhp16=nucleotide excision repair protein homolog
            [Schizosaccharomyces pombe, Peptide, 854 aa] [Schizosaccharomyces
            pombe]
            Length = 854

  Minus Strand HSPs:

 Score = 127 (44.7 bits), Expect = 0.00011, P = 0.00011
 Identities = 46/120 (38%), Positives = 58/120 (48%), Frame = -1

Query:   378 FKENIKKPNDIYNE-DMENSERTKDTNCE------YNKKKKDEDDEEICLTSSTLSTSSV 220
             F E   K   I N  DM NS R+  T  E      Y  +KKD   + I  +  T     +
Sbjct:   660 FSEEKFKNASILNRIDM-NSWRSS-TKIEALVEELYLLRKKDRTLKSIVFSQFTSMLDLI 717

Query:   219 GTQ-NDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVI 43
               +   AG    V+LDG      R   I+ FS D NI +FL+S KAGGV LNL  A+ V 
Sbjct:   718 HWRLRKAGFNC-VKLDGGMTPKARAATIEAFSNDINITIFLVSLKAGGVALNLTEASQVF 776

Query:    42 LMD 34
             +MD
Sbjct:   777 MMD 779


>gnl|PID|e16326 (X15081) MURF2 protein (AA 1-348) [Crithidia fasciculata]
            Length = 347

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 0.00011, P = 0.00011
 Identities = 41/158 (25%), Positives = 69/158 (43%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTYFFIIFIFFLFI 291
             Y+  F   F+DF+SF+S   +     N  + VI C       S     ++FI+   F FI
Sbjct:   113 YVSFF--LFFDFVSFSSHLTTFFGLTNNFS-VIFC-------SYLFCLFYFIVCFLFCFI 162

Query:   292 IFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIIL 468
              F I C+F    I + F+ +    +  F     I++  I  +++     FCF +     +
Sbjct:   163 FFVIRCLFV---IIYDFLFFNFDLYISFLMCDLIYVDFICFLLLYFGFIFCFISGFFCFI 219

Query:   469 FFF-YKHIYIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITI 585
             F   Y  + ++ +  L +G IF+ Y L  F   Y   +  I
Sbjct:   220 FVLNYVFLLLFFVLALFFGFIFLSYGLALFLCCYTFWLFMI 260

 Score = 120 (42.2 bits), Expect = 0.00020, P = 0.00020
 Identities = 39/150 (26%), Positives = 66/150 (44%), Frame = +1

Query:   136 FYDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTYFFIIFIFFLFIIFTI-CIF 312
             F+DF+SF+S   +     N  + VI C       S     ++FI+   F FI F I C+F
Sbjct:   119 FFDFVSFSSHLTTFFGLTNNFS-VIFC-------SYLFCLFYFIVCFLFCFIFFVIRCLF 170

Query:   313 SSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFF-YKHI 489
                 I + F+ +    +  F     I++  I  +++     FCF +     +F   Y  +
Sbjct:   171 V---IIYDFLFFNFDLYISFLMCDLIYVDFICFLLLYFGFIFCFISGFFCFIFVLNYVFL 227

Query:   490 YIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITI 585
              ++ +  L +G IF+ Y L  F   Y   +  I
Sbjct:   228 LLFFVLALFFGFIFLSYGLALFLCCYTFWLFMI 260

 Score = 115 (40.5 bits), Expect = 0.00078, P = 0.00078
 Identities = 35/119 (29%), Positives = 54/119 (45%), Frame = +1

Query:   253 TY--FFIIFIFFLFIIFTICIFSSL*IFH-IFIIYIIWFFYIFFKTKFIFIPIINIIIIV 423
             TY  FF+ F F  F       F     F  IF  Y+   FY      F FI  +   + V
Sbjct:   112 TYVSFFLFFDFVSFSSHLTTFFGLTNNFSVIFCSYLFCLFYFIVCFLFCFIFFVIRCLFV 171

Query:   424 IIMTFCFFTYIMIILFFFYKHIYI-YIIFFLTY-GIIFIYAL*TFNSLYMIHIITIIIY 594
             II  F FF + + I F     IY+ +I F L Y G IF +    F  +++++ + ++++
Sbjct:   172 IIYDFLFFNFDLYISFLMCDLIYVDFICFLLLYFGFIFCFISGFFCFIFVLNYVFLLLF 230

 Score = 112 (39.4 bits), Expect = 0.0017, P = 0.0017
 Identities = 28/110 (25%), Positives = 50/110 (45%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             ++FI+   F FI F I C+F    I + F+ +    +  F     I++  I  +++    
Sbjct:   151 FYFIVCFLFCFIFFVIRCLFV---IIYDFLFFNFDLYISFLMCDLIYVDFICFLLLYFGF 207

Query:   433 TFCFFTYIMIILFFF-YKHIYIYIIFFLTYGIIFI-YAL*TFNSLYMIHIITI 585
              FCF +     +F   Y  + ++ +  L +G IF+ Y L  F   Y   +  I
Sbjct:   208 IFCFISGFFCFIFVLNYVFLLLFFVLALFFGFIFLSYGLALFLCCYTFWLFMI 260

 Score = 105 (37.0 bits), Expect = 0.011, P = 0.011
 Identities = 40/123 (32%), Positives = 61/123 (49%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHI-FIIYIIWF-FYIF--FKTKFI-FIPIIN-III 417
             Y + I+I + FI F  C   S  ++ I F  Y+ +F F+ F  F +    F  + N   +
Sbjct:    82 YIYYIYILYNFICFFFCFGLSYILYFIEFFTYVSFFLFFDFVSFSSHLTTFFGLTNNFSV 141

Query:   418 IVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFN-SLYMIHIITIIIY 594
             I     FC F +I+  LF F   + I  +F + Y  +F      FN  LY+  ++  +IY
Sbjct:   142 IFCSYLFCLFYFIVCFLFCFIFFV-IRCLFVIIYDFLF------FNFDLYISFLMCDLIY 194

Query:   595 -KFI*QGLLY 621
               FI   LLY
Sbjct:   195 VDFICFLLLY 204

 Score = 102 (35.9 bits), Expect = 0.025, P = 0.025
 Identities = 24/90 (26%), Positives = 47/90 (52%), Frame = +1

Query:   346 YIIWFF---YIFFKTKFIFIPIINIIIIVIIMTFC--FFTYIMIILFFFYKHIYIYIIFF 510
             +I+W+F   +I +   F F+  I  I + ++  F   FF+++ ++LF  +  ++   + F
Sbjct:    19 FILWWFDLDFILYDFVFDFVVCITFIFVFVLGFFLRIFFSFVFVLLFIVFFGLFSLALTF 78

Query:   511 LTYGIIFIYAL*TFNSLYMIHIITIIIYKFI 603
               Y I +IY L  F   +    ++ I+Y FI
Sbjct:    79 TGYYIYYIYILYNFICFFFCFGLSYILY-FI 108

 Score = 100 (35.2 bits), Expect = 0.044, P = 0.043
 Identities = 32/105 (30%), Positives = 54/105 (51%), Frame = +1

Query:   250 KTYFFIIFIFFL-FIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             ++Y FI++ F L FI++       + I  IF+  + +F  IFF   F+ + I+   +  +
Sbjct:    15 RSYDFILWWFDLDFILYDFVFDFVVCITFIFVFVLGFFLRIFFSFVFVLLFIVFFGLFSL 74

Query:   427 IMTFC----FFTYIM--IILFFF-YKHIYI-YIIFFLTYGIIFIY 537
              +TF     ++ YI+   I FFF +   YI Y I F TY   F++
Sbjct:    75 ALTFTGYYIYYIYILYNFICFFFCFGLSYILYFIEFFTYVSFFLF 119

 Score = 98 (34.5 bits), Expect = 0.075, P = 0.072
 Identities = 26/108 (24%), Positives = 50/108 (46%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINI----IIIV 423
             Y F++ +FF+  +F   IF S  +      Y  W F I+ ++ ++ +P + I    +   
Sbjct:   224 YVFLL-LFFVLALFFGFIFLSYGLALFLCCYTFWLFMIYTRSCYVLLPSVLIFFKFLYFN 282

Query:   424 IIMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIFI-YAL*TFNSLY 564
             +   F F   + I+ FF F+   ++++  F      FI Y +  +N  Y
Sbjct:   283 VFFIFVFLLILFIVCFFGFFLKDFLFLNLFFDMFTSFINYDVLCYNGFY 331

 Score = 96 (33.8 bits), Expect = 0.13, P = 0.12
 Identities = 34/127 (26%), Positives = 56/127 (44%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFI-FIPIINIIIIVIIM 432
             +F  IF  F+F++  I  F    +   F  Y I++ YI +   FI F     +  I+  +
Sbjct:    51 FFLRIFFSFVFVLLFIVFFGLFSLALTFTGYYIYYIYILYN--FICFFFCFGLSYILYFI 108

Query:   433 TFCFFTYIMIILFF----FYKHIYIYI-------IFFLTYGIIFIYAL*TFNSLYMIHII 579
              F  FTY+   LFF    F  H+  +        + F +Y     Y +  F   ++  +I
Sbjct:   109 EF--FTYVSFFLFFDFVSFSSHLTTFFGLTNNFSVIFCSYLFCLFYFIVCFLFCFIFFVI 166

Query:   580 T---IIIYKFI 603
                 +IIY F+
Sbjct:   167 RCLFVIIYDFL 177

 Score = 91 (32.0 bits), Expect = 0.47, P = 0.38
 Identities = 32/100 (32%), Positives = 50/100 (50%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIF-FKTKFI--FIPIINIIIIVIIM 432
             F++ I F+F+ F +  F  +    +F++  I FF +F     F   +I  I I+   I  
Sbjct:    37 FVVCITFIFV-FVLGFFLRIFFSFVFVLLFIVFFGLFSLALTFTGYYIYYIYILYNFICF 95

Query:   433 TFCF-FTYIMIILFFFYKHIYIYIIFFLTYGII-FIYAL*TFNSL 561
              FCF  +YI+  + FF      Y+ FFL +  + F   L TF  L
Sbjct:    96 FFCFGLSYILYFIEFF-----TYVSFFLFFDFVSFSSHLTTFFGL 135

 Score = 90 (31.7 bits), Expect = 0.62, P = 0.46
 Identities = 22/86 (25%), Positives = 39/86 (45%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y F++ +FF+  +F   IF S  +      Y  W F I+ ++ ++ +P +     +I   
Sbjct:   224 YVFLL-LFFVLALFFGFIFLSYGLALFLCCYTFWLFMIYTRSCYVLLPSV-----LIFFK 277

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFL 513
             F +F    I +F     I  +  FFL
Sbjct:   278 FLYFNVFFIFVFLLILFIVCFFGFFL 303

 Score = 89 (31.3 bits), Expect = 0.80, P = 0.55
 Identities = 29/121 (23%), Positives = 55/121 (45%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y F+ F F L+I F +C    +  F  F++    F + F    F FI ++N + +++   
Sbjct:   174 YDFLFFNFDLYISFLMCDLIYV-DFICFLLLYFGFIFCFISGFFCFIFVLNYVFLLLFFV 232

Query:   436 FC-FFTYIMI----ILF-----FFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITI 585
                FF +I +     LF     F+   IY    + L   ++  +    FN ++ I +  +
Sbjct:   233 LALFFGFIFLSYGLALFLCCYTFWLFMIYTRSCYVLLPSVLIFFKFLYFN-VFFIFVFLL 291

Query:   586 IIY 594
             I++
Sbjct:   292 ILF 294

 Score = 80 (28.2 bits), Expect = 8.5, P = 1.0
 Identities = 21/85 (24%), Positives = 38/85 (44%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y F++ +FF+  +F   IF S  +      Y  W F I+ ++ ++ +P +     +I   
Sbjct:   224 YVFLL-LFFVLALFFGFIFLSYGLALFLCCYTFWLFMIYTRSCYVLLPSV-----LIFFK 277

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFF 510
             F +F    I +F     I   + FF
Sbjct:   278 FLYFNVFFIFVFLL---ILFIVCFF 299


>gnl|PID|e267084 (Z80344) F15D4.1 [Caenorhabditis elegans]
            Length = 365

  Minus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 0.00012, P = 0.00012
 Identities = 29/73 (39%), Positives = 42/73 (57%), Frame = -1

Query:   252 LTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVG 73
             L S  L +   G+     H +   LDGS    +R K++ RF++D+ I V +L+T  GGVG
Sbjct:   171 LVSDALKSGEFGSV--VSHLV---LDGSVPAGDRMKMVNRFNEDKTIDVLILTTHVGGVG 225

Query:    72 LNLIAANHVILMD 34
             LNL  A+ VI +D
Sbjct:   226 LNLTGADTVIFLD 238


>gi|1439631 (U64598) coded for by C. elegans cDNA yk88a8.5; coded for by C.
            elegans cDNA yk112b11.5; coded for by C. elegans cDNA yk11a10.5;
            coded for by C. elegans cDNA yk11a10.3; coded for by C. elegans
            cDNA yk112b11.3; coded for by C. elegans cDNA yk...
            Length = 1257

  Minus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 0.00013, P = 0.00013
 Identities = 29/59 (49%), Positives = 41/59 (69%), Frame = -1

Query:   204 AGHQI-YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             AG  I Y+RLDGST   ER  ++ +F+  +   F+F+LST+AGG+GLNL  A+ VI+ D
Sbjct:   641 AGGTIQYLRLDGSTKPDERGALLDKFNAPNSEYFLFMLSTRAGGLGLNLQTADTVIIFD 699


>sp|P41877|SN2L_CAEEL POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L
            >pir||S44645 F37A4.8 protein - Caenorhabditis elegans >gi|458966
            (U00032) similar to entire SN2L_HUMAN, possible global
            transcription activator SNF2L [Caenorhabditis elegans]
            Length = 971

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00014, Sum P(2) = 0.00014
 Identities = 25/56 (44%), Positives = 37/56 (66%), Frame = -1

Query:   198 HQIYVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             H  Y RLDGST   +R   I+ ++  D   F+F+L+T+AGG+G+NL  A+ VI+ D
Sbjct:   437 HYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYD 492

 Score = 48 (16.9 bits), Expect = 0.00014, Sum P(2) = 0.00014
 Identities = 8/15 (53%), Positives = 13/15 (86%), Frame = -1

Query:   657 IIFSQFTTFLDIIEE 613
             +IFSQF+  LD++E+
Sbjct:   417 LIFSQFSRMLDLLED 431


>gi|996018 (X91637) BRG1 protein [Gallus gallus]
           Length = 1630

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 0.00014, P = 0.00014
 Identities = 26/53 (49%), Positives = 39/53 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDG+T   +R  ++K F++     F+FLLST+AGG+GLNL +A+ VI+ D
Sbjct:  1120 YLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFD 1172


>sp|P51532|SN23_HUMAN POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L3
            (SNF2-BETA) (BRG-1 PROTEIN) (MITOTIC GROWTH AND TRANSCRIPTION
            ACTIVATOR) (BRAHMA PROTEIN HOMOLOG 1) >pir||S45252 SNF2beta protein
            - human >gnl|PID|d1005685 (D26156) hSNF2b [Homo sapiens] >gi|902046
            (U29175) transcriptional activator [Homo sapiens]
            Length = 1647

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 0.00014, P = 0.00014
 Identities = 26/53 (49%), Positives = 39/53 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDG+T   +R  ++K F++     F+FLLST+AGG+GLNL +A+ VI+ D
Sbjct:  1123 YLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFD 1175


>pir||S67208 hypothetical protein YOR304w - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e252429 (Z75212) ORF YOR304w [Saccharomyces cerevisiae]
            Length = 1120

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 0.00015, Sum P(2) = 0.00015
 Identities = 27/53 (50%), Positives = 39/53 (73%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R+DGST+  ER + I  ++K +   FVFLL+T+AGG+G+NL+ A+ VIL D
Sbjct:   533 YCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFD 585

 Score = 38 (13.4 bits), Expect = 0.00015, Sum P(2) = 0.00015
 Identities = 8/39 (20%), Positives = 19/39 (48%), Frame = -1

Query:   372 ENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             + + K  D     +  S  T  ++  +++K + E+D E+
Sbjct:   116 QKLLKQLDSDANKLSKSHSTVSSSSRHHRKTEKEEDAEL 154


>gi|436923 (U01849) ORF1 [Trypanosoma brucei]
           Length = 146

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.00017, P = 0.00017
 Identities = 23/86 (26%), Positives = 43/86 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             YFF +F F  F++  + +F     F  F++  + FF +FF    +F  +    + V    
Sbjct:    61 YFFFLFCFVFFVL--LFLFGLFGFFLYFLLCFVLFFDLFF---MLFFVLGGFFVFVFFFC 115

Query:   436 FCFFTYIMII-------LFFFYKHIYIYIIF 507
              C F +++++       L F Y+ IY+  +F
Sbjct:   116 LCLFLFVVVVILLVWLLLLFVYRFIYMRFLF 146

 Score = 101 (35.6 bits), Expect = 0.0014, P = 0.0014
 Identities = 23/122 (18%), Positives = 55/122 (45%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII-----II 420
             Y F     F F++          ++ +F ++   F Y FF   F+F  ++ +       +
Sbjct:    25 YLFCYSCLFFFVVLGCDFLLVFWLYSLFFLWRYNFVYFFFLFCFVFFVLLFLFGLFGFFL 84

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
               ++ F  F  +  +LFF     ++++ FF     +F+  +     + ++ ++ + +Y+F
Sbjct:    85 YFLLCFVLFFDLFFMLFFVLGGFFVFVFFFCLCLFLFVVVV-----ILLVWLLLLFVYRF 139

Query:   601 I*QGLLY 621
             I    L+
Sbjct:   140 IYMRFLF 146

 Score = 94 (33.1 bits), Expect = 0.018, P = 0.017
 Identities = 24/124 (19%), Positives = 58/124 (46%), Frame = +1

Query:   259 FFIIFIF-FLFIIFTICI-------FSSL*IFHIF---IIYIIWFFYIFFKTKFIFIPII 405
             ++I+ +F FLF++F +C+       +S L  F +     + + W + +FF  ++ F+   
Sbjct:     5 WYILLLFCFLFLLF-VCVGMFYLFCYSCLFFFVVLGCDFLLVFWLYSLFFLWRYNFVYFF 63

Query:   406 NI---IIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHI 576
              +   +  V++  F  F + +  L  F     ++ + F   G  F++       L++  +
Sbjct:    64 FLFCFVFFVLLFLFGLFGFFLYFLLCFVLFFDLFFMLFFVLGGFFVFVFFFCLCLFLFVV 123

Query:   577 ITIII 591
             + I++
Sbjct:   124 VVILL 128

 Score = 89 (31.3 bits), Expect = 0.089, P = 0.085
 Identities = 20/116 (17%), Positives = 54/116 (46%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             +FF++      ++F +  +S   +F ++    ++FF++F    F+ + +  +    +   
Sbjct:    33 FFFVVLGCDFLLVFWL--YS---LFFLWRYNFVYFFFLFCFVFFVLLFLFGLFGFFLYFL 87

Query:   436 FCFFTY--IMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI 603
              CF  +  +  +LFF     ++++ FF     +F+  +     L ++ +   I  +F+
Sbjct:    88 LCFVLFFDLFFMLFFVLGGFFVFVFFFCLCLFLFVVVVILLVWLLLLFVYRFIYMRFL 145


>gi|2388586 (AC000098) Similar to Saccharomyces RAD16 (gb|X78993). [Arabidopsis
            thaliana]
            Length = 822

  Minus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.00018, Sum P(2) = 0.00018
 Identities = 23/47 (48%), Positives = 29/47 (61%), Frame = -1

Query:   186 VRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHV 46
             V+L GS     R   I +F +D +  VFL+S KAGGV LNL  A+HV
Sbjct:   774 VQLVGSMTMAARDTAINKFKEDPDCRVFLMSLKAGGVALNLTVASHV 820

 Score = 64 (22.5 bits), Expect = 0.00018, Sum P(2) = 0.00018
 Identities = 12/19 (63%), Positives = 16/19 (84%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K+I+FSQFT+FLD+I   L
Sbjct:   748 KAIVFSQFTSFLDLINYTL 766

 Score = 39 (13.7 bits), Expect = 0.062, Sum P(2) = 0.060
 Identities = 9/39 (23%), Positives = 21/39 (53%), Frame = -1

Query:   375 KENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
             K+  KK +D  ++  + ++  +D   + +KKK  +  E+
Sbjct:   298 KQKRKKTSDSSSQQGKEADAGEDKKLKKSKKKTKQTVEK 336


>sp|P15605|YM04_PARTE HYPOTHETICAL 18.8 KD PROTEIN (ORF4) >pir||S07729
            hypothetical protein 4 - Paramecium tetraurelia mitochondrion
            (SGC6) >gi|13261 (X15917) ORF4 protein (AA 1-156) [Paramecium
            aurelia]
            Length = 156

  Plus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.00023, P = 0.00023
 Identities = 30/110 (27%), Positives = 51/110 (46%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             FF  FIFFL  +F + +      F I +   +  F  FF + F F   ++    +  + F
Sbjct:    42 FFTFFIFFLAAVFKLGL-PPFFFFKIEVYKGLPLFVTFFYSVFFFFNYLSGFFFLFFVFF 100

Query:   439 C-FFTYIMIILFFFYKHIYIYIIFFLT-YGII--FIYAL*TFNSLYMIHII 579
               FF Y   +LFFF     ++  F+LT Y  +  F       NS ++++++
Sbjct:   101 TSFFVYFSYLLFFFVPVFVLFFFFYLTTYDNLNCFFSISSVINSTFLVYLL 151

 Score = 99 (34.8 bits), Expect = 0.0056, P = 0.0056
 Identities = 32/111 (28%), Positives = 53/111 (47%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             FF  FIFFL  +F + +      F I +   +  F  FF + F F   ++    +  + F
Sbjct:    42 FFTFFIFFLAAVFKLGL-PPFFFFKIEVYKGLPLFVTFFYSVFFFFNYLSGFFFLFFVFF 100

Query:   439 C-FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
               FF Y   +LFFF   + ++++FF      F Y L T+++L     I+ +I
Sbjct:   101 TSFFVYFSYLLFFF---VPVFVLFF------FFY-LTTYDNLNCFFSISSVI 142


>gi|897642 (M14820) ORF2 bases 1807-2850; first start codon at 2032; putative
           [Trypanosoma brucei]
           Length = 272

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00027, P = 0.00027
 Identities = 44/154 (28%), Positives = 77/154 (50%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINL--MTCVILCTNR*GRKSR*SKTYFFIIFIFFL 285
             +IFI    F+DF+SF++    I +Y  +  M  V+ C             ++F+I+  F 
Sbjct:    36 FIFITFHIFFDFISFSNY---IYNYFGILYMFNVMFCAYL-------FCLFYFVIYFLFC 85

Query:   286 FIIFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI--IMTFC--FFT 450
             FI F I C+F    +   F+ +    F        +++  I+++++    I  F   FF+
Sbjct:    86 FIFFVIRCLFI---VIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFS 142

Query:   451 YIMII-LFFFYKHIYIYIIF---FLTYGIIFIYAL*TFNSLYMIH 573
             +++I+ L F    + I + F   FL YGI  I     +  LYMI+
Sbjct:   143 FVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVY-WLYMIY 186

 Score = 112 (39.4 bits), Expect = 0.0011, P = 0.0011
 Identities = 32/123 (26%), Positives = 65/123 (52%), Frame = +1

Query:   256 YFFIIF-IFFLFIIFTICIFSSL*IFHIF-IIYIIWFFYIF-FKTKFIFIPIINII--II 420
             + FI F IFF FI F+  I++   I ++F +++  + F +F F   F+F  I  +I  + 
Sbjct:    36 FIFITFHIFFDFISFSNYIYNYFGILYMFNVMFCAYLFCLFYFVIYFLFCFIFFVIRCLF 95

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYI-YIIFFLTY-GIIFIYAL*TFNSLYMIHIITIIIY 594
             ++IM F FF + + +       +Y+ +I   L Y   IF +    F+ + ++ ++ ++++
Sbjct:    96 IVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLF 155

Query:   595 KFI 603
               I
Sbjct:   156 LVI 158

 Score = 109 (38.4 bits), Expect = 0.0024, P = 0.0024
 Identities = 39/164 (23%), Positives = 81/164 (49%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINL--MTCVILCTNR*GRKSR*SKTYFFIIFIFFL 285
             +IFI    F+DF+SF++    I +Y  +  M  V+ C             Y F +F F +
Sbjct:    36 FIFITFHIFFDFISFSNY---IYNYFGILYMFNVMFCA------------YLFCLFYFVI 80

Query:   286 FIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII-MTFCFFTYIMI 462
             + +F    F    I  +FI+ + + F+ F    F+ I + +I+ +  I +   +F +I  
Sbjct:    81 YFLFCFIFFV---IRCLFIVIMDFLFFNF--DIFVSILLCDIVYLDFISLLLLYFNFIFN 135

Query:   463 ILFFFYKHIYIY-IIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI 603
              ++ F+  + I  ++F L + +I ++    F   ++++ I II+  ++
Sbjct:   136 FIYGFFSFVIILGLLFLLLFLVINLF----FGFTFLVYGIQIILLYYV 179

 Score = 108 (38.0 bits), Expect = 0.0032, P = 0.0032
 Identities = 29/114 (25%), Positives = 54/114 (47%), Frame = +1

Query:   259 FFIIFIFF-LFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             F ++F+   LF  FT  ++    I  I + Y+ W + I+ ++ +I +P I +I    I  
Sbjct:   151 FLLLFLVINLFFGFTFLVYG---IQIILLYYVYWLYMIYSRSCYILMPAI-LIFFKFIYF 206

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
               FF ++ I++ F       ++  FL   + F      F SLY   I++  I+ +
Sbjct:   207 DVFFVFVFILILFIISFFSFFLKDFLFLSLYFDI----FGSLYNYDILSYSIFYY 257

 Score = 106 (37.3 bits), Expect = 0.0055, P = 0.0055
 Identities = 34/112 (30%), Positives = 57/112 (50%), Frame = +1

Query:   256 YFFIIF-IFFLFIIFTICIFSSL*IFHIF-IIYIIWFFYIF-FKTKFIFIPIINII--II 420
             + FI F IFF FI F+  I++   I ++F +++  + F +F F   F+F  I  +I  + 
Sbjct:    36 FIFITFHIFFDFISFSNYIYNYFGILYMFNVMFCAYLFCLFYFVIYFLFCFIFFVIRCLF 95

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
             ++IM F FF + + +       +Y+  I  L     FI     FN +Y      II+
Sbjct:    96 IVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFI-----FNFIYGFFSFVIIL 147

 Score = 106 (37.3 bits), Expect = 0.0055, P = 0.0055
 Identities = 30/123 (24%), Positives = 65/123 (52%), Frame = +1

Query:   256 YFFIIFIF-FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIIN-------I 411
             YF I+++F  +F  +  C+F        F+IY + F +IFF  + +FI I++       I
Sbjct:    57 YFGILYMFNVMFCAYLFCLF-------YFVIYFL-FCFIFFVIRCLFIVIMDFLFFNFDI 108

Query:   412 IIIVIIMTFCFFTYIMIILFFF---YKHIYIYIIFFLTYGIIFIYAL*TFNSLY----MI 570
              + +++    +  +I ++L +F   +  IY +  F +  G++F+      N  +    ++
Sbjct:   109 FVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLV 168

Query:   571 HIITIIIYKFI 603
             + I II+  ++
Sbjct:   169 YGIQIILLYYV 179

 Score = 98 (34.5 bits), Expect = 0.048, P = 0.047
 Identities = 38/127 (29%), Positives = 67/127 (52%), Frame = +1

Query:   271 FIFFLFIIFT-ICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII-----IIVI-- 426
             +I++++I++  IC F +  I +  I YI +F +I F   F FI   N I     I+ +  
Sbjct:     7 YIYYIYILYNFICFFFAFGI-NFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMFN 65

Query:   427 IM----TFCFFTYIMIILF---FFY-KHIYIYIIFFLTYGI-IFIYAL*TFNSLYMIHII 579
             +M     FC F +++  LF   FF  + ++I I+ FL +   IF+  L   + +Y+  I 
Sbjct:    66 VMFCAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSIL-LCDIVYLDFIS 124

Query:   580 TIIIY-KFI 603
              +++Y  FI
Sbjct:   125 LLLLYFNFI 133

 Score = 92 (32.4 bits), Expect = 0.24, P = 0.21
 Identities = 29/125 (23%), Positives = 63/125 (50%), Frame = +1

Query:   256 YFFIIFIFFLFII-FTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             +  ++ ++F FI  F    FS + I  +  + +     +FF   F+   I  I++  +  
Sbjct:   122 FISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYW 181

Query:   433 TFCFFT---YIMI-ILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
              +  ++   YI++  +  F+K IY + +FF+   I+ ++ + +F S ++   + + +Y F
Sbjct:   182 LYMIYSRSCYILMPAILIFFKFIY-FDVFFVFVFILILFII-SFFSFFLKDFLFLSLY-F 238

Query:   601 I*QGLLYN 624
                G LYN
Sbjct:   239 DIFGSLYN 246

 Score = 88 (31.0 bits), Expect = 0.70, P = 0.50
 Identities = 27/102 (26%), Positives = 55/102 (53%), Frame = +1

Query:   259 FFIIFIFF--LFIIFTICIFSSL*IFHIFIIY-----------IIWFFYIFFKTKFIFIP 399
             F +I +FF   F+++ I I     ++ +++IY           +I+F +I+F   F+F+ 
Sbjct:   155 FLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFKFIYFDVFFVFVF 214

Query:   400 IINIIIIVIIMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIF 531
             I+ I+ I+   +F    ++ + L+F  +  +Y Y I  L+Y I +
Sbjct:   215 IL-ILFIISFFSFFLKDFLFLSLYFDIFGSLYNYDI--LSYSIFY 256

 Score = 85 (29.9 bits), Expect = 1.5, P = 0.79
 Identities = 22/93 (23%), Positives = 51/93 (54%), Frame = +1

Query:   256 YFFIIF---IFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             + F+++   I  L+ ++ + +  S   + +    +I+F +I+F   F+F+ I+ I+ I+ 
Sbjct:   164 FTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFKFIYFDVFFVFVFIL-ILFIIS 222

Query:   427 IMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIF 531
               +F    ++ + L+F  +  +Y Y I  L+Y I +
Sbjct:   223 FFSFFLKDFLFLSLYFDIFGSLYNYDI--LSYSIFY 256

 Score = 79 (27.8 bits), Expect = 7.6, P = 1.0
 Identities = 26/101 (25%), Positives = 50/101 (49%), Frame = +1

Query:   307 IFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKH 486
             +F+   I++I+I+Y    F+  F   F+   I   I I   + F F ++   I + ++  
Sbjct:     2 LFTGYYIYYIYILYNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYI-YNYFGI 60

Query:   487 IYIYIIFFLTYGI-IF---IYAL*TFNSLYMIHIITIIIYKFI 603
             +Y++ + F  Y   +F   IY L  F   ++I  + I+I  F+
Sbjct:    61 LYMFNVMFCAYLFCLFYFVIYFLFCF-IFFVIRCLFIVIMDFL 102


>sp|P32849|RAD5_YEAST DNA REPAIR PROTEIN RAD5 >pir||S64859 DNA repair protein
            RAD5 - yeast (Saccharomyces cerevisiae) >gi|172347 (M96644) RAD5
            protein [Saccharomyces cerevisiae] >gnl|PID|e245505 (Z73204) ORF
            YLR032w [Saccharomyces cerevisiae]
            Length = 1169

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.00028, Sum P(2) = 0.00028
 Identities = 25/55 (45%), Positives = 34/55 (61%), Frame = -1

Query:   195 QIYVRLDGSTNTIERQKIIKRFS-KD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +IY + DG  +  ER  ++  F+ KD     + LLS KAGGVGLNL  A+H  +MD
Sbjct:  1042 KIY-KFDGRLSLKERTSVLADFAVKDYSRQKILLLSLKAGGVGLNLTCASHAYMMD 1096

 Score = 70 (24.6 bits), Expect = 0.00028, Sum P(2) = 0.00028
 Identities = 13/24 (54%), Positives = 19/24 (79%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLYEFIYD 586
             +IFSQF+T+LDI+E+ L + F  D
Sbjct:  1016 VIFSQFSTYLDILEKELTHTFSKD 1039

 Score = 40 (14.1 bits), Expect = 0.31, Sum P(2) = 0.27
 Identities = 11/37 (29%), Positives = 17/37 (45%), Frame = -1

Query:   297 EYNKKKKDE-DDEEICLTSSTLSTSSVGTQNDAGHQI 190
             E+ K  K    DE++ ++S   S +      D GH I
Sbjct:   650 EWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNI 686


>sp|Q10332|YD92_SCHPO HYPOTHETICAL 93.9 KD HELICASE C19G10.02 IN CHROMOSOME I
            >gi|1216242 (Z69909) unknown [Schizosaccharomyces pombe]
            Length = 830

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.00030, Sum P(2) = 0.00030
 Identities = 22/52 (42%), Positives = 27/52 (51%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +VR DG  N   R+K +     D    V L S K G +GLNL  A+ VIL D
Sbjct:   697 FVRYDGRMNNRAREKSLDLLRSDSGTQVLLCSLKCGALGLNLTCASRVILCD 748

 Score = 71 (25.0 bits), Expect = 0.00030, Sum P(2) = 0.00030
 Identities = 14/16 (87%), Positives = 16/16 (100%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIE 616
             K+IIFSQFTTFLDII+
Sbjct:   672 KTIIFSQFTTFLDIID 687


>pir||A05235 hypothetical protein A-288 - Trypanosoma brucei mitochondrion
            (SGC6)
            Length = 288

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00031, P = 0.00031
 Identities = 44/154 (28%), Positives = 77/154 (50%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINL--MTCVILCTNR*GRKSR*SKTYFFIIFIFFL 285
             +IFI    F+DF+SF++    I +Y  +  M  V+ C             ++F+I+  F 
Sbjct:    52 FIFITFHIFFDFISFSNY---IYNYFGILYMFNVMFCAYL-------FCLFYFVIYFLFC 101

Query:   286 FIIFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI--IMTFC--FFT 450
             FI F I C+F    +   F+ +    F        +++  I+++++    I  F   FF+
Sbjct:   102 FIFFVIRCLFI---VIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFS 158

Query:   451 YIMII-LFFFYKHIYIYIIF---FLTYGIIFIYAL*TFNSLYMIH 573
             +++I+ L F    + I + F   FL YGI  I     +  LYMI+
Sbjct:   159 FVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVY-WLYMIY 202

 Score = 112 (39.4 bits), Expect = 0.0012, P = 0.0012
 Identities = 32/123 (26%), Positives = 65/123 (52%), Frame = +1

Query:   256 YFFIIF-IFFLFIIFTICIFSSL*IFHIF-IIYIIWFFYIF-FKTKFIFIPIINII--II 420
             + FI F IFF FI F+  I++   I ++F +++  + F +F F   F+F  I  +I  + 
Sbjct:    52 FIFITFHIFFDFISFSNYIYNYFGILYMFNVMFCAYLFCLFYFVIYFLFCFIFFVIRCLF 111

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYI-YIIFFLTY-GIIFIYAL*TFNSLYMIHIITIIIY 594
             ++IM F FF + + +       +Y+ +I   L Y   IF +    F+ + ++ ++ ++++
Sbjct:   112 IVIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLF 171

Query:   595 KFI 603
               I
Sbjct:   172 LVI 174

 Score = 109 (38.4 bits), Expect = 0.0028, P = 0.0028
 Identities = 39/164 (23%), Positives = 81/164 (49%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINL--MTCVILCTNR*GRKSR*SKTYFFIIFIFFL 285
             +IFI    F+DF+SF++    I +Y  +  M  V+ C             Y F +F F +
Sbjct:    52 FIFITFHIFFDFISFSNY---IYNYFGILYMFNVMFCA------------YLFCLFYFVI 96

Query:   286 FIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII-MTFCFFTYIMI 462
             + +F    F    I  +FI+ + + F+ F    F+ I + +I+ +  I +   +F +I  
Sbjct:    97 YFLFCFIFFV---IRCLFIVIMDFLFFNF--DIFVSILLCDIVYLDFISLLLLYFNFIFN 151

Query:   463 ILFFFYKHIYIY-IIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI 603
              ++ F+  + I  ++F L + +I ++    F   ++++ I II+  ++
Sbjct:   152 FIYGFFSFVIILGLLFLLLFLVINLF----FGFTFLVYGIQIILLYYV 195

 Score = 108 (38.0 bits), Expect = 0.0036, P = 0.0036
 Identities = 29/114 (25%), Positives = 54/114 (47%), Frame = +1

Query:   259 FFIIFIFF-LFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             F ++F+   LF  FT  ++    I  I + Y+ W + I+ ++ +I +P I +I    I  
Sbjct:   167 FLLLFLVINLFFGFTFLVYG---IQIILLYYVYWLYMIYSRSCYILMPAI-LIFFKFIYF 222

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
               FF ++ I++ F       ++  FL   + F      F SLY   I++  I+ +
Sbjct:   223 DVFFVFVFILILFIISFFSFFLKDFLFLSLYFDI----FGSLYNYDILSYSIFYY 273

 Score = 106 (37.3 bits), Expect = 0.0062, P = 0.0062
 Identities = 30/123 (24%), Positives = 65/123 (52%), Frame = +1

Query:   256 YFFIIFIF-FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIIN-------I 411
             YF I+++F  +F  +  C+F        F+IY + F +IFF  + +FI I++       I
Sbjct:    73 YFGILYMFNVMFCAYLFCLF-------YFVIYFL-FCFIFFVIRCLFIVIMDFLFFNFDI 124

Query:   412 IIIVIIMTFCFFTYIMIILFFF---YKHIYIYIIFFLTYGIIFIYAL*TFNSLY----MI 570
              + +++    +  +I ++L +F   +  IY +  F +  G++F+      N  +    ++
Sbjct:   125 FVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLV 184

Query:   571 HIITIIIYKFI 603
             + I II+  ++
Sbjct:   185 YGIQIILLYYV 195

 Score = 99 (34.8 bits), Expect = 0.041, P = 0.040
 Identities = 41/136 (30%), Positives = 70/136 (51%), Frame = +1

Query:   247 SKTYFFI-IFIFFLFIIFT-ICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII-- 414
             S T  F   +I++++I++  IC F +  I +  I YI +F +I F   F FI   N I  
Sbjct:    14 SLTMLFTGYYIYYIYILYNFICFFFAFGI-NFLIYYIEFFIFITFHIFFDFISFSNYIYN 72

Query:   415 ---IIVI--IM----TFCFFTYIMIILF---FFY-KHIYIYIIFFLTYGI-IFIYAL*TF 552
                I+ +  +M     FC F +++  LF   FF  + ++I I+ FL +   IF+  L   
Sbjct:    73 YFGILYMFNVMFCAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSIL-LC 131

Query:   553 NSLYMIHIITIIIY-KFI 603
             + +Y+  I  +++Y  FI
Sbjct:   132 DIVYLDFISLLLLYFNFI 149

 Score = 97 (34.1 bits), Expect = 0.070, P = 0.068
 Identities = 31/117 (26%), Positives = 57/117 (48%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F ++FI F  I     +F+   I++I+I+Y    F+  F   F+   I   I I   + F
Sbjct:     2 FVLLFITFFGICSLTMLFTGYYIYYIYILYNFICFFFAFGINFLIYYIEFFIFITFHIFF 61

Query:   439 CFFTYIMIILFFFYKHIYIYIIFFLTYGI-IF---IYAL*TFNSLYMIHIITIIIYKFI 603
              F ++   I + ++  +Y++ + F  Y   +F   IY L  F   ++I  + I+I  F+
Sbjct:    62 DFISFSNYI-YNYFGILYMFNVMFCAYLFCLFYFVIYFLFCF-IFFVIRCLFIVIMDFL 118

 Score = 92 (32.4 bits), Expect = 0.27, P = 0.23
 Identities = 29/125 (23%), Positives = 63/125 (50%), Frame = +1

Query:   256 YFFIIFIFFLFII-FTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             +  ++ ++F FI  F    FS + I  +  + +     +FF   F+   I  I++  +  
Sbjct:   138 FISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYW 197

Query:   433 TFCFFT---YIMI-ILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
              +  ++   YI++  +  F+K IY + +FF+   I+ ++ + +F S ++   + + +Y F
Sbjct:   198 LYMIYSRSCYILMPAILIFFKFIY-FDVFFVFVFILILFII-SFFSFFLKDFLFLSLY-F 254

Query:   601 I*QGLLYN 624
                G LYN
Sbjct:   255 DIFGSLYN 262

 Score = 88 (31.0 bits), Expect = 0.77, P = 0.54
 Identities = 27/102 (26%), Positives = 55/102 (53%), Frame = +1

Query:   259 FFIIFIFF--LFIIFTICIFSSL*IFHIFIIY-----------IIWFFYIFFKTKFIFIP 399
             F +I +FF   F+++ I I     ++ +++IY           +I+F +I+F   F+F+ 
Sbjct:   171 FLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFKFIYFDVFFVFVF 230

Query:   400 IINIIIIVIIMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIF 531
             I+ I+ I+   +F    ++ + L+F  +  +Y Y I  L+Y I +
Sbjct:   231 IL-ILFIISFFSFFLKDFLFLSLYFDIFGSLYNYDI--LSYSIFY 272

 Score = 85 (29.9 bits), Expect = 1.7, P = 0.82
 Identities = 22/93 (23%), Positives = 51/93 (54%), Frame = +1

Query:   256 YFFIIF---IFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             + F+++   I  L+ ++ + +  S   + +    +I+F +I+F   F+F+ I+ I+ I+ 
Sbjct:   180 FTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFKFIYFDVFFVFVFIL-ILFIIS 238

Query:   427 IMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIF 531
               +F    ++ + L+F  +  +Y Y I  L+Y I +
Sbjct:   239 FFSFFLKDFLFLSLYFDIFGSLYNYDI--LSYSIFY 272


>gnl|PID|d1019392 (D90916) helicase of the snf2/rad54 family [Synechocystis
            sp.]
            Length = 1039

  Minus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 0.00031, P = 0.00031
 Identities = 26/57 (45%), Positives = 38/57 (66%), Frame = -1

Query:   198 HQIYVRLDGSTNTIERQKIIKRFSKDENI-FVFLLSTKAGGVGLNLIAANHVILMDQ 31
             +Q  + L G T   +RQ +++RF +D N  ++F+LS KAGG GLNL  ANHV  +D+
Sbjct:   896 NQEVLYLHGGTPAEQRQALVERFQQDPNSPYLFILSLKAGGTGLNLTRANHVFHVDR 952


>gi|454844 (M74170) ORF 3 [Schistosoma mansoni]
           Length = 393

  Plus Strand HSPs:

 Score = 119 (41.9 bits), Expect = 0.00032, P = 0.00032
 Identities = 34/110 (30%), Positives = 65/110 (59%), Frame = +1

Query:   265 IIFIFF-LFIIFTICIF---SSL*IFHIFIIYIIWFFYIFFK-TKFIFIPIINIIIIVII 429
             ++FI   L ++FTI +F   +++ +F IF+I I+    IFF  T F+ I  + +++I ++
Sbjct:    24 VMFIMIMLIVVFTITVFFISTTIIVFVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVL 83

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             +   FF  I II       I++  +F +T   IFI A+    ++++I I+ + I+
Sbjct:    84 VVSVFFVTIFIIAILLVT-IFVVSVFVVT---IFIIAV-LLVTIFVISILLVTIF 133

 Score = 109 (38.4 bits), Expect = 0.0048, P = 0.0048
 Identities = 32/125 (25%), Positives = 67/125 (53%), Frame = +1

Query:   265 IIFIFF-LFIIFTICIF---SSL*IFHIFIIYIIWFFYIFFK-TKFIFIPIINIIIIVII 429
             ++FI   L ++FTI +F   +++ +F IF+I I+    IFF  T F+ I  + +++I ++
Sbjct:    24 VMFIMIMLIVVFTITVFFISTTIIVFVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVL 83

Query:   430 MTFCFFTYIMIILFF----FYKHIYIYIIFFLTYGIIFIYAL*TFN-SLYMIHI--ITII 588
             +   FF  I II       F   +++  IF +   ++ I+ +     +++++ I  +T+ 
Sbjct:    84 VVSVFFVTIFIIAILLVTIFVVSVFVVTIFIIAVLLVTIFVISILLVTIFVVSILVVTLF 143

Query:   589 IYKFI 603
             I  F+
Sbjct:   144 ITIFV 148

 Score = 98 (34.5 bits), Expect = 0.091, P = 0.087
 Identities = 28/113 (24%), Positives = 58/113 (51%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWF-FYIFFKTKFIFIPIINIIIIVIIMT 435
             F ++ +  L ++  + +   + +  I I+ I+ F   +FF +  I + +I +I+I+II+ 
Sbjct:     2 FMMMMMVMLMMMVAVVVMVVMMVMFIMIMLIVVFTITVFFISTTIIVFVIFLIVILIILA 61

Query:   436 FCFFTYIMIILF---FFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
               F   I +I+F        + +  +FF+T  II I  +  F  +  + ++TI I
Sbjct:    62 IFFGVTIFLIIFSMTMLVIPVLVVSVFFVTIFIIAILLVTIF--VVSVFVVTIFI 114

 Score = 93 (32.7 bits), Expect = 0.34, P = 0.28
 Identities = 30/112 (26%), Positives = 57/112 (50%), Frame = +1

Query:   265 IIFIFFLFIIFTI-CIFSSL*IFHI-FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             I+F+ FL +I  I  IF  + IF I F + ++    +     F+ I II I+++ I +  
Sbjct:    47 IVFVIFLIVILIILAIFFGVTIFLIIFSMTMLVIPVLVVSVFFVTIFIIAILLVTIFVVS 106

Query:   439 CFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYM--IHIITIII 591
              F   I II       I++  I  +T  ++ I  +  F ++++  I ++TI++
Sbjct:   107 VFVVTIFIIAVLLVT-IFVISILLVTIFVVSILVVTLFITIFVRAILVVTILV 158

 Score = 92 (32.4 bits), Expect = 0.44, P = 0.36
 Identities = 32/115 (27%), Positives = 58/115 (50%), Frame = +1

Query:   268 IFI-FFLFIIFTICIFSSL*IFHIFI--IYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             +F+  F+  I  I +F ++ I  I +  I +I  F I   T  IF+  I II I +I  F
Sbjct:   217 LFVAIFVRTILVITLFVTIFIISILLVTILVISVFIIAILTISIFVISILIITIFVISVF 276

Query:   439 CFFTYIMIILFFFYKHIYIYII-FFLTYGI-IFIYAL*TFNSLYMIHIITIIIYKFI 603
                 +++ I       I I+I+ FF+ + + I +  L    ++++I I+ I I+  +
Sbjct:   277 VITIFVVTIFAITVLVISIFIVAFFIVFAVSILLVPL--LMTIFIIAILVITIFVIV 331

 Score = 90 (31.7 bits), Expect = 0.75, P = 0.53
 Identities = 26/91 (28%), Positives = 47/91 (51%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFS-SL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F+I +F +  IF + IF+ ++ +  IFI+     F+I F    + +P++  I I+ I+  
Sbjct:   271 FVISVFVI-TIFVVTIFAITVLVISIFIVA----FFIVFAVSILLVPLLMTIFIIAILVI 325

Query:   439 CFFTYIMII--LFFFYKHIYIYIIFFLTYGIIFI 534
               F  +  +  L      ++  I  FLT  +IFI
Sbjct:   326 TIFVIVFTVSVLAGIIACVFSTITIFLTI-VIFI 358

 Score = 90 (31.7 bits), Expect = 0.75, P = 0.53
 Identities = 22/111 (19%), Positives = 52/111 (46%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINI-IIIVIIMTFC 441
             +I +F    + TI + +      +  I +I  F   F    + + I+ I + I+ I+T  
Sbjct:   200 VITLFVTIFVRTILVITLFVAIFVRTILVITLFVTIFIISILLVTILVISVFIIAILTIS 259

Query:   442 FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFN-SLYMIHIITIII 591
              F   ++I+  F   +++  IF +T   I +  +  F  + +++  ++I++
Sbjct:   260 IFVISILIITIFVISVFVITIFVVTIFAITVLVISIFIVAFFIVFAVSILL 310

 Score = 89 (31.3 bits), Expect = 0.97, P = 0.62
 Identities = 27/93 (29%), Positives = 44/93 (47%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWF---FYIFFKTKFIFIPIINIIIIVIIMT 435
             +I   F+  +F I IF    IF I ++ I  F   F+I F    + +P++  I I+ I+ 
Sbjct:   266 LIITIFVISVFVITIFVVT-IFAITVLVISIFIVAFFIVFAVSILLVPLLMTIFIIAILV 324

Query:   436 FCFFTYIMII--LFFFYKHIYIYIIFFLTYGIIFI 534
                F  +  +  L      ++  I  FLT  +IFI
Sbjct:   325 ITIFVIVFTVSVLAGIIACVFSTITIFLTI-VIFI 358

 Score = 89 (31.3 bits), Expect = 0.97, P = 0.62
 Identities = 31/120 (25%), Positives = 57/120 (47%), Frame = +1

Query:   253 TYFFIIFIFFLFII--FTICIFSSL*IFHIFIIYI-IWFFYIFFKTKFIF-IPIINIIII 420
             T F IIF   + +I    + +F    IF I I+ + I+   +F  T FI  + ++ I +I
Sbjct:    67 TIFLIIFSMTMLVIPVLVVSVFFVT-IFIIAILLVTIFVVSVFVVTIFIIAVLLVTIFVI 125

Query:   421 VIIMTFCFFTYIMIILFF---FYKHIYIYIIFFLTYGI-IFIYAL*TFNSLYMIHIITII 588
              I++   F   I+++  F   F + I +  I  +   + IF+ A+        I + TI+
Sbjct:   126 SILLVTIFVVSILVVTLFITIFVRAILVVTILVINLFVTIFVRAILVITLFVAIFVRTIL 185

Query:   589 I 591
             +
Sbjct:   186 V 186

 Score = 87 (30.6 bits), Expect = 1.6, P = 0.81
 Identities = 34/111 (30%), Positives = 58/111 (52%), Frame = +1

Query:   268 IFI-FFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFI---FIPIINIIIIVIIMT 435
             +F+  F+  I  I +F +  IF   I+ I  F  IF +T  +   F+ I    I+VI + 
Sbjct:   161 LFVTIFVRAILVITLFVA--IFVRTILVITLFVAIFVRTILVITLFVTIFVRTILVITLF 218

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGII--FIYAL*TFNSLYMIHIITIIIY 594
                F   ++++  F   I+I  I  +T  +I  FI A+ T  S+++I I+ I I+
Sbjct:   219 VAIFVRTILVITLFVT-IFIISILLVTILVISVFIIAILTI-SIFVISILIITIF 271

 Score = 87 (30.6 bits), Expect = 1.6, P = 0.81
 Identities = 33/116 (28%), Positives = 58/116 (50%), Frame = +1

Query:   253 TYFFIIFIFFLFII-FTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             T F  IF+  + +I   + IF    I  I +   I+   I   T F+ I II+I+++ I+
Sbjct:   188 TLFVAIFVRTILVITLFVTIFVRT-ILVITLFVAIFVRTILVITLFVTIFIISILLVTIL 246

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
             +   F   I+ I  F    I I  IF ++  +I I+ + T  ++ ++ +I+I I  F
Sbjct:   247 VISVFIIAILTISIFVIS-ILIITIFVISVFVITIFVV-TIFAITVL-VISIFIVAF 300

 Score = 85 (29.9 bits), Expect = 2.7, P = 0.94
 Identities = 30/110 (27%), Positives = 53/110 (48%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSS-L*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFC 441
             +I +F    + TI + +  + IF   I+ I  F  IF +T  +    + I +  I++   
Sbjct:   172 VITLFVAIFVRTILVITLFVAIFVRTILVITLFVTIFVRTILVITLFVAIFVRTILVITL 231

Query:   442 FFT-YIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             F T +I+ IL      I ++II  LT  I  I  L    ++++I +  I I+
Sbjct:   232 FVTIFIISILLVTILVISVFIIAILTISIFVISIL--IITIFVISVFVITIF 281

 Score = 82 (28.9 bits), Expect = 6.0, P = 1.0
 Identities = 29/110 (26%), Positives = 57/110 (51%), Frame = +1

Query:   262 FIIFIFFLFIIF-TICIFSSL*IFHIFIIYIIWFFYIFFKTKFI-FIPIINIIIIVIIMT 435
             F++ IF + ++  TI + S L +  IF++ I+      F T F+  I ++ I++I + +T
Sbjct:   108 FVVTIFIIAVLLVTIFVISIL-LVTIFVVSIL--VVTLFITIFVRAILVVTILVINLFVT 164

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGI-IFIYAL*TFNSLYMIHIITIII 591
               F   I++I  F    I++  I  +T  + IF+  +        I + TI++
Sbjct:   165 I-FVRAILVITLFVA--IFVRTILVITLFVAIFVRTILVITLFVTIFVRTILV 214

 Score = 82 (28.9 bits), Expect = 6.0, P = 1.0
 Identities = 36/138 (26%), Positives = 66/138 (47%), Frame = +1

Query:   262 FIIFIFFLFIIF-TICIFSSL*--IFHIFIIYIIWFFYIFFKTKFIF-IPIINIII---- 417
             F++ IF + ++  TI + S L   IF + I+ +  F  IF +   +  I +IN+ +    
Sbjct:   108 FVVTIFIIAVLLVTIFVISILLVTIFVVSILVVTLFITIFVRAILVVTILVINLFVTIFV 167

Query:   418 --IVIIMTFC--FFTYIMIILFF--FYKHIYIYIIFFLTYGIIFIYAL*TFNSLYM--IH 573
               I++I  F   F   I++I  F   +    + I  F+T  +  I  +  F ++++  I 
Sbjct:   168 RAILVITLFVAIFVRTILVITLFVAIFVRTILVITLFVTIFVRTILVITLFVAIFVRTIL 227

Query:   574 IITIIIYKFI*QGLLYNI 627
             +IT+ +  FI   LL  I
Sbjct:   228 VITLFVTIFIISILLVTI 245

 Score = 81 (28.5 bits), Expect = 7.9, P = 1.0
 Identities = 24/112 (21%), Positives = 57/112 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWF-FYIFFKTKFIFIPIINIIIIVIIMT 435
             F ++ +  L ++  + +   + +  I I+ I+ F   +FF +  I + +I +I+I+II+ 
Sbjct:     2 FMMMMMVMLMMMVAVVVMVVMMVMFIMIMLIVVFTITVFFISTTIIVFVIFLIVILIILA 61

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
               F   I +I+F     + + +I  L   + F+       ++++I I+ + I+
Sbjct:    62 IFFGVTIFLIIF----SMTMLVIPVLVVSVFFV-------TIFIIAILLVTIF 103


>sp|P22082|SNF2_YEAST TRANSCRIPTION REGULATORY PROTEIN SNF2 (SWI/SNF COMPLEX
            COMPONENT SNF2) (REGULATORY PROTEIN SWI2) (REGULATORY PROTEIN GAM1)
            (TRANSCRIPTION FACTOR TYE3) >pir||S15047 SNF2 protein - yeast
            (Saccharomyces cerevisiae) >gi|4500 (X57837) GAM1/SNF2 protein
            [Saccharomyces cerevisiae] >gi|172632 (M61703) SNF2protein
            [Saccharomyces cerevisiae] >gnl|PID|d1015136 (D90459) RIC1
            [Saccharomyces cerevisiae] >gnl|PID|e189413 (X89633) regulatory
            protein gam1 [Saccharomyces cerevisiae] >gnl|PID|e252424 (Z75198)
            ORF YOR290c [Saccharomyces cerevisiae]
            Length = 1703

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 0.00032, Sum P(2) = 0.00032
 Identities = 25/53 (47%), Positives = 37/53 (69%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDG T + ER ++++ F+  D     F+LST+AGG+GLNL  A+ VI+ D
Sbjct:  1130 YLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFD 1182

 Score = 46 (16.2 bits), Expect = 0.00032, Sum P(2) = 0.00032
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY 601
             +IF Q T  +DI+E+ L Y
Sbjct:  1107 LIFFQMTQIMDIMEDFLRY 1125

 Score = 43 (15.1 bits), Expect = 0.00065, Sum P(2) = 0.00065
 Identities = 12/34 (35%), Positives = 19/34 (55%), Frame = -1

Query:   447 KETKRHDDNNNNNINDGDENKFCFKENIKKPNDI 346
             K+ +  DD++N+N+ D        KE+IKK   I
Sbjct:   729 KDEEYDDDDDNSNV-DYYNVAHRIKEDIKKQPSI 761

 Score = 40 (14.1 bits), Expect = 0.0013, Sum P(2) = 0.0013
 Identities = 6/15 (40%), Positives = 10/15 (66%), Frame = -1

Query:   429 DDNNNNNINDGDENK 385
             D NN +N+N G+  +
Sbjct:   308 DQNNQSNLNGGNNTQ 322


>prf||1718318A GAM1 gene [Saccharomyces cerevisiae]
            Length = 1703

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 0.00032, Sum P(2) = 0.00032
 Identities = 25/53 (47%), Positives = 37/53 (69%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDG T + ER ++++ F+  D     F+LST+AGG+GLNL  A+ VI+ D
Sbjct:  1130 YLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFD 1182

 Score = 46 (16.2 bits), Expect = 0.00032, Sum P(2) = 0.00032
 Identities = 9/19 (47%), Positives = 13/19 (68%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY 601
             +IF Q T  +DI+E+ L Y
Sbjct:  1107 LIFFQMTQIMDIMEDFLRY 1125

 Score = 43 (15.1 bits), Expect = 0.00065, Sum P(2) = 0.00065
 Identities = 12/34 (35%), Positives = 19/34 (55%), Frame = -1

Query:   447 KETKRHDDNNNNNINDGDENKFCFKENIKKPNDI 346
             K+ +  DD++N+N+ D        KE+IKK   I
Sbjct:   729 KDEEYDDDDDNSNV-DYYNVAHRIKEDIKKQPSI 761

 Score = 40 (14.1 bits), Expect = 0.0013, Sum P(2) = 0.0013
 Identities = 6/15 (40%), Positives = 10/15 (66%), Frame = -1

Query:   429 DDNNNNNINDGDENK 385
             D NN +N+N G+  +
Sbjct:   308 DQNNQSNLNGGNNTQ 322


>pir||F22845 hypothetical protein 6 - Trypanosoma brucei mitochondrion (SGC6)
            Length = 347

  Plus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 0.00034, P = 0.00034
 Identities = 44/154 (28%), Positives = 77/154 (50%), Frame = +1

Query:   112 YIFIF*KTFYDFLSFNSVC*SIQSYINL--MTCVILCTNR*GRKSR*SKTYFFIIFIFFL 285
             +IFI    F+DF+SF++    I +Y  +  M  V+ C             ++F+I+  F 
Sbjct:   111 FIFITFHIFFDFISFSNY---IYNYFGILYMENVMFCAYL-------FCLFYFVIYFLFC 160

Query:   286 FIIFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI--IMTFC--FFT 450
             FI F I C+F    +   F+ +    F        +++  I+++++    I  F   FF+
Sbjct:   161 FIFFVIRCLFI---VIMDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFS 217

Query:   451 YIMII-LFFFYKHIYIYIIF---FLTYGIIFIYAL*TFNSLYMIH 573
             +++I+ L F    + I + F   FL YGI  I     +  LYMI+
Sbjct:   218 FVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVY-WLYMIY 261

 Score = 108 (38.0 bits), Expect = 0.0051, P = 0.0051
 Identities = 29/114 (25%), Positives = 54/114 (47%), Frame = +1

Query:   259 FFIIFIFF-LFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             F ++F+   LF  FT  ++    I  I + Y+ W + I+ ++ +I +P I +I    I  
Sbjct:   226 FLLLFLVINLFFGFTFLVYG---IQIILLYYVYWLYMIYSRSCYILMPAI-LIFFKFIYF 281

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
               FF ++ I++ F       ++  FL   + F      F SLY   I++  I+ +
Sbjct:   282 DVFFVFVFILILFIISFFSFFLKDFLFLSLYFDI----FGSLYNYDILSYSIFYY 332

 Score = 108 (38.0 bits), Expect = 0.0051, P = 0.0051
 Identities = 36/123 (29%), Positives = 63/123 (51%), Frame = +1

Query:   256 YFFIIF-IFFLFIIFTICIFSSL*IFHI----FIIYIIWFFY--IFFKTKFIFIPIINII 414
             + FI F IFF FI F+  I++   I ++    F  Y+   FY  I+F   FIF  +I  +
Sbjct:   111 FIFITFHIFFDFISFSNYIYNYFGILYMENVMFCAYLFCLFYFVIYFLFCFIFF-VIRCL 169

Query:   415 IIVIIMTFCFFTYIMIILFFFYKHIYI-YIIFFLTY-GIIFIYAL*TFNSLYMIHIITII 588
              IVI M F FF + + +       +Y+ +I   L Y   IF +    F+ + ++ ++ ++
Sbjct:   170 FIVI-MDFLFFNFDIFVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVIILGLLFLL 228

Query:   589 IYKFI 603
             ++  I
Sbjct:   229 LFLVI 233

 Score = 101 (35.6 bits), Expect = 0.034, P = 0.033
 Identities = 25/88 (28%), Positives = 43/88 (48%), Frame = +1

Query:   346 YIIWFF---YIFFKTKFIFIPIINIIIIVIIMTFC--FFTYIMIILFFFYKHIYIYIIFF 510
             +I+W+F   +I +   F F+  I  I I ++  F   FF+++ ++LF  +  I    + F
Sbjct:    19 FILWWFDLDFILYDFVFDFVVCITFIFIFVLGFFIRIFFSFVFVLLFITFFGICSLTMLF 78

Query:   511 LTYGIIFIYAL*TFNSLYMIHIITIIIY 594
               Y I +IY L  F   +    I  +IY
Sbjct:    79 TGYYIYYIYILYNFICFFFAFGINFLIY 106

 Score = 99 (34.8 bits), Expect = 0.057, P = 0.055
 Identities = 41/136 (30%), Positives = 70/136 (51%), Frame = +1

Query:   247 SKTYFFI-IFIFFLFIIFT-ICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII-- 414
             S T  F   +I++++I++  IC F +  I +  I YI +F +I F   F FI   N I  
Sbjct:    73 SLTMLFTGYYIYYIYILYNFICFFFAFGI-NFLIYYIEFFIFITFHIFFDFISFSNYIYN 131

Query:   415 ---IIVI--IM----TFCFFTYIMIILF---FFY-KHIYIYIIFFLTYGI-IFIYAL*TF 552
                I+ +  +M     FC F +++  LF   FF  + ++I I+ FL +   IF+  L   
Sbjct:   132 YFGILYMENVMFCAYLFCLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSIL-LC 190

Query:   553 NSLYMIHIITIIIY-KFI 603
             + +Y+  I  +++Y  FI
Sbjct:   191 DIVYLDFISLLLLYFNFI 208

 Score = 97 (34.1 bits), Expect = 0.097, P = 0.092
 Identities = 29/123 (23%), Positives = 64/123 (52%), Frame = +1

Query:   256 YFFIIFIF-FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIIN-------I 411
             YF I+++   +F  +  C+F        F+IY + F +IFF  + +FI I++       I
Sbjct:   132 YFGILYMENVMFCAYLFCLF-------YFVIYFL-FCFIFFVIRCLFIVIMDFLFFNFDI 183

Query:   412 IIIVIIMTFCFFTYIMIILFFF---YKHIYIYIIFFLTYGIIFIYAL*TFNSLY----MI 570
              + +++    +  +I ++L +F   +  IY +  F +  G++F+      N  +    ++
Sbjct:   184 FVSILLCDIVYLDFISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLV 243

Query:   571 HIITIIIYKFI 603
             + I II+  ++
Sbjct:   244 YGIQIILLYYV 254

 Score = 97 (34.1 bits), Expect = 0.097, P = 0.092
 Identities = 32/124 (25%), Positives = 57/124 (45%), Frame = +1

Query:   250 KTYFFIIFIFFLFIIFTICIFSSL*I-FHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             + +F  +F+      F IC  + L   ++I+ IYI++ F  FF    I   I  I   + 
Sbjct:    54 RIFFSFVFVLLFITFFGICSLTMLFTGYYIYYIYILYNFICFFFAFGINFLIYYIEFFIF 113

Query:   427 IMTFCFFTYIMI--ILFFFYKHIYIYIIFFLTYGI-IF---IYAL*TFNSLYMIHIITII 588
             I    FF +I     ++ ++  +Y+  + F  Y   +F   IY L  F   ++I  + I+
Sbjct:   114 ITFHIFFDFISFSNYIYNYFGILYMENVMFCAYLFCLFYFVIYFLFCF-IFFVIRCLFIV 172

Query:   589 IYKFI 603
             I  F+
Sbjct:   173 IMDFL 177

 Score = 96 (33.8 bits), Expect = 0.13, P = 0.12
 Identities = 29/87 (33%), Positives = 43/87 (49%), Frame = +1

Query:   259 FFI-IFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFK-TKFIFIPIINIIIIVIIM 432
             FFI IF  F+F++  I  F    +  +F  Y I++ YI +    F F   IN +I  I  
Sbjct:    51 FFIRIFFSFVFVLLFITFFGICSLTMLFTGYYIYYIYILYNFICFFFAFGINFLIYYIEF 110

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIFFLTY 519
              F F T+ +   F  + + YIY  F + Y
Sbjct:   111 -FIFITFHIFFDFISFSN-YIYNYFGILY 137

 Score = 92 (32.4 bits), Expect = 0.36, P = 0.31
 Identities = 29/125 (23%), Positives = 63/125 (50%), Frame = +1

Query:   256 YFFIIFIFFLFII-FTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             +  ++ ++F FI  F    FS + I  +  + +     +FF   F+   I  I++  +  
Sbjct:   197 FISLLLLYFNFIFNFIYGFFSFVIILGLLFLLLFLVINLFFGFTFLVYGIQIILLYYVYW 256

Query:   433 TFCFFT---YIMI-ILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
              +  ++   YI++  +  F+K IY + +FF+   I+ ++ + +F S ++   + + +Y F
Sbjct:   257 LYMIYSRSCYILMPAILIFFKFIY-FDVFFVFVFILILFII-SFFSFFLKDFLFLSLY-F 313

Query:   601 I*QGLLYN 624
                G LYN
Sbjct:   314 DIFGSLYN 321

 Score = 91 (32.0 bits), Expect = 0.47, P = 0.38
 Identities = 35/115 (30%), Positives = 55/115 (47%), Frame = +1

Query:   250 KTYFFIIFIFFL-FIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             +TY FI++ F L FI++       + I  IFI  + +F  IFF   F+F+     ++ + 
Sbjct:    15 RTYDFILWWFDLDFILYDFVFDFVVCITFIFIFVLGFFIRIFFS--FVFV-----LLFIT 67

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
                 C  T    +LF  Y   YIY I+ L   I F +A   F   ++I+ I   I+
Sbjct:    68 FFGICSLT----MLFTGY---YIYYIYILYNFICFFFA---FGINFLIYYIEFFIF 113

 Score = 88 (31.0 bits), Expect = 1.0, P = 0.65
 Identities = 27/102 (26%), Positives = 55/102 (53%), Frame = +1

Query:   259 FFIIFIFF--LFIIFTICIFSSL*IFHIFIIY-----------IIWFFYIFFKTKFIFIP 399
             F +I +FF   F+++ I I     ++ +++IY           +I+F +I+F   F+F+ 
Sbjct:   230 FLVINLFFGFTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFKFIYFDVFFVFVF 289

Query:   400 IINIIIIVIIMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIF 531
             I+ I+ I+   +F    ++ + L+F  +  +Y Y I  L+Y I +
Sbjct:   290 IL-ILFIISFFSFFLKDFLFLSLYFDIFGSLYNYDI--LSYSIFY 331

 Score = 85 (29.9 bits), Expect = 2.3, P = 0.90
 Identities = 22/93 (23%), Positives = 51/93 (54%), Frame = +1

Query:   256 YFFIIF---IFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             + F+++   I  L+ ++ + +  S   + +    +I+F +I+F   F+F+ I+ I+ I+ 
Sbjct:   239 FTFLVYGIQIILLYYVYWLYMIYSRSCYILMPAILIFFKFIYFDVFFVFVFIL-ILFIIS 297

Query:   427 IMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIF 531
               +F    ++ + L+F  +  +Y Y I  L+Y I +
Sbjct:   298 FFSFFLKDFLFLSLYFDIFGSLYNYDI--LSYSIFY 331


>gi|1655930 (U66564) RUSH-1alpha [Oryctolagus cuniculus]
            Length = 1005

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 0.00040, P = 0.00040
 Identities = 43/134 (32%), Positives = 67/134 (50%), Frame = -1

Query:   435 RHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             R+D + +N +    E   C  E  KK N    E   +S+     +   + + K+ + + +
Sbjct:   798 RNDIHGDNLLECPPEELACDSE--KKSN---MEWTSSSKINALMHALIDLRTKNPNIKSL 852

Query:   255 CLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDE--NIFVFLLSTKAG 82
              ++  T   S + T   A   ++ RLDGS    +R + I+ F   E  +  + LLS KAG
Sbjct:   853 VVSQFTTFLSLIETPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAG 912

Query:    81 GVGLNLIAANHVILMD 34
             GVGLNL AA+ V LMD
Sbjct:   913 GVGLNLCAASRVFLMD 928


>gi|1703553 (U80033) coded for by C. elegans cDNA yk43f12.3; coded for by C.
            elegans cDNA yk134d1.3; coded for by C. elegans cDNA yk58f12.5;
            coded for by C. elegans cDNA yk134d1.5; coded for by C. elegans
            cDNA yk53e3.5; strong similarity to helicases of...
            Length = 1026

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 0.00041, P = 0.00041
 Identities = 37/129 (28%), Positives = 67/129 (51%), Frame = -1

Query:   420 NNNNINDG-DENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTS 244
             +++N  +G D NK   +E  + P  I+  D  + +  K    E  ++  ++ ++ + ++ 
Sbjct:   810 DSDNDEEGVDTNK---EEPKQPPTRIFEPDFISCKMAK--TLEVVREILEKKEKVVIVSQ 864

Query:   243 STLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDEN-IFVFLLSTKAGGVGLN 67
              T   + V     AG   Y  + G     +RQ+ +  F++++    V LLS  AGGVGLN
Sbjct:   865 WTSVLNLVEKHIQAGGHNYTSITGQVLVKDRQERVDSFNQEKGGAQVMLLSLTAGGVGLN 924

Query:    66 LIAANHVILMD 34
             LI  NH+I++D
Sbjct:   925 LIGGNHLIMVD 935


>gi|552200 (M63270) malaria antigen [Plasmodium falciparum]
           Length = 109

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.00045, P = 0.00045
 Identities = 21/66 (31%), Positives = 43/66 (65%), Frame = -1

Query:   582 SDYMDHIQT-IKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGK-ETKRHDDNNNNN 409
             SD+++  Q+ + +S+  ++  + C+E+NN N+ + I + +N  +  K +   +DDNNN++
Sbjct:    40 SDFLEKDQSQVITSEEDSEMKSSCREKNN-NIKMGIPKMKNNSNYNKNDDNNNDDNNNDD 98

Query:   408 INDGDEN 388
              NDG+ N
Sbjct:    99 NNDGNNN 105

 Score = 92 (32.4 bits), Expect = 0.0016, P = 0.0016
 Identities = 23/70 (32%), Positives = 44/70 (62%), Frame = -1

Query:   582 SDYMDHIQT-IKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGK-ETKRHDDNNNNN 409
             SD+++  Q+ + +S+  ++  + C+E+NN N+ + I + +N  +  K +   +DDNNN++
Sbjct:    40 SDFLEKDQSQVITSEEDSEMKSSCREKNN-NIKMGIPKMKNNSNYNKNDDNNNDDNNNDD 98

Query:   408 INDG----DEN 388
              NDG    DEN
Sbjct:    99 NNDGNNNNDEN 109


>pir||S51908 cryptogene protein G1(ND9) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 196

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.00052, P = 0.00052
 Identities = 25/92 (27%), Positives = 51/92 (55%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWF-FYIFFKTKFIFIPIINIIIIVIIMT 435
             FF +   ++F+ F  C F     F++F+ + ++F  ++FF   F  +  +++  I     
Sbjct:    23 FFCLCCRWVFLCFVDCSFV---FFYLFVCFFLFFVMFLFFNLWFFLLYCLDLFCIDFC-G 78

Query:   436 FCFFTYIMIILFFF----YKHIYIYIIFFLTYGIIF 531
             FCF  +I+I + F     ++  ++ I FFL +G++F
Sbjct:    79 FCFVRFILIYVLFCLLLCFRVSFVLICFFLFFGLVF 114

 Score = 102 (35.9 bits), Expect = 0.0070, P = 0.0069
 Identities = 27/91 (29%), Positives = 50/91 (54%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             FF +F+ F F+ F + +F +L     F++Y +  F I F   F F+  I +I ++  +  
Sbjct:    42 FFYLFVCF-FLFFVMFLFFNL---WFFLLYCLDLFCIDF-CGFCFVRFI-LIYVLFCLLL 95

Query:   439 CFFTYIMIILFFFYKHIYIYIIFFLTYGI-IF 531
             CF    ++I FF +  + ++ +FF +Y + IF
Sbjct:    96 CFRVSFVLICFFLFFGL-VFSLFFCSYALCIF 126


>pir||A56095 HIP116 protein - human >gi|531196 (L34673) ATPase [Homo sapiens]
            Length = 1009

  Minus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 0.00053, P = 0.00052
 Identities = 41/130 (31%), Positives = 68/130 (52%), Frame = -1

Query:   414 NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEY---NKKKKDEDDEEICLTS 244
             N+I++ D    C  E + + ++    DME +  +K     +   + +KK+ + + + ++ 
Sbjct:   802 NDIHE-DNLLECPPEELARDSE-KKSDMEWTSSSKINALMHALTDLRKKNPNIKSLVVSQ 859

Query:   243 STLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDE--NIFVFLLSTKAGGVGL 70
              T   S +     A   ++ RLDGS    +R + I+ F   E  +  + LLS KAGGVGL
Sbjct:   860 FTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAGGVGL 919

Query:    69 NLIAANHVILMD 34
             NL AA+ V LMD
Sbjct:   920 NLSAASRVFLMD 931


>pir||S55492 rad8 protein - fission yeast (Schizosaccharomyces pombe)
            (fragment) >gi|871545 (Z49811) Rad8 [Schizosaccharomyces pombe]
            Length = 104

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.00058, P = 0.00058
 Identities = 18/30 (60%), Positives = 23/30 (76%), Frame = -1

Query:   123 DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             D ++ V ++S KAGGVGLNL  ANHV +MD
Sbjct:     1 DPDVNVLIISLKAGGVGLNLTCANHVFIMD 30


>sp|P15583|NU5M_LEITA NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >pir||A26696 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Sauroleishmania
            tarentolae mitochondrion (SGC6) (fragment)
            Length = 101

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.00076, P = 0.00076
 Identities = 31/93 (33%), Positives = 47/93 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFF---YIFFKTKFIFIPIINIIIIV 423
             FF I +F +FII  I   I S + IF+ F I  I FF   ++F    F+F        I 
Sbjct:     9 FFDIALFTVFIIDIIKFYILSGV-IFYFFNIDCIMFFWRVFLFITMGFLFFIFTTWYFIC 67

Query:   424 IIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFI 534
               M  C F + ++I   ++++   Y +FF    II+I
Sbjct:    68 FYMYICMFIWNLVI---YFRYNLKYCLFFCMLFIIYI 101

 Score = 71 (25.0 bits), Expect = 1.4, P = 0.76
 Identities = 19/70 (27%), Positives = 38/70 (54%), Frame = +1

Query:   265 IIFIFFLF--IIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII-MT 435
             +IF FF    I+F   +F  + +  +F I+  W+F  F+   +I + I N++I     + 
Sbjct:    31 VIFYFFNIDCIMFFWRVFLFITMGFLFFIFTTWYFICFYM--YICMFIWNLVIYFRYNLK 88

Query:   436 FCFFTYIMIILF 471
             +C F  ++ I++
Sbjct:    89 YCLFFCMLFIIY 100

 Score = 70 (24.6 bits), Expect = 2.8, P = 0.94
 Identities = 18/59 (30%), Positives = 31/59 (52%), Frame = +1

Query:   256 YFFIIFIF----FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIV 423
             +F+ +F+F    FLF IFT   F     F+++I   IW   I+F+    +     ++ I+
Sbjct:    43 FFWRVFLFITMGFLFFIFTTWYFIC---FYMYICMFIWNLVIYFRYNLKYCLFFCMLFII 99

Query:   424 II 429
              I
Sbjct:   100 YI 101

 Score = 70 (24.6 bits), Expect = 2.8, P = 0.94
 Identities = 32/98 (32%), Positives = 46/98 (46%), Frame = +1

Query:   337 FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLT 516
             F +Y   FF I   T FI I II   I+  ++ F FF  I  I+FF+       +  F+T
Sbjct:     2 FYLYYASFFDIALFTVFI-IDIIKFYILSGVI-FYFFN-IDCIMFFWR------VFLFIT 52

Query:   517 YGIIF-IYAL*TFNSLYMIHIITIIIYKFI*QGLLYNIK 630
              G +F I+    F   YM   I + I+  +     YN+K
Sbjct:    53 MGFLFFIFTTWYFICFYMY--ICMFIWNLVIY-FRYNLK 88


>sp|P38144|YB95_YEAST HYPOTHETICAL 131.1 KD HELICASE IN ALG7-ENP1 INTERGENIC
            REGION >gnl|PID|e304681 (Z36114) ORF YBR245c [Saccharomyces
            cerevisiae]
            Length = 1129

  Minus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.00080, Sum P(3) = 0.00080
 Identities = 25/53 (47%), Positives = 37/53 (69%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R+DGST   +R + I  ++  D   FVFLL+T+AGG+G+NL +A+ V+L D
Sbjct:   545 YCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYD 597

 Score = 46 (16.2 bits), Expect = 0.00080, Sum P(3) = 0.00080
 Identities = 9/31 (29%), Positives = 17/31 (54%), Frame = -1

Query:   465 NYHDIGKETKRHDDNNNNNINDGDENKFCFK 373
             N+H     T+    + NN+ N+ D+++  FK
Sbjct:     9 NFHFFKFYTRMRKKHENNSCNEKDKDENLFK 39

 Score = 39 (13.7 bits), Expect = 0.00080, Sum P(3) = 0.00080
 Identities = 7/29 (24%), Positives = 16/29 (55%), Frame = -1

Query:   342 NEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             ++D+   +   + + E  K++  +DDE I
Sbjct:   153 HQDVRRRKTEHEEDAELLKEEDSDDDESI 181


>pir||S46122 SNF2 protein homolog YBR245c - yeast (Saccharomyces cerevisiae)
            Length = 1143

  Minus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.00083, Sum P(3) = 0.00083
 Identities = 25/53 (47%), Positives = 37/53 (69%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R+DGST   +R + I  ++  D   FVFLL+T+AGG+G+NL +A+ V+L D
Sbjct:   559 YCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYD 611

 Score = 46 (16.2 bits), Expect = 0.00083, Sum P(3) = 0.00083
 Identities = 9/31 (29%), Positives = 17/31 (54%), Frame = -1

Query:   465 NYHDIGKETKRHDDNNNNNINDGDENKFCFK 373
             N+H     T+    + NN+ N+ D+++  FK
Sbjct:    23 NFHFFKFYTRMRKKHENNSCNEKDKDENLFK 53

 Score = 39 (13.7 bits), Expect = 0.00083, Sum P(3) = 0.00083
 Identities = 7/29 (24%), Positives = 16/29 (55%), Frame = -1

Query:   342 NEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             ++D+   +   + + E  K++  +DDE I
Sbjct:   167 HQDVRRRKTEHEEDAELLKEEDSDDDESI 195


>gi|1280116 (U55373) coded for by C. elegans cDNA yk72d6.3; coded for by C.
            elegans cDNA yk28h7.5; coded for by C. elegans cDNA yk28d2.3; coded
            for by C. elegans cDNA yk34h7.3; coded for by C. elegans cDNA
            yk21a12.3; coded for by C. elegans cDNA yk131b5...
            Length = 1334

  Minus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.00089, Sum P(2) = 0.00089
 Identities = 25/53 (47%), Positives = 34/53 (64%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R+DGS     RQ  I R++      F+FLLST+AGG+G+NL  A+ VI+ D
Sbjct:   474 YERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYD 526

 Score = 56 (19.7 bits), Expect = 0.00089, Sum P(2) = 0.00089
 Identities = 13/28 (46%), Positives = 18/28 (64%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLYE-FIYDDSD 577
             +IFSQ T  LDI+E+   YE + Y+  D
Sbjct:   451 LIFSQMTRMLDIMEDLCEYEGYRYERID 478


>gnl|PID|e349623 (Z92970) H06O01.2 [Caenorhabditis elegans]
            Length = 1465

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.00093, Sum P(2) = 0.00093
 Identities = 22/51 (43%), Positives = 33/51 (64%), Frame = -1

Query:   183 RLDGSTNTIERQKIIKRFSKDENI-FVFLLSTKAGGVGLNLIAANHVILMD 34
             RLDGS     R++ +  ++   +  F FLLST+AGG+G+NL  A+ VI+ D
Sbjct:   756 RLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFD 806

 Score = 67 (23.6 bits), Expect = 0.00093, Sum P(2) = 0.00093
 Identities = 26/124 (20%), Positives = 56/124 (45%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIK-----EEQNYHDIGKETKRHDD 424
             D SD  D     ++S S   ++   K++NN N  +  +     E +NY    K +KR DD
Sbjct:    53 DQSDDSDDAS--ENSSSSEPDEPAPKKKNNNNRGMDAETRKLLENENYFRRSKRSKRQDD 110

Query:   423 NNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDT--------NCEYNKKKKDED 268
             + ++N  +   ++  + +  K    +  + ++ +++            N  Y +K  D+D
Sbjct:   111 SPSDNSEESQSSEDDWDDRRKPRRTVTKKVVKQTKKAVSVVKRKSVKGNVNYAEKNSDDD 170

Query:   267 --DEEI 256
               D+++
Sbjct:   171 IDDDDV 176

 Score = 46 (16.2 bits), Expect = 0.12, Sum P(2) = 0.12
 Identities = 16/71 (22%), Positives = 31/71 (43%), Frame = -1

Query:   423 NNNNNINDGDENKFCFKENI-------KKPNDIYNEDMENSERTKDTNCEYNKKKKDEDD 265
             NNNN   D +  K    EN        K+ +D  +++ E S+ ++D   +  K ++    
Sbjct:    79 NNNNRGMDAETRKLLENENYFRRSKRSKRQDDSPSDNSEESQSSEDDWDDRRKPRRTVTK 138

Query:   264 EEICLTSSTLS 232
             + +  T   +S
Sbjct:   139 KVVKQTKKAVS 149

 Score = 45 (15.8 bits), Expect = 0.16, Sum P(2) = 0.15
 Identities = 9/17 (52%), Positives = 12/17 (70%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEAL 607
             +IFSQ    LDI++E L
Sbjct:   731 LIFSQMVMMLDILQEYL 747

 Score = 43 (15.1 bits), Expect = 0.25, Sum P(2) = 0.22
 Identities = 14/50 (28%), Positives = 22/50 (44%), Frame = -1

Query:   336 DMENSERT-----KDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDA 202
             D E  E+T     ++ N E N   +D D++E    S   S+      +DA
Sbjct:    12 DAEPDEKTDEPVREEENPEGNSTSEDNDEKEKAADSPESSSDQSDDSDDA 61

 Score = 40 (14.1 bits), Expect = 0.50, Sum P(2) = 0.39
 Identities = 14/61 (22%), Positives = 28/61 (45%), Frame = -1

Query:   447 KETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDED 268
             +E +  + N+ +  ND  E      E+    +D  ++  ENS  ++    E   KKK+ +
Sbjct:    24 REEENPEGNSTSEDNDEKEKAADSPESSSDQSDDSDDASENSSSSEPD--EPAPKKKNNN 81

Query:   267 D 265
             +
Sbjct:    82 N 82


>gi|2443887 (AC002294) Similar to transcription factor gb|Z46606|1658307 and
            others [Arabidopsis thaliana]
            Length = 1272

  Minus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.00093, Sum P(2) = 0.00093
 Identities = 21/57 (36%), Positives = 36/57 (63%), Frame = -1

Query:   204 AGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             + H  Y RLDG+ +   R K ++ F+    + V ++S KA  +GLN++AA HV+++D
Sbjct:  1152 SSHIQYRRLDGTMSVAARDKAVQDFNTLPEVTVMIMSLKAASLGLNMVAACHVLMLD 1208

 Score = 53 (18.7 bits), Expect = 0.00093, Sum P(2) = 0.00093
 Identities = 10/24 (41%), Positives = 18/24 (75%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEALLYEFI 592
             K+I+FSQ+T  L+++E +L+   I
Sbjct:  1132 KAIVFSQWTKMLNLLEASLVSSHI 1155


>pir||S43955 CR5 protein - Trypanosoma brucei >gi|468424 (L26251) CR5
            [Trypanosoma brucei]
            Length = 150

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.00095, P = 0.00095
 Identities = 26/121 (21%), Positives = 61/121 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIY--IIWF---FY------IFFKTKFIFIPII 405
             F I++   LFI F +C    L   H F  +   +WF    Y      +F+     F+  +
Sbjct:    18 FLILWFIILFIGFFLCFLCFL--LHFFDCFRCCLWFSCGLYDMNSRLVFYTLDLCFVSCL 75

Query:   406 NIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITI 585
               +++  I+    F +++++ +F Y  ++++ +FF+   I F++    ++ +Y+  +I  
Sbjct:    76 FFVLLNSIICVLLFVFVIVLFYFCYGFLFLWFLFFVVC-IGFVWYF--WDHVYLCGVILF 132

Query:   586 IIYKFI 603
              ++ F+
Sbjct:   133 CLWCFL 138

 Score = 85 (29.9 bits), Expect = 0.34, P = 0.29
 Identities = 23/95 (24%), Positives = 46/95 (48%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIY--IIWFFYIFF--KTKFIFIPIINIIIIVI 426
             F I++   LFI F +C    L   H F  +   +WF    +   ++ +F  +   +  V 
Sbjct:    18 FLILWFIILFIGFFLCFLCFL--LHFFDCFRCCLWFSCGLYDMNSRLVFYTLD--LCFVS 73

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL 543
              + F     I+ +L F    +++ ++F+  YG +F++ L
Sbjct:    74 CLFFVLLNSIICVLLF----VFVIVLFYFCYGFLFLWFL 108


>pir||B30010 hypothetical ORF-5 protein - Sauroleishmania tarentolae
            mitochondrion (SGC6)
            Length = 105

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.00098, P = 0.00098
 Identities = 22/87 (25%), Positives = 42/87 (48%), Frame = +1

Query:   346 YIIWFF---YIFFKTKFIFIPIINIIIIVIIMTFC--FFTYIMIILFFFYKHIYIYIIFF 510
             +I+W+F   +I +   F F+  I  I + ++  F   FF+++ ++LF  +  ++     +
Sbjct:    19 FILWWFDLDFILYDFVFDFVVCITFIFVFVLGFFLRIFFSFVFVLLFIVFFGLFSLSFLY 78

Query:   511 LTYGIIFIYAL*TFNSLYMIHIITIII 591
               Y I +IY L  F   +    I  II
Sbjct:    79 TGYFIYYIYILYNFICYFFCFSIAYII 105

 Score = 91 (32.0 bits), Expect = 0.0021, P = 0.0021
 Identities = 22/90 (24%), Positives = 45/90 (50%), Frame = +1

Query:   250 KTYFFIIFIFFL-FIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             ++Y FI++ F L FI++       + I  IF+  + +F  IFF   F+F+ +  +   + 
Sbjct:    15 RSYDFILWWFDLDFILYDFVFDFVVCITFIFVFVLGFFLRIFFS--FVFVLLFIVFFGLF 72

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTY 519
              ++F +  Y +  ++  Y  I  +  F + Y
Sbjct:    73 SLSFLYTGYFIYYIYILYNFICYFFCFSIAY 103

 Score = 71 (25.0 bits), Expect = 2.9, P = 0.94
 Identities = 22/69 (31%), Positives = 34/69 (49%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIF---FKTKFIFIPIINIIIIVIIM 432
             F++ I F+F+ F +  F  +    +F++  I FF +F   F     FI  I I+   I  
Sbjct:    37 FVVCITFIFV-FVLGFFLRIFFSFVFVLLFIVFFGLFSLSFLYTGYFIYYIYILYNFICY 95

Query:   433 TFCF-FTYIM 459
              FCF   YI+
Sbjct:    96 FFCFSIAYII 105


>gnl|PID|e280495 (Z46606) helicase-like transcription factor [Homo sapiens]
            Length = 887

  Minus Strand HSPs:

 Score = 119 (41.9 bits), Expect = 0.0010, P = 0.0010
 Identities = 40/130 (30%), Positives = 68/130 (52%), Frame = -1

Query:   414 NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEY---NKKKKDEDDEEICLTS 244
             N+I++ D    C  E + + ++    DME +  +K     +   + +KK+ + + + ++ 
Sbjct:   680 NDIHE-DNLLECPPEELARDSE-KKSDMEWTSSSKINALMHALTDLRKKNPNIKSLVVSQ 737

Query:   243 STLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDE--NIFVFLLSTKAGGVGL 70
              T   S +     A   ++ RLDGS    +R + I+ F   E  +  + LLS +AGGVGL
Sbjct:   738 FTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLRAGGVGL 797

Query:    69 NLIAANHVILMD 34
             NL AA+ V LMD
Sbjct:   798 NLSAASRVFLMD 809


>pir||B26696 hypothetical protein 1 (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6) (fragment)
            >gi|896286 (M10126) NH2 terminus uncertain [Leishmania tarentolae]
            Length = 443

  Plus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.0012, P = 0.0012
 Identities = 37/125 (29%), Positives = 67/125 (53%), Frame = +1

Query:   268 IFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             +F++ + II  + ++S    F I   Y    FY+ F    I++ IINIII+ I+ ++  F
Sbjct:     3 LFLYLIHIILFLLLYS----FIILCDYTS-LFYLSFD--LIWLIIINIIILTILDSYICF 55

Query:   448 TYIMIILF-FFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGLLYN 624
              ++++ LF FF+   ++       + II +  +  F  L++IHI+ I I   +   LL+ 
Sbjct:    56 IFLLLFLFCFFFLFCFLNFDTRFVFMIIIMQYIIIFMFLHVIHILFISILFELFSLLLFL 115

Query:   625 IKKSSK 642
             I  SS+
Sbjct:   116 ILISSR 121

 Score = 115 (40.5 bits), Expect = 0.0012, P = 0.0012
 Identities = 38/128 (29%), Positives = 65/128 (50%), Frame = +1

Query:   250 KTYFFIIFIFF--LFIIFTICIFSSL*IFHI---FIIYIIWFFYIFFKTKFIFIPIINII 414
             K Y  I+ +F   L+I   + IF  +  F++   FI+ I+   +I+F   FI + II  I
Sbjct:   185 KLYIAILILFLEQLYIRLGVFIFIYMLTFYVLFCFILIILLICFIYFYIIFIKLIIIQSI 244

Query:   415 IIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIH-IITIII 591
               V+I    F    ++ +       ++++IF  T   IF Y    F+ +Y +  II II+
Sbjct:   245 TCVLIGLNSFAIVSLLFVLSVNNFSFLFLIFISTKNYIF-YMYLNFHLIYSLSLIILIIL 303

Query:   592 YKFI*QGLLYNI 627
             Y F    ++YN+
Sbjct:   304 YYFF---IVYNM 312

 Score = 103 (36.3 bits), Expect = 0.029, P = 0.028
 Identities = 34/121 (28%), Positives = 61/121 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIF----FKTKFIFIPIINIIIIVI 426
             F +I++  + II  + I  S   F   ++++  FF++F    F T+F+F+    III+  
Sbjct:    33 FDLIWLIIINIII-LTILDSYICFIFLLLFLFCFFFLFCFLNFDTRFVFM----IIIMQY 87

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI* 606
             I+ F F   I I+       ++  ++F +     F Y +      YMI++I  I+  F+ 
Sbjct:    88 IIIFMFLHVIHILFISILFELFSLLLFLILISSRFGYKILILWYYYMINLINFILL-FV- 145

Query:   607 QGLLY 621
               LLY
Sbjct:   146 --LLY 148

 Score = 103 (36.3 bits), Expect = 0.029, P = 0.028
 Identities = 37/128 (28%), Positives = 63/128 (49%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHI-FIIYIIWFFYIFFKTKFIFIPIINIIIIV----II 429
             I+FI  LF +F++ +F  L      + I I+W++Y+     FI + ++   +I+     +
Sbjct:    99 ILFISILFELFSLLLFLILISSRFGYKILILWYYYMINLINFILLFVLLYYMILNYCFYL 158

Query:   430 MTFCFFT------------YIMIILFFFYKHIYIYII--FFLTYGI-IFIYAL*TFNSLY 564
               FCF              YI++ILF  Y  I I  +   ++  G+ IFIY L TF  L+
Sbjct:   159 CDFCFLIFDEEWLGILCLFYILLILFKLYIAILILFLEQLYIRLGVFIFIYML-TFYVLF 217

Query:   565 MIHIITIII 591
                +I ++I
Sbjct:   218 CFILIILLI 226

 Score = 102 (35.9 bits), Expect = 0.037, P = 0.036
 Identities = 29/119 (24%), Positives = 66/119 (55%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIW---FFYIFFKTKFIFIPIINIII 417
             +K Y F +++ F  +I+++ +   + +++ FI+Y ++   +   +F   FIF    N ++
Sbjct:   278 TKNYIFYMYLNF-HLIYSLSLIILIILYYFFIVYNMFDIKYNENYFLINFIFFSFFNNLL 336

Query:   418 IVIIMTFCFFTYI--MIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
             I I++  C F  I  + I+F F+  ++  ++     GI  ++    F+ +++I II I  
Sbjct:   337 ISIMIA-CIFLCIGSIPIVFGFFLKVFCLLLHLSYLGICIVF----FSIIWLI-IIYIFY 390

Query:   592 YKFI 603
             ++ I
Sbjct:   391 FRLI 394

 Score = 99 (34.8 bits), Expect = 0.082, P = 0.079
 Identities = 28/98 (28%), Positives = 52/98 (53%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFII-YIIWFFYIFFKTKFIFIPIIN---IIIIVI 426
             F ++F+F  F +F    F +  +F I I+ YII F ++      +FI I+     +++ +
Sbjct:    57 FLLLFLFCFFFLFCFLNFDTRFVFMIIIMQYIIIFMFLHV-IHILFISILFELFSLLLFL 115

Query:   427 IMTFCFFTYIMIILFFFY--KHIYIYIIFFLTYGIIFIY 537
             I+    F Y ++IL+++Y    I   ++F L Y +I  Y
Sbjct:   116 ILISSRFGYKILILWYYYMINLINFILLFVLLYYMILNY 154

 Score = 99 (34.8 bits), Expect = 0.082, P = 0.079
 Identities = 33/123 (26%), Positives = 62/123 (50%), Frame = +1

Query:   259 FFIIFIFF-LFIIFTICIFSSL*I-FHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             F+I+ I F L+I   I     L I   +FI   +  FY+ F     FI    +II++I  
Sbjct:   177 FYILLILFKLYIAILILFLEQLYIRLGVFIFIYMLTFYVLF----CFI----LIILLICF 228

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIIT--IIIYKFI* 606
              + +  +I +I+      + I +  F    ++F+ ++  F+ L++I I T   I Y ++ 
Sbjct:   229 IYFYIIFIKLIIIQSITCVLIGLNSFAIVSLLFVLSVNNFSFLFLIFISTKNYIFYMYLN 288

Query:   607 QGLLYNI 627
               L+Y++
Sbjct:   289 FHLIYSL 295

 Score = 99 (34.8 bits), Expect = 0.082, P = 0.079
 Identities = 32/128 (25%), Positives = 68/128 (53%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIW---FFYIFFKTKFIFIPIINIII 417
             +K Y F +++ F  +I+++ +   + +++ FI+Y ++   +   +F   FIF    N ++
Sbjct:   278 TKNYIFYMYLNF-HLIYSLSLIILIILYYFFIVYNMFDIKYNENYFLINFIFFSFFNNLL 336

Query:   418 IVIIMTFCFFTYI--MIILFFFYKHIYIYIIFFLTYGI-IFIYAL*TFNSLYMIH---II 579
             I I++  C F  I  + I+F F+  ++  ++     GI I  +++     +Y+ +   II
Sbjct:   337 ISIMIA-CIFLCIGSIPIVFGFFLKVFCLLLHLSYLGICIVFFSIIWLIIIYIFYFRLII 395

Query:   580 TIII--YKFI 603
              I I  Y+FI
Sbjct:   396 NIFIFSYQFI 405

 Score = 95 (33.4 bits), Expect = 0.24, P = 0.21
 Identities = 30/125 (24%), Positives = 60/125 (48%), Frame = +1

Query:   247 SKTYFFIIFIFFLFI------IFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIIN 408
             ++ YF I FIFF F       I   CIF  +    I   + +  F +     ++ I I+ 
Sbjct:   318 NENYFLINFIFFSFFNNLLISIMIACIFLCIGSIPIVFGFFLKVFCLLLHLSYLGICIVF 377

Query:   409 IIIIVIIMTFCFFTYIMIILFFF-YKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITI 585
               II +I+ + F+  ++I +F F Y+ I  +++     G   ++ + +F S++++    I
Sbjct:   378 FSIIWLIIIYIFYFRLIINIFIFSYQFIGFWVVRLHILGFSNLFFILSF-SIFILFFDII 436

Query:   586 IIYKFI 603
              ++  I
Sbjct:   437 NLFDLI 442

 Score = 94 (33.1 bits), Expect = 0.31, P = 0.26
 Identities = 31/124 (25%), Positives = 66/124 (53%), Frame = +1

Query:   256 YFFII-FIFFL----FIIFT------ICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPI 402
             Y+ I+ + F+L    F+IF       +C+F  L I  +F +YI     +F +  +I + +
Sbjct:   148 YYMILNYCFYLCDFCFLIFDEEWLGILCLFYILLI--LFKLYIA-ILILFLEQLYIRLGV 204

Query:   403 -INIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHII 579
              I I ++   + FCF   I++I F ++  I+I +I   +   + I  L +F  + ++ ++
Sbjct:   205 FIFIYMLTFYVLFCFILIILLICFIYFYIIFIKLIIIQSITCVLI-GLNSFAIVSLLFVL 263

Query:   580 TIIIYKFI 603
             ++  + F+
Sbjct:   264 SVNNFSFL 271

 Score = 93 (32.7 bits), Expect = 0.40, P = 0.33
 Identities = 33/118 (27%), Positives = 65/118 (55%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*IFHIFI-IYIIWFFYIFFKTKFIFIPIINIIIIV 423
             ++ YF I FIFF F  F   + S + I  IF+ I  I   + FF    +F  ++++  + 
Sbjct:   318 NENYFLINFIFFSF--FNNLLISIM-IACIFLCIGSIPIVFGFFLK--VFCLLLHLSYLG 372

Query:   424 IIMTFCFFTYIMIILFFFYK---HIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             I + F    +++II  F+++   +I+I+   F+ + ++ ++ L  F++L+ I   +I I 
Sbjct:   373 ICIVFFSIIWLIIIYIFYFRLIINIFIFSYQFIGFWVVRLHIL-GFSNLFFILSFSIFIL 431

Query:   595 KF 600
              F
Sbjct:   432 FF 433

 Score = 92 (32.4 bits), Expect = 0.52, P = 0.41
 Identities = 31/108 (28%), Positives = 51/108 (47%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIF-IIYII------WFFYIFFKTK-FIFIPIINI 411
             YF+IIFI  + I    C+   L  F I  +++++      + F IF  TK +IF   +N 
Sbjct:   230 YFYIIFIKLIIIQSITCVLIGLNSFAIVSLLFVLSVNNFSFLFLIFISTKNYIFYMYLNF 289

Query:   412 -------IIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFI 534
                    +II+II+ + F  Y M  + +   +  I  IFF  +  + I
Sbjct:   290 HLIYSLSLIILIILYYFFIVYNMFDIKYNENYFLINFIFFSFFNNLLI 337

 Score = 87 (30.6 bits), Expect = 1.9, P = 0.86
 Identities = 33/106 (31%), Positives = 57/106 (53%), Frame = +1

Query:   274 IFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTY 453
             I  L+  + I + + + +F + + Y+I   Y F+   F F+ I +   + I+   C F Y
Sbjct:   126 ILILWYYYMINLINFILLF-VLLYYMI-LNYCFYLCDFCFL-IFDEEWLGIL---CLF-Y 178

Query:   454 IMIILFFFYKHIYIYII--FFLTYGI-IFIYAL*TFNSLYMIHIITIII 591
             I++ILF  Y  I I  +   ++  G+ IFIY L TF  L+   +I ++I
Sbjct:   179 ILLILFKLYIAILILFLEQLYIRLGVFIFIYML-TFYVLFCFILIILLI 226

 Score = 86 (30.3 bits), Expect = 2.5, P = 0.92
 Identities = 27/111 (24%), Positives = 53/111 (47%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFI---IYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             F ++F+   ++I   C +     F IF    + I+  FYI      ++I I+ + +  + 
Sbjct:   140 FILLFVLLYYMILNYCFYLCDFCFLIFDEEWLGILCLFYILLILFKLYIAILILFLEQLY 199

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
             +    F +I ++ F+    ++ +I+  L   I FIY    F  L +I  IT ++
Sbjct:   200 IRLGVFIFIYMLTFYV---LFCFILIILL--ICFIYFYIIFIKLIIIQSITCVL 248


>pir||S39059 protein BRG1 - human
            Length = 1613

  Minus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 0.0012, P = 0.0012
 Identities = 25/53 (47%), Positives = 38/53 (71%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RL G+T   +R  ++K F++     F+FLLST+AGG+GLNL +A+ VI+ D
Sbjct:  1121 YLRLAGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFD 1173


>prf||1924378A nucler protein GRB1 [Homo sapiens]
            Length = 1613

  Minus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 0.0012, P = 0.0012
 Identities = 25/53 (47%), Positives = 38/53 (71%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RL G+T   +R  ++K F++     F+FLLST+AGG+GLNL +A+ VI+ D
Sbjct:  1121 YLRLAGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFD 1173


>pir||S49618 helicase-like transcription factor - human >gi|575251 (Z46606)
            helicase-like transcription factor [Homo sapiens]
            Length = 1009

  Minus Strand HSPs:

 Score = 119 (41.9 bits), Expect = 0.0012, P = 0.0012
 Identities = 40/130 (30%), Positives = 68/130 (52%), Frame = -1

Query:   414 NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEY---NKKKKDEDDEEICLTS 244
             N+I++ D    C  E + + ++    DME +  +K     +   + +KK+ + + + ++ 
Sbjct:   802 NDIHE-DNLLECPPEELARDSE-KKSDMEWTSSSKINALMHALTDLRKKNPNIKSLVVSQ 859

Query:   243 STLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDE--NIFVFLLSTKAGGVGL 70
              T   S +     A   ++ RLDGS    +R + I+ F   E  +  + LLS +AGGVGL
Sbjct:   860 FTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLRAGGVGL 919

Query:    69 NLIAANHVILMD 34
             NL AA+ V LMD
Sbjct:   920 NLSAASRVFLMD 931


>gnl|PID|e1169985 (AJ001017) TAFII170 [Homo sapiens]
            Length = 1849

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.0014, Sum P(2) = 0.0014
 Identities = 24/52 (46%), Positives = 35/52 (67%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y+RLDGS    +R  I+ RF+ D +I V LL+T  GG+GLNL  A+ V+ ++
Sbjct:  1674 YLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVE 1725

 Score = 44 (15.5 bits), Expect = 0.0014, Sum P(2) = 0.0014
 Identities = 9/18 (50%), Positives = 12/18 (66%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALL 604
             +IF Q  + LDI+E  LL
Sbjct:  1648 LIFCQLKSMLDIVEHDLL 1665


>gi|501027 (U01849) ORF2 [Trypanosoma brucei]
           Length = 141

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.0016, P = 0.0016
 Identities = 30/109 (27%), Positives = 52/109 (47%), Frame = +1

Query:   274 IFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFI--FIPIINIIIIVIIMTFCFF 447
             IF+   +F  C       F  F+I ++ FF +F+   F   F  I+     VII+ F FF
Sbjct:    20 IFYCCFVFCFCCLFVWVCFICFVI-VVCFFLLFWVVIFYWCFDCIVYFFCDVIIL-FIFF 77

Query:   448 TYIMIILFFFYKHIYIY-IIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
              Y   +L F Y   Y+  ++FF  +  +  Y L  F   ++  ++ + ++ F
Sbjct:    78 FYF--VLCFLYCCFYLVCLVFFCIFCCVLCYFLIYFLCCFLFWVVFLFLFFF 127

 Score = 98 (34.5 bits), Expect = 0.0028, P = 0.0028
 Identities = 21/98 (21%), Positives = 45/98 (45%), Frame = +1

Query:   259 FFIIFIFFLF---IIFTICIFSSL*IF-HIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             F I+  FFL    +IF  C    +  F  + I++I +F+++       F  +  +   + 
Sbjct:    41 FVIVVCFFLLFWVVIFYWCFDCIVYFFCDVIILFIFFFYFVLCFLYCCFYLVCLVFFCIF 100

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL 543
                 C+F    +  F F+  +++++ FF  Y   +++ L
Sbjct:   101 CCVLCYFLIYFLCCFLFWV-VFLFLFFFFVYVCFYLWLL 138

 Score = 96 (33.8 bits), Expect = 0.0058, P = 0.0058
 Identities = 22/85 (25%), Positives = 46/85 (54%), Frame = +1

Query:   259 FFIIFIFFLF--IIFTICIFSSL*IFHIFIIYIIWFFYI-FFKTKFIFIPIINIIIIVII 429
             F+++  ++ F  I++  C    L IF  F  +++ F Y  F+    +F  I   ++   +
Sbjct:    51 FWVVIFYWCFDCIVYFFCDVIILFIF--FFYFVLCFLYCCFYLVCLVFFCIFCCVLCYFL 108

Query:   430 MTF-CFFTYIMIILFFFYKHIYIYIIFFL 513
             + F C F + ++ LF F+   ++Y+ F+L
Sbjct:   109 IYFLCCFLFWVVFLFLFF--FFVYVCFYL 135

 Score = 95 (33.4 bits), Expect = 0.0091, P = 0.0090
 Identities = 23/98 (23%), Positives = 47/98 (47%), Frame = +1

Query:   259 FFIIFIFFLF---IIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             F I+  FFL    +IF  C F  +  F   +I I++ F+ +F   F++     + ++   
Sbjct:    41 FVIVVCFFLLFWVVIFYWC-FDCIVYFFCDVI-ILFIFFFYFVLCFLYCCFYLVCLVFFC 98

Query:   430 MTFCFFTYIMIILF--FFYKHIYIYIIFFLTYGIIFIYAL 543
             +  C   Y +I     F +  +++++ FF  Y   +++ L
Sbjct:    99 IFCCVLCYFLIYFLCCFLFWVVFLFLFFFFVYVCFYLWLL 138

 Score = 94 (33.1 bits), Expect = 0.013, P = 0.013
 Identities = 23/90 (25%), Positives = 48/90 (53%), Frame = +1

Query:   259 FFIIFIFFLF--IIFTICIFSSL*IFHIFIIYIIWFFYI-FFKTKFIFIPIINIIIIVII 429
             F+++  ++ F  I++  C    L IF  F  +++ F Y  F+    +F  I   ++   +
Sbjct:    51 FWVVIFYWCFDCIVYFFCDVIILFIF--FFYFVLCFLYCCFYLVCLVFFCIFCCVLCYFL 108

Query:   430 MTF--CF-FTYIMIILFFFYKHI--YIYIIFF 510
             + F  CF F  + + LFFF+ ++  Y++++ F
Sbjct:   109 IYFLCCFLFWVVFLFLFFFFVYVCFYLWLLLF 140

 Score = 90 (31.7 bits), Expect = 0.052, P = 0.051
 Identities = 23/120 (19%), Positives = 59/120 (49%), Frame = +1

Query:   259 FFIIFIFFLFIIFT-ICIFSSL*IFHIFIIY-IIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             F+  F+F    +F  +C    + +   F+++ ++ F++ F    + F  +I + I     
Sbjct:    21 FYCCFVFCFCCLFVWVCFICFVIVVCFFLLFWVVIFYWCFDCIVYFFCDVIILFIFFFYF 80

Query:   433 TFCFFT---YIMIILFF--FYKHIYIYIIFFLT---YGIIFIYAL*TFNSLYMIHIITII 588
               CF     Y++ ++FF  F   +  ++I+FL    + ++F++    F  +Y+   + ++
Sbjct:    81 VLCFLYCCFYLVCLVFFCIFCCVLCYFLIYFLCCFLFWVVFLFLF--FFFVYVCFYLWLL 138

Query:   589 IY 594
             ++
Sbjct:   139 LF 140

 Score = 88 (31.0 bits), Expect = 0.096, P = 0.092
 Identities = 29/122 (23%), Positives = 54/122 (44%), Frame = +1

Query:   268 IFIFFLFIIFTIC----IFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIV---- 423
             IF FF++ +  +C    IF    +F  F    +W  +I F     F  +  ++I      
Sbjct:     3 IFFFFIWCVCVLCTVYGIFYCCFVF-CFCCLFVWVCFICFVIVVCFFLLFWVVIFYWCFD 61

Query:   424 -IIMTFCFFTYIMIILFFFYKHIYIYIIFFLT---YGIIFIYAL*TFNSLYMIHIITIII 591
              I+  FC    I+ I FF++   ++Y  F+L    +  IF   L  F   ++   +  ++
Sbjct:    62 CIVYFFCD-VIILFIFFFYFVLCFLYCCFYLVCLVFFCIFCCVLCYFLIYFLCCFLFWVV 120

Query:   592 YKFI 603
             + F+
Sbjct:   121 FLFL 124

 Score = 84 (29.6 bits), Expect = 0.35, P = 0.29
 Identities = 20/88 (22%), Positives = 41/88 (46%), Frame = +1

Query:   274 IFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTY 453
             IFF FI + +C+  +  ++ IF    ++ F   F     FI  + ++   ++     F +
Sbjct:     3 IFFFFI-WCVCVLCT--VYGIFYCCFVFCFCCLF-VWVCFICFVIVVCFFLLFWVVIFYW 58

Query:   454 IMIILFFFYKHIYIYIIFFLTYGIIFIY 537
                 + +F+  + I  IFF  + + F+Y
Sbjct:    59 CFDCIVYFFCDVIILFIFFFYFVLCFLY 86

 Score = 83 (29.2 bits), Expect = 0.46, P = 0.37
 Identities = 22/76 (28%), Positives = 40/76 (52%), Frame = +1

Query:   256 YFF----IIFIFFLFII--FTICIFSSL*-IFHIFIIYIIWFFYIFFKTKFIFIPIINII 414
             YFF    I+FIFF + +  F  C F  +  +F      ++ +F I+F   F+F  ++ + 
Sbjct:    65 YFFCDVIILFIFFFYFVLCFLYCCFYLVCLVFFCIFCCVLCYFLIYFLCCFLFW-VVFLF 123

Query:   415 IIVIIMTFCFFTYIMIILF 471
             +    +  CF  Y+ ++LF
Sbjct:   124 LFFFFVYVCF--YLWLLLF 140


>gi|1065711 (Z67884) T14G8.1 [Caenorhabditis elegans]
            Length = 1744

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.0017, P = 0.0017
 Identities = 31/86 (36%), Positives = 45/86 (52%), Frame = -1

Query:   288 KKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKD-ENI 112
             +K KD     +  +  T+    +    D     Y R+DGS    +RQ  I R++      
Sbjct:   950 RKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQ 1009

Query:   111 FVFLLSTKAGGVGLNLIAANHVILMD 34
             FVFLLST+AGG+G+NL  A+ VI+ D
Sbjct:  1010 FVFLLSTRAGGLGINLATADTVIIYD 1035


>sp|P31244|RA16_YEAST DNA REPAIR PROTEIN RAD16 >pir||S25366 DNA repair protein
            RAD16 - yeast (Saccharomyces cerevisiae) >gi|3551 (X66247) excision
            repair protein [Saccharomyces cerevisiae] >gi|476069 (X78993) UV
            damage repair protein [Saccharomyces cerevisiae] >gi|487900
            (M86929) RAD16 [Saccharomyces cerevisiae] >gi|536453 (Z35983) ORF
            YBR114w [Saccharomyces cerevisiae]
            Length = 790

  Minus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 26/57 (45%), Positives = 35/57 (61%), Frame = -1

Query:   204 AGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             AG Q  V+L GS +  +R + IK F  +    VFL+S KAGGV LNL  A+ V ++D
Sbjct:   660 AGFQT-VKLQGSMSPTQRDETIKYFMNNIQCEVFLVSLKAGGVALNLCEASQVFILD 715

 Score = 48 (16.9 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 26/105 (24%), Positives = 49/105 (46%), Frame = -1

Query:   540 SINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIK 361
             ++  + T+  + N+ NVN    +++ Y D     K  DD++ + I D   +    KE  +
Sbjct:    30 AVKNSKTLQLKGNSENVND--SQDEEYRDDATLVKSPDDDDKDFIIDLTGSD---KE--R 82

Query:   360 KPNDIYNEDMENSERTKDTNCEYN--KKKKDEDDEEICLTSSTLSTS 226
                D      EN+   K+ N E    K+++D  D++  LT    +T+
Sbjct:    83 TATD------ENTHAIKNDNDEIIEIKEERDVSDDDEPLTKKRKTTA 123


>pir||E22845 hypothetical protein 4 - Trypanosoma brucei mitochondrion (SGC6)
            Length = 445

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0020, P = 0.0020
 Identities = 38/116 (32%), Positives = 60/116 (51%), Frame = +1

Query:   274 IFFLFIIFTICIFSSL*IFHIFIIYIIWF--FYIF--FKTKFIFIPIINIIIIVIIMTFC 441
             ++ L  +F I +  S   F   ++++  F  F+ F  F T+F+FI II  I  +II  F 
Sbjct:    39 LWLLINLFWITLLDSYICFIFILLFLFCFTLFFCFLSFDTRFLFIIII--IQYIIIFLFI 96

Query:   442 FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGLLY 621
             F  +I+II   F   I+  ++F L     F Y +      YM+++I  I+  FI   LLY
Sbjct:    97 FINHIIIISILF--EIFSLLLFLLLMSSRFGYKILVLWYYYMLNLINFILL-FI---LLY 150

 Score = 113 (39.8 bits), Expect = 0.0020, P = 0.0020
 Identities = 36/123 (29%), Positives = 62/123 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHI---FIIYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             F I+F+  L+I   + IF  +  F+I   FI+ I+   +I+F   FI + +      V+I
Sbjct:   192 FLILFMEQLYIRLGVFIFIYMLTFYILFCFILIILLISFIYFYILFIKLLLFQSCTCVLI 251

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIIT-IIIYKFI* 606
                 F    ++ +       ++++IF  T   IF Y    F+ +Y I ++  IIIY F  
Sbjct:   252 GLNSFAIVSLLFVLSVNNFCFLFLIFISTKNYIF-YLYLNFHLIYSISLVLLIIIYYFF- 309

Query:   607 QGLLYNI 627
               ++YNI
Sbjct:   310 --IIYNI 314

 Score = 107 (37.7 bits), Expect = 0.0099, P = 0.0098
 Identities = 35/125 (28%), Positives = 63/125 (50%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYI---FFKTKFIFIPIINIII 417
             +K Y F +++ F  +I++I +   + I++ FIIY I+ F     +F   FIF    N  +
Sbjct:   280 TKNYIFYLYLNF-HLIYSISLVLLIIIYYFFIIYNIFDFKYNENYFLINFIFFSFFNNFL 338

Query:   418 IVIIMTFCFFTYI--MIILFFFYKHIYIYIIFFLTY-----GIIFIYAL*TFNSLYMIHI 576
             I +++  C F  I  + I+F F+  ++  ++  L+Y     G  FI  L      Y   I
Sbjct:   339 ISLLLA-CLFLCIGAIPIVFGFFIKVFC-LLLQLSYLCICIGFFFIIWLIIIYIFYFRLI 396

Query:   577 ITIIIYKF 600
             + I I+ +
Sbjct:   397 VNIFIFSY 404

 Score = 105 (37.0 bits), Expect = 0.017, P = 0.017
 Identities = 32/124 (25%), Positives = 69/124 (55%), Frame = +1

Query:   256 YFFII-FIFFL----FIIFT------ICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPI 402
             YF I+ + FFL    F++F       +C+F +L I  +F +YI  F  +F +  +I + +
Sbjct:   150 YFMILNYCFFLCDFCFLVFDEEWLGILCLFYTLLI--LFKLYIA-FLILFMEQLYIRLGV 206

Query:   403 -INIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHII 579
              I I ++   + FCF   I++I F ++  ++I ++ F +   + I  L +F  + ++ ++
Sbjct:   207 FIFIYMLTFYILFCFILIILLISFIYFYILFIKLLLFQSCTCVLI-GLNSFAIVSLLFVL 265

Query:   580 TIIIYKFI 603
             ++  + F+
Sbjct:   266 SVNNFCFL 273

 Score = 104 (36.6 bits), Expect = 0.022, P = 0.022
 Identities = 34/124 (27%), Positives = 63/124 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*I-FHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             ++ ++ +F L+I F I     L I   +FI   +  FYI F     FI    +II++I  
Sbjct:   179 FYTLLILFKLYIAFLILFMEQLYIRLGVFIFIYMLTFYILF----CFI----LIILLISF 230

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIIT--IIIYKFI* 606
              + +  +I ++LF     + I +  F    ++F+ ++  F  L++I I T   I Y ++ 
Sbjct:   231 IYFYILFIKLLLFQSCTCVLIGLNSFAIVSLLFVLSVNNFCFLFLIFISTKNYIFYLYLN 290

Query:   607 QGLLYNI 627
               L+Y+I
Sbjct:   291 FHLIYSI 297

 Score = 103 (36.3 bits), Expect = 0.029, P = 0.028
 Identities = 28/98 (28%), Positives = 52/98 (53%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFII-YIIWFFYIFFKTKFIF---IPIINIIIIVI 426
             F ++F+F   + F    F +  +F I II YII F +IF     I      I ++++ ++
Sbjct:    59 FILLFLFCFTLFFCFLSFDTRFLFIIIIIQYIIIFLFIFINHIIIISILFEIFSLLLFLL 118

Query:   427 IMTFCFFTYIMIILFFFY--KHIYIYIIFFLTYGIIFIY 537
             +M+   F Y +++L+++Y    I   ++F L Y +I  Y
Sbjct:   119 LMS-SRFGYKILVLWYYYMLNLINFILLFILLYFMILNY 156

 Score = 98 (34.5 bits), Expect = 0.11, P = 0.10
 Identities = 33/113 (29%), Positives = 60/113 (53%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHI-FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFC 441
             II I  LF IF++ +F  L      + I ++W++Y+     FI   ++ I++  +I+ +C
Sbjct:   101 IIIISILFEIFSLLLFLLLMSSRFGYKILVLWYYYMLNLINFI---LLFILLYFMILNYC 157

Query:   442 FFTYIMIILFFFYKHIYIYIIFFLTYGIIF-IYAL*TFNSLYMIHI-ITIIIYKFI 603
             FF      L F  + + I  +F+ T  I+F +Y    F  L+M  + I + ++ FI
Sbjct:   158 FFLCDFCFLVFDEEWLGILCLFY-TLLILFKLYI--AFLILFMEQLYIRLGVFIFI 210

 Score = 95 (33.4 bits), Expect = 0.24, P = 0.21
 Identities = 31/94 (32%), Positives = 50/94 (53%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFSSL*IFH---IFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             +I FIF L  +F   +F     F    +FII II +  IF    FIFI  I III ++  
Sbjct:    54 YICFIFILLFLFCFTLFFCFLSFDTRFLFIIIIIQYIIIFL---FIFINHI-IIISILFE 109

Query:   433 TFCFFTYIMIILFFF-YKHI---YIYIIFFLTYGIIFI 534
              F    +++++   F YK +   Y Y++  + + ++FI
Sbjct:   110 IFSLLLFLLLMSSRFGYKILVLWYYYMLNLINFILLFI 147

 Score = 93 (32.7 bits), Expect = 0.40, P = 0.33
 Identities = 31/116 (26%), Positives = 61/116 (52%), Frame = +1

Query:   247 SKTYFFIIFIFFLFII-FTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIV 423
             ++ YF I FIFF F   F I +  +     I  I I++ F+I    K +F  ++ +  + 
Sbjct:   320 NENYFLINFIFFSFFNNFLISLLLACLFLCIGAIPIVFGFFI----K-VFCLLLQLSYLC 374

Query:   424 IIMTFCFFTYIMIILFFFYK---HIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             I + F F  +++II  F+++   +I+I+   FL + ++ +  +   N L+ I     I++
Sbjct:   375 ICIGFFFIIWLIIIYIFYFRLIVNIFIFSYQFLGFWVVKLSFINIKNLLFFICSSVYILF 434

 Score = 93 (32.7 bits), Expect = 0.40, P = 0.33
 Identities = 30/129 (23%), Positives = 57/129 (44%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             + +II IF   II++  I        +    ++W     F     +I +++  I  I + 
Sbjct:     7 FLYIIHIFIFLIIYSFIILCDYTTLTLLSFDLLWLLINLF-----WITLLDSYICFIFIL 61

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGL 615
                F + +   F  +   +++II  + Y IIF++       +++ HII I I   I   L
Sbjct:    62 LFLFCFTLFFCFLSFDTRFLFIIIIIQYIIIFLF-------IFINHIIIISILFEIFSLL 114

Query:   616 LYNIKKSSK 642
             L+ +  SS+
Sbjct:   115 LFLLLMSSR 123

 Score = 89 (31.3 bits), Expect = 1.2, P = 0.68
 Identities = 43/150 (28%), Positives = 69/150 (46%), Frame = +1

Query:   109 KYIFIF*KTFYDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTY-------FFI 267
             +YI IF   F + +   S+   I S   L+  ++L ++R G K      Y       F +
Sbjct:    88 QYIIIFLFIFINHIIIISILFEIFS---LLLFLLLMSSRFGYKILVLWYYYMLNLINFIL 144

Query:   268 IFIFFLFIIFTICIFSSL*IFHIFI---IYIIWFFY---IFFKTKFIFIPI--------I 405
             +FI   F+I   C F     F +F    + I+  FY   I FK    F+ +        +
Sbjct:   145 LFILLYFMILNYCFFLCDFCFLVFDEEWLGILCLFYTLLILFKLYIAFLILFMEQLYIRL 204

Query:   406 NIIIIVIIMTF-CFFTYIMIILFFFYKHIYIYIIF 507
              + I + ++TF   F +I+IIL   +  IY YI+F
Sbjct:   205 GVFIFIYMLTFYILFCFILIILLISF--IYFYILF 237

 Score = 86 (30.3 bits), Expect = 2.5, P = 0.92
 Identities = 25/94 (26%), Positives = 51/94 (54%), Frame = +1

Query:   256 YFFIIFIFFLFIIF-TICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             + F   +FF F+ F T  +F  + I +I I   I+  +I   +  I   I ++++ +++M
Sbjct:    63 FLFCFTLFFCFLSFDTRFLFIIIIIQYIIIFLFIFINHIIIIS--ILFEIFSLLLFLLLM 120

Query:   433 TFCFFTYIMIILFFFY--KHIYIYIIFFLTYGIIFIY 537
             +   F Y +++L+++Y    I   ++F L Y +I  Y
Sbjct:   121 S-SRFGYKILVLWYYYMLNLINFILLFILLYFMILNY 156

 Score = 85 (29.9 bits), Expect = 3.3, P = 0.96
 Identities = 28/112 (25%), Positives = 50/112 (44%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHI----FIIYIIWFFYIFFKTKFIFIPIINIIIIV 423
             YF+I+FI  L      C+   L  F I    F++ +  F ++F     IFI   N I  +
Sbjct:   232 YFYILFIKLLLFQSCTCVLIGLNSFAIVSLLFVLSVNNFCFLFL----IFISTKNYIFYL 287

Query:   424 IIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
              +     ++  +++L   Y    IY IF   Y   +      F S +   +I++++
Sbjct:   288 YLNFHLIYSISLVLLIIIYYFFIIYNIFDFKYNENYFLINFIFFSFFNNFLISLLL 343

 Score = 83 (29.2 bits), Expect = 5.5, P = 1.0
 Identities = 32/108 (29%), Positives = 57/108 (52%), Frame = +1

Query:   280 FLFIIFTICIFSSL*IFHIFIIYIIWFF----YIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             F + I  +  +  L + +  +++I+ +F    Y FF   F F+ + +   + I+   C F
Sbjct:   124 FGYKILVLWYYYMLNLINFILLFILLYFMILNYCFFLCDFCFL-VFDEEWLGIL---CLF 179

Query:   448 TYIMIILFFFYKHIYIYII--FFLTYGI-IFIYAL*TFNSLYMIHIITIIIYKFI 603
              Y ++ILF  Y    I  +   ++  G+ IFIY L TF  L+   I+ I++  FI
Sbjct:   180 -YTLLILFKLYIAFLILFMEQLYIRLGVFIFIYML-TFYILFCF-ILIILLISFI 231

 Score = 83 (29.2 bits), Expect = 5.5, P = 1.0
 Identities = 39/163 (23%), Positives = 70/163 (42%), Frame = +1

Query:   109 KYIFIF*KTFYDFLSFNSVC*SIQSYINLMTCVILCTNR*GRKSR*SKTY-------FFI 267
             +YI IF   F + +   S+   I S   L+  ++L ++R G K      Y       F +
Sbjct:    88 QYIIIFLFIFINHIIIISILFEIFS---LLLFLLLMSSRFGYKILVLWYYYMLNLINFIL 144

Query:   268 IFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             +FI   F+I   C F     F +F    +    +F+    +F   I  +I+ +   +   
Sbjct:   145 LFILLYFMILNYCFFLCDFCFLVFDEEWLGILCLFYTLLILFKLYIAFLILFMEQLYIRL 204

Query:   448 -TYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
               +I I +  FY  ++ +I+  L    I+ Y L  F  L +    T ++
Sbjct:   205 GVFIFIYMLTFYI-LFCFILIILLISFIYFYIL--FIKLLLFQSCTCVL 250

 Score = 81 (28.5 bits), Expect = 9.3, P = 1.0
 Identities = 32/102 (31%), Positives = 49/102 (48%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFS-SL*IFHIFIIYIIWF--FYIFFKTKFIFIPI--INIIIIVII 429
             +I I++ FII+ I  F  +   F I  I+  +F  F I      +F+ I  I I+    I
Sbjct:   302 LIIIYYFFIIYNIFDFKYNENYFLINFIFFSFFNNFLISLLLACLFLCIGAIPIVFGFFI 361

Query:   430 MTFCFF---TYIMIILFFFYKH--IYIYIIFFLTYGIIFIYA 540
               FC     +Y+ I + FF+    I IYI +F     IFI++
Sbjct:   362 KVFCLLLQLSYLCICIGFFFIIWLIIIYIFYFRLIVNIFIFS 403


>pir||F30010 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 443

  Plus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.0026, P = 0.0026
 Identities = 34/115 (29%), Positives = 58/115 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             YF  + +FFL  + +  + S    F+I + YI    +IFF    I + I + +  +I+  
Sbjct:    57 YFMGLIVFFLIFLLSRKLVSYSKYFYILLSYI----FIFFDVTLIIL-IDDFMCFMILFE 111

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
               FF    + LFF + + +I+ IF+L   +IF     + +S+  I I  III+ F
Sbjct:   112 SLFFPICFVSLFFNFNNRFIFAIFYL---VIFS----SLSSIMCIIICIIIIFHF 159

 Score = 93 (32.7 bits), Expect = 0.40, P = 0.33
 Identities = 27/90 (30%), Positives = 41/90 (45%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F    I F  + F IC  S    F+   I+ I++  IF     I   II IIII      
Sbjct:   103 FMCFMILFESLFFPICFVSLFFNFNNRFIFAIFYLVIFSSLSSIMCIIICIIIIFHFNIL 162

Query:   439 CFFTYIMIILF-FFYKHIYIYIIFFLTYGI 525
                ++I I +F   Y  +Y++I+ F+ + I
Sbjct:   163 NLQSFIDICIFDSLYLGLYVWILLFIMFSI 192

 Score = 93 (32.7 bits), Expect = 0.40, P = 0.33
 Identities = 36/109 (33%), Positives = 57/109 (52%), Frame = +1

Query:   274 IFFLFI-IFTICIFSSL*IFHIFIIYIIW-FFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             IF + I  F I I+SSL    IF+  I + F  +F+   F+   +I++  I I    CF+
Sbjct:   329 IFLMLISFFGISIWSSL-FLGIFLFNIDFPFMLLFYIDIFLLYGLISLSFIYIC---CFY 384

Query:   448 TYIMIILFFFYKHIYIYIIFFLTYGIIFI--YAL*--TFNSLYMIHIITIIIYKF 600
                +I+L  F   IY+Y+     Y  I++  Y     T N +Y+  I +II+  F
Sbjct:   385 ---IIVLAVFLSSIYMYMCLSF-YSFIWLDKYLRLDLTINDIYLYFITSIIVILF 435

 Score = 82 (28.9 bits), Expect = 7.1, P = 1.0
 Identities = 29/124 (23%), Positives = 62/124 (50%), Frame = +1

Query:   259 FFIIFIF--FLFIIFTICI---FSSL*IFHIFIIYI-IWFFY-----IFFKTKFIFIPII 405
             F ++F+    +FI ++ C+   F+ + I +I++ YI +WF Y     +FF    +   ++
Sbjct:    17 FILLFLIVTLIFINYSFCLALQFNYIYI-NIYLNYINLWFIYFMGLIVFFLIFLLSRKLV 75

Query:   406 NI---IIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHI 576
             +      I++   F FF   +IIL   +   ++ +   L + I F+     FN+ ++  I
Sbjct:    76 SYSKYFYILLSYIFIFFDVTLIILIDDFM-CFMILFESLFFPICFVSLFFNFNNRFIFAI 134

Query:   577 ITIIIY 594
               ++I+
Sbjct:   135 FYLVIF 140


>gnl|PID|e275074 (X98455) SNF [Bacillus cereus]
            Length = 1064

  Minus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0030, Sum P(2) = 0.0030
 Identities = 26/52 (50%), Positives = 35/52 (67%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y  LDG+T + ER ++  RF++ E   +FL+S KAGG GLNL  A+ VIL D
Sbjct:   939 YFYLDGNTPSQERVELCNRFNEGEGD-LFLISLKAGGTGLNLTGADTVILYD 989

 Score = 44 (15.5 bits), Expect = 0.0030, Sum P(2) = 0.0030
 Identities = 10/17 (58%), Positives = 11/17 (64%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEAL 607
             +IFSQFT  L II   L
Sbjct:   916 LIFSQFTKMLSIIGREL 932


>pir||S67083 hypothetical protein YOR191w - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e252066 (Z75099) ORF YOR191w [Saccharomyces cerevisiae]
            Length = 1619

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.0035, P = 0.0035
 Identities = 35/118 (29%), Positives = 60/118 (50%), Frame = -1

Query:   375 KENIKKPNDIYNEDMENSE-RTKDTNC-EYNKKKKDEDDEEICLTSSTLSTSSVGTQNDA 202
             K+ I++ N +Y  + E+ E  TK   C +  ++  DE   E  +  S  +T     ++  
Sbjct:  1423 KQKIQQKN-VYVPNFESLEPSTKIEQCIQVIQRVFDESATEKIIIFSQFTTFFEILEHFL 1481

Query:   201 GHQI---YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
              +++   Y++  GS N   R  +I  F +D    + L+S KAG  GL L  ANHV+++D
Sbjct:  1482 KNKLNFPYLKYIGSMNAQRRSDVINEFYRDPEKRILLISMKAGNSGLTLTCANHVVIVD 1540


>sp|P14546|COX3_LEITA CYTOCHROME C OXIDASE POLYPEPTIDE III >pir||G22848
            cytochrome-c oxidase (EC 1.9.3.1) chain III - Sauroleishmania
            tarentolae mitochondrion (SGC6)
            Length = 284

  Plus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.0035, P = 0.0035
 Identities = 22/91 (24%), Positives = 54/91 (59%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIW------FFYIFFKTKFIFIPIINIIIIVI 426
             ++F+   +++F++ +F S+    +F+I +++      F ++F+   + FI I N++I   
Sbjct:    95 LLFLSLFYVVFSLVLFVSVEFAFVFVIPVMFSCLICDFGFVFY---WYFIDIFNLLINTF 151

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIF 531
             ++ F    ++  +LF F+   ++ ++F L  GI+F
Sbjct:   152 LL-FVSGLFVNFVLFLFWFRFFLCVLFMLWVGILF 185


>gi|340588 (L07539) cytochrome oxidase [Leishmania tarentolae]
           Length = 287

  Plus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.0036, P = 0.0036
 Identities = 22/91 (24%), Positives = 54/91 (59%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIW------FFYIFFKTKFIFIPIINIIIIVI 426
             ++F+   +++F++ +F S+    +F+I +++      F ++F+   + FI I N++I   
Sbjct:    98 LLFLSLFYVVFSLVLFVSVEFAFVFVIPVMFSCLICDFGFVFY---WYFIDIFNLLINTF 154

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIF 531
             ++ F    ++  +LF F+   ++ ++F L  GI+F
Sbjct:   155 LL-FVSGLFVNFVLFLFWFRFFLCVLFMLWVGILF 188


>gnl|PID|e276379 (Y08924) AARP2 protein [Plasmodium falciparum]
            Length = 1360

  Minus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0037, P = 0.0037
 Identities = 50/193 (25%), Positives = 87/193 (45%), Frame = -1

Query:   627 DIIEEAL--LYEFIYDDSDYMDHIQTIKSSQS---INKNDTICKEE---NNINVNVFIKE 472
             DI+E+     Y F+ +D+ Y D + T +S +    I  N +I   +   +NI  N F + 
Sbjct:   819 DIVEDKKRGCYSFMNEDNYYYDKLDTFRSDEEDIFIFNNLSISLYDIVDSNIVDNFFSRY 878

Query:   471 EQNYHDIGKETKRH--------DDNNNNN------INDGDENKFCFKENIKKPNDIYNED 334
             ++ Y    K  KR         DDNNNNN      IN  D N +    N    ++  N D
Sbjct:   879 DKVYRMFFKNRKRGNMGINSEGDDNNNNNSDDDNNINSDDNNNYSDDNNSNSDDNNSNSD 938

Query:   333 MENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIE 154
              +N+  + D N   +    + DD  I   S   +      + + G++I ++   +   ++
Sbjct:   939 -DNNSNSDDNNSNSDDNNINSDDNNI--NSGDDNNLKDKDKGNIGNEINIK--ENLKKLK 993

Query:   153 RQKIIKR--FSKDENIFV 106
              +K+I++  F + E I V
Sbjct:   994 EEKLIEKEKFRETEKIGV 1011

 Score = 109 (38.4 bits), Expect = 0.024, P = 0.024
 Identities = 45/175 (25%), Positives = 77/175 (44%), Frame = -1

Query:   627 DIIEEAL--LYEFIYDDSDYMDHIQTIKSSQS---INKNDTICKEE---NNINVNVFIKE 472
             DI+E+     Y F+ +D+ Y D + T +S +    I  N +I   +   +NI  N F + 
Sbjct:   819 DIVEDKKRGCYSFMNEDNYYYDKLDTFRSDEEDIFIFNNLSISLYDIVDSNIVDNFFSRY 878

Query:   471 EQNYHDIGKETKRH--------DDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSER 316
             ++ Y    K  KR         DDNNNNN +D D+N     +N    +D  +   +N+  
Sbjct:   879 DKVYRMFFKNRKRGNMGINSEGDDNNNNN-SD-DDNNINSDDNNNYSDDNNSNSDDNNSN 936

Query:   315 TKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIK 136
             + D N   +    + DD  I    + +++   G  N+   +    +    N  E  K +K
Sbjct:   937 SDDNNSNSDDNNSNSDDNNINSDDNNINS---GDDNNLKDKDKGNIGNEINIKENLKKLK 993

 Score = 100 (35.2 bits), Expect = 0.25, P = 0.22
 Identities = 31/127 (24%), Positives = 67/127 (52%), Frame = -1

Query:   615 EALLYEFIYDDSDYM--DHIQTIKSSQSINKNDTICKE-ENNINVNVFIKEEQNYHDI-- 451
             E++LYE   +D +Y   +++ TI S     +ND   +E      +N  + ++   +DI  
Sbjct:   552 ESILYEKKNNDEEYYCANNV-TISSDDDKEENDASFREFYRKYGLNADMSDDGGNNDINI 610

Query:   450 --GKETKRHDDNNNNNINDG--DENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKK 283
               G+E++    +  + + DG  DE+ +   EN+   ND  ++D EN +  ++ + E +  
Sbjct:   611 YNGQESEEKLKDTYDKLIDGGDDEDDYDDDENVGDENDDDDDDDENDDDKENDDDENDDD 670

Query:   282 KKDEDDEE 259
             ++++DD++
Sbjct:   671 EENDDDDD 678

 Score = 96 (33.8 bits), Expect = 0.71, P = 0.51
 Identities = 37/131 (28%), Positives = 61/131 (46%), Frame = -1

Query:   615 EALLYEFIYDDSDYM-DHIQTIKSSQSINKNDTICKE-ENNINVNVFIKEEQNYHDI--- 451
             E++LYE   +D +Y   +  TI S     +ND   +E      +N  + ++   +DI   
Sbjct:   552 ESILYEKKNNDEEYYCANNVTISSDDDKEENDASFREFYRKYGLNADMSDDGGNNDINIY 611

Query:   450 -GKETKRHDDNNNNNINDG--DENKFCFKENIKKPNDIYNEDMENS---ERTKDTNC--E 295
              G+E++    +  + + DG  DE+ +   EN+   ND  ++D EN    E   D N   E
Sbjct:   612 NGQESEEKLKDTYDKLIDGGDDEDDYDDDENVGDENDDDDDDDENDDDKENDDDENDDDE 671

Query:   294 YNKKKKDEDDE 262
              N    D+DDE
Sbjct:   672 ENDDDDDDDDE 682

 Score = 95 (33.4 bits), Expect = 0.93, P = 0.61
 Identities = 51/184 (27%), Positives = 81/184 (44%), Frame = -1

Query:   654 IFSQFTTFL-DIIEEALLYEFI--YDDSDYMDHIQTIKSSQSINK-----NDTICKEENN 499
             IF+  +  L DI++  ++  F   YD    M      + +  IN      N+    ++NN
Sbjct:   854 IFNNLSISLYDIVDSNIVDNFFSRYDKVYRMFFKNRKRGNMGINSEGDDNNNNNSDDDNN 913

Query:   498 INVNVFIKEEQNYHDIGKETKRHDDNNNN----NINDGDENKFCFKENIKKPNDIYNEDM 331
             IN +    +  NY D        DDNN+N    N N  D N      NI   ++  N   
Sbjct:   914 INSD----DNNNYSD--DNNSNSDDNNSNSDDNNSNSDDNNSNSDDNNINSDDNNINSGD 967

Query:   330 ENSERTKDT-NC--EYNKKK--KDEDDEEICLTSSTLSTSSVGTQNDA-GHQI----YVR 181
             +N+ + KD  N   E N K+  K   +E++        T  +G  N   G  +    YVR
Sbjct:   968 DNNLKDKDKGNIGNEINIKENLKKLKEEKLIEKEKFRETEKIGVLNSGYGSSVNVGEYVR 1027

Query:   180 LDGSTNTIERQKI 142
             ++   N IE++K+
Sbjct:  1028 IE--LN-IEKKKL 1037

 Score = 92 (32.4 bits), Expect = 2.0, P = 0.87
 Identities = 37/119 (31%), Positives = 59/119 (49%), Frame = -1

Query:   615 EALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETK 436
             E++LYE   +D +Y        ++ +I+ +D   KEEN+ +   F      Y   G    
Sbjct:   552 ESILYEKKNNDEEYY-----CANNVTISSDDD--KEENDASFREF------YRKYGLNAD 598

Query:   435 RHDDNNNNNIN--DGDENKFCFKENIKK------PNDIYNEDMEN--SERTKDTNCEYNK 286
               DD  NN+IN  +G E++   K+   K        D Y++D EN   E   D + + N 
Sbjct:   599 MSDDGGNNDINIYNGQESEEKLKDTYDKLIDGGDDEDDYDDD-ENVGDENDDDDDDDEND 657

Query:   285 KKKDEDDEE 259
               K+ DD+E
Sbjct:   658 DDKENDDDE 666

 Score = 91 (32.0 bits), Expect = 2.6, P = 0.93
 Identities = 41/158 (25%), Positives = 73/158 (46%), Frame = -1

Query:   555 IKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH--------DDNNNNN--- 409
             I ++ SI+  D +   ++NI  N F + ++ Y    K  KR         DDNNNNN   
Sbjct:   854 IFNNLSISLYDIV---DSNIVDNFFSRYDKVYRMFFKNRKRGNMGINSEGDDNNNNNSDD 910

Query:   408 ---INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSST 238
                IN  D N +    N    ++  N D +N+  + D N   +    + DD  I   S  
Sbjct:   911 DNNINSDDNNNYSDDNNSNSDDNNSNSD-DNNSNSDDNNSNSDDNNINSDDNNI--NSGD 967

Query:   237 LSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKR--FSKDENIFV 106
              +      + + G++I ++   +   ++ +K+I++  F + E I V
Sbjct:   968 DNNLKDKDKGNIGNEINIK--ENLKKLKEEKLIEKEKFRETEKIGV 1011

 Score = 87 (30.6 bits), Expect = 7.4, P = 1.0
 Identities = 31/128 (24%), Positives = 61/128 (47%), Frame = -1

Query:   486 VFIKEEQNYHDIGKETKRHDDNNNN-----NINDGDENKFCFKENIKKPNDIYNEDMENS 322
             +F K  +   ++G  ++  D+NNNN     NIN  D N +    N    ++  N D +N+
Sbjct:   884 MFFKNRKR-GNMGINSEGDDNNNNNSDDDNNINSDDNNNYSDDNNSNSDDNNSNSD-DNN 941

Query:   321 ERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKI 142
               + D N   +    + DD  I   S   +      + + G++I ++   +   ++ +K+
Sbjct:   942 SNSDDNNSNSDDNNINSDDNNI--NSGDDNNLKDKDKGNIGNEINIK--ENLKKLKEEKL 997

Query:   141 IKR--FSKDENIFV 106
             I++  F + E I V
Sbjct:   998 IEKEKFRETEKIGV 1011

 Score = 87 (30.6 bits), Expect = 7.4, P = 1.0
 Identities = 37/139 (26%), Positives = 61/139 (43%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             D+  Y+    +IK  + + K++ +  ++   N+ +F +   NY   G    R    +N  
Sbjct:   472 DNEKYIT--DSIKMIRELQKSNGVFSKQQKDNLILFNETNDNY---GASNIRRKAPSNVY 526

Query:   408 INDGDENKFCFKENIKKPNDIY-NEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLS 232
             I++        K+  KK  D Y NE  E  E  K  +  Y KK  DE  E  C  + T+S
Sbjct:   527 ISE--------KQKKKKQQDSYVNEKAE--EYNKLESILYEKKNNDE--EYYCANNVTIS 574

Query:   231 TSSVGTQNDAGHQIYVRLDG 172
             +     +NDA  + + R  G
Sbjct:   575 SDDDKEENDASFREFYRKYG 594


>pir||I50372 ORF2 - chicken >gnl|PID|d1003771 (D14316) ORF2 [Gallus gallus]
            Length = 560

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.0039, Sum P(2) = 0.0039
 Identities = 22/53 (41%), Positives = 35/53 (66%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             + RLDGS     R++ +  F+ +    F FLLST+AGG+G+NL +A+ V++ D
Sbjct:    79 FQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFD 131

 Score = 48 (16.9 bits), Expect = 0.0039, Sum P(2) = 0.0039
 Identities = 12/28 (42%), Positives = 16/28 (57%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY-EFIYDDSD 577
             +IFSQ    LDI+ E L Y +F +   D
Sbjct:    56 LIFSQMVRMLDILAEYLKYRQFPFQRLD 83


>gi|1107696 (X86691) Mi-2 protein [Homo sapiens]
            Length = 1912

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.0040, Sum P(2) = 0.0040
 Identities = 25/53 (47%), Positives = 33/53 (62%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R+DG      RQ+ I RF+      F FLLST+AGG+G+NL  A+ VI+ D
Sbjct:  1093 YERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYD 1145

 Score = 54 (19.0 bits), Expect = 0.0040, Sum P(2) = 0.0040
 Identities = 12/28 (42%), Positives = 19/28 (67%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLYE-FIYDDSD 577
             +IFSQ T  LD++E+ L +E + Y+  D
Sbjct:  1070 LIFSQMTKMLDLLEDFLEHEGYKYERID 1097


>pir||I64201 helicase (mot1) homolog - Mycoplasma genitalium (SGC3) >gi|1045687
            (U39680) helicase [Mycoplasma genitalium]
            Length = 427

  Minus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0042, P = 0.0042
 Identities = 50/170 (29%), Positives = 76/170 (44%), Frame = -1

Query:   531 KNDTICKEENNINVNVFIK---EEQNYHDI----G-KETKRHDDNNNNNINDG--DENKF 382
             KN  + +    I  +++++   E Q  +D     G KE K  D  N  NI          
Sbjct:   184 KNKVLKELPKKIITDIYVELSEEHQKLYDKQKTDGLKEIKESDAKNALNILSLILKLRHI 243

Query:   381 CFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDA 202
             C   ++ K ND+ N+  +NS+     N  Y      E+  ++ L +  L       Q   
Sbjct:   244 C---SLVKDNDV-NDFEDNSKANAALNIIYEAL---ENKRKVILFTQFLDVIDCFKQTLK 296

Query:   201 GHQI-YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
               +I ++  DG      R  II++F+  +   V L S KAGGVG+NL AA  VI  D
Sbjct:   297 NQKIDHLVFDGRKTVKNRNTIIQKFNSAKEPCVMLASLKAGGVGINLTAAEVVIHFD 353


>gi|172320 (M83553) excision repair protein [Saccharomyces cerevisiae]
           Length = 392

  Minus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0048, P = 0.0048
 Identities = 26/57 (45%), Positives = 35/57 (61%), Frame = -1

Query:   204 AGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             AG Q  V+L GS +  +R + IK F  +    VFL+S KAGGV LNL  A+ V ++D
Sbjct:   262 AGFQT-VKLQGSMSPTQRDETIKYFMNNIQCEVFLVSLKAGGVALNLCEASQVFILD 317


>sp|P47264|Y018_MYCGE HYPOTHETICAL HELICASE MG018
            Length = 496

  Minus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0052, P = 0.0052
 Identities = 50/170 (29%), Positives = 76/170 (44%), Frame = -1

Query:   531 KNDTICKEENNINVNVFIK---EEQNYHDI----G-KETKRHDDNNNNNINDG--DENKF 382
             KN  + +    I  +++++   E Q  +D     G KE K  D  N  NI          
Sbjct:   253 KNKVLKELPKKIITDIYVELSEEHQKLYDKQKTDGLKEIKESDAKNALNILSLILKLRHI 312

Query:   381 CFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDA 202
             C   ++ K ND+ N+  +NS+     N  Y      E+  ++ L +  L       Q   
Sbjct:   313 C---SLVKDNDV-NDFEDNSKANAALNIIYEAL---ENKRKVILFTQFLDVIDCFKQTLK 365

Query:   201 GHQI-YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
               +I ++  DG      R  II++F+  +   V L S KAGGVG+NL AA  VI  D
Sbjct:   366 NQKIDHLVFDGRKTVKNRNTIIQKFNSAKEPCVMLASLKAGGVGINLTAAEVVIHFD 422


>pir||S41482 rad8 protein - fission yeast (Schizosaccharomyces pombe)
            Length = 179

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.0067, P = 0.0067
 Identities = 19/31 (61%), Positives = 24/31 (77%), Frame = -1

Query:   123 DENIFVFLLSTKAGGVGLNLIAANHVILMDQ 31
             D ++ V ++S KAGGVGLNL  ANHV +MDQ
Sbjct:   131 DPDVNVLIISLKAGGVGLNLTCANHVFIMDQ 161


>gnl|PID|e347760 (Z73102) F54E12.2 [Caenorhabditis elegans]
            Length = 155

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.010, P = 0.010
 Identities = 20/53 (37%), Positives = 32/53 (60%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDEN-IFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y  + G     +RQ+ +  F++++    V LLS  AGGVGLNL   NH++++D
Sbjct:    24 YTSITGQVLVKDRQERVDSFNREKGGARVMLLSLAAGGVGLNLTGGNHLVMVD 76


>gi|2501846 (AF004397) chromo-helicase-DNA-binding on the Z chromosome protein
            [Gallus gallus]
            Length = 1808

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.011, Sum P(2) = 0.011
 Identities = 22/53 (41%), Positives = 35/53 (66%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             + RLDGS     R++ +  F+ +    F FLLST+AGG+G+NL +A+ V++ D
Sbjct:   828 FQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFD 880

 Score = 55 (19.4 bits), Expect = 0.011, Sum P(2) = 0.011
 Identities = 14/46 (30%), Positives = 25/46 (54%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDA 202
             ED  +SE + D +    KKKK +D++     S + S S  G+ +++
Sbjct:   121 EDSSSSEDSADDSSSETKKKKHKDED--WQMSGSGSVSGTGSDSES 164

 Score = 52 (18.3 bits), Expect = 0.022, Sum P(2) = 0.021
 Identities = 13/40 (32%), Positives = 22/40 (55%), Frame = -1

Query:   339 EDMENSERTKDTNCEYNKKKKDEDDE-EICLTSSTLSTSS 223
             ED  +SE + D +    KKKK +D++ ++  + S   T S
Sbjct:   121 EDSSSSEDSADDSSSETKKKKHKDEDWQMSGSGSVSGTGS 160

 Score = 48 (16.9 bits), Expect = 0.055, Sum P(2) = 0.053
 Identities = 12/28 (42%), Positives = 16/28 (57%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY-EFIYDDSD 577
             +IFSQ    LDI+ E L Y +F +   D
Sbjct:   805 LIFSQMVRMLDILAEYLKYRQFPFQRLD 832


>sp|P24499|ATP6_TRYBB ATP SYNTHASE A CHAIN (PROTEIN 6)
            Length = 229

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.011, P = 0.011
 Identities = 33/122 (27%), Positives = 67/122 (54%), Frame = +1

Query:   262 FIIFIFFLFIIFTIC---IFSSL*I----FHIFII-YIIWF---FYIFFKTKFIFIPII- 405
             F+++I FLF+   +C   +F++L +      +F I +++ F   F +  +    F+ +  
Sbjct:    89 FLLYIAFLFLFCFLCDFFLFNNLLVGDSFMDVFFIRFLLCFLECFSLLCRCLSTFLRLFC 148

Query:   406 NIII--IVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHII 579
             N++    +++M F FF +I +  FFFY  ++ Y I F+    +F + L  +  LY++ + 
Sbjct:   149 NLLSSHFLLLMFFDFFYFIFV--FFFYG-VFCYFILFI---FVFCFCLLFYVFLYLLDLF 202

Query:   580 TIIIYKFI 603
               I+  FI
Sbjct:   203 AAILQLFI 210

 Score = 95 (33.4 bits), Expect = 0.076, P = 0.073
 Identities = 33/119 (27%), Positives = 63/119 (52%), Frame = +1

Query:   256 YFFIIFIF-FL--FIIFTICIF--SSL*IFHI-FIIYIIWFFYIFFKTKFIFIPII-NII 414
             Y   +F+F FL  F +F   +   S + +F I F++  +  F +  +    F+ +  N++
Sbjct:    92 YIAFLFLFCFLCDFFLFNNLLVGDSFMDVFFIRFLLCFLECFSLLCRCLSTFLRLFCNLL 151

Query:   415 I--IVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITII 588
                 +++M F FF +I +  FFFY  ++ Y I F+    +F + L  +  LY++ +   I
Sbjct:   152 SSHFLLLMFFDFFYFIFV--FFFYG-VFCYFILFI---FVFCFCLLFYVFLYLLDLFAAI 205

Query:   589 IYKFI 603
             +  FI
Sbjct:   206 LQLFI 210

 Score = 88 (31.0 bits), Expect = 0.50, P = 0.39
 Identities = 24/120 (20%), Positives = 65/120 (54%), Frame = +1

Query:   184 YINLMTCVILCTNR*GRKSR*SKTYF---FIIFIFFLFIIFTICIFSSL*IFHI--FIIY 348
             ++ L+ C+  C +R          YF    +IF F LF +F + +F  L +F +  F+++
Sbjct:    11 WLRLLLCMYYCVSR-----LCFIVYFNCLMLIFDFLLFCLFDLYLFVGLCLFLLLWFMLF 65

Query:   349 IIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYI---YI-IFFLT 516
              ++   +++   ++ + ++  I+ ++ + F F  +  +  FF + ++ +   ++ +FF+ 
Sbjct:    66 NLYSLILYYCITYLNLYLLFCIVFLLYIAFLFL-FCFLCDFFLFNNLLVGDSFMDVFFIR 124

Query:   517 YGIIFI 534
             + + F+
Sbjct:   125 FLLCFL 130

 Score = 87 (30.6 bits), Expect = 0.66, P = 0.48
 Identities = 19/72 (26%), Positives = 35/72 (48%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             +F+ IF+FF + +F  C F    I  IF+      FY+F     +F  I+ + I   ++ 
Sbjct:   163 FFYFIFVFFFYGVF--CYF----ILFIFVFCFCLLFYVFLYLLDLFAAILQLFIFCNMIL 216

Query:   436 FCFFTYIMIILF 471
                  +++ +LF
Sbjct:   217 QLIMDFLLFLLF 228


>pir||A47392 chromodomain-helicase-DNA-binding protein, CHD-1 - mouse
            Length = 1711

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.015, Sum P(2) = 0.015
 Identities = 22/53 (41%), Positives = 35/53 (66%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             + RLDGS     R++ +  F+ +    F FLLST+AGG+G+NL +A+ V++ D
Sbjct:   829 FQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFD 881

 Score = 53 (18.7 bits), Expect = 0.015, Sum P(2) = 0.015
 Identities = 21/79 (26%), Positives = 31/79 (39%), Frame = -1

Query:   471 EQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEY 292
             E +Y    K   R   N + + N G +     K  I    D  +ED +N +R+       
Sbjct:   178 ESDYEPKNKVRSRKPQNRSKSKN-GKKILGQKKRQIDSSEDEDDEDYDNDKRSSRRQATV 236

Query:   291 NKKKKDEDDEEICLTSSTL 235
             N   K+  DEE+   S  L
Sbjct:   237 NVSYKE--DEEMKTDSDDL 253

 Score = 48 (16.9 bits), Expect = 0.049, Sum P(2) = 0.048
 Identities = 12/28 (42%), Positives = 16/28 (57%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY-EFIYDDSD 577
             +IFSQ    LDI+ E L Y +F +   D
Sbjct:   806 LIFSQMVRMLDILAEYLKYRQFPFQRLD 833

 Score = 47 (16.5 bits), Expect = 0.062, Sum P(2) = 0.060
 Identities = 11/65 (16%), Positives = 29/65 (44%), Frame = -1

Query:   453 IGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKD 274
             +G +++  ++ + ++  DG E+ +  K  ++          +N ++            +D
Sbjct:   159 LGSDSESEEERDKSSC-DGTESDYEPKNKVRSRKPQNRSKSKNGKKILGQKKRQIDSSED 217

Query:   273 EDDEE 259
             EDDE+
Sbjct:   218 EDDED 222


>sp|P40201|CHD1_MOUSE CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN CHD-1
            >gi|455015 (L10410) DNA-binding protein [Mus musculus]
            Length = 1711

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.015, Sum P(2) = 0.015
 Identities = 22/53 (41%), Positives = 35/53 (66%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             + RLDGS     R++ +  F+ +    F FLLST+AGG+G+NL +A+ V++ D
Sbjct:   829 FQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFD 881

 Score = 53 (18.7 bits), Expect = 0.015, Sum P(2) = 0.015
 Identities = 21/79 (26%), Positives = 31/79 (39%), Frame = -1

Query:   471 EQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEY 292
             E +Y    K   R   N + + N G +     K  I    D  +ED +N +R+       
Sbjct:   178 ESDYEPKNKVRSRKPQNRSKSKN-GKKILGQKKRQIDSSEDEDDEDYDNDKRSSRRQATV 236

Query:   291 NKKKKDEDDEEICLTSSTL 235
             N   K+  DEE+   S  L
Sbjct:   237 NVSYKE--DEEMKTDSDDL 253

 Score = 48 (16.9 bits), Expect = 0.049, Sum P(2) = 0.048
 Identities = 12/28 (42%), Positives = 16/28 (57%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY-EFIYDDSD 577
             +IFSQ    LDI+ E L Y +F +   D
Sbjct:   806 LIFSQMVRMLDILAEYLKYRQFPFQRLD 833

 Score = 47 (16.5 bits), Expect = 0.062, Sum P(2) = 0.060
 Identities = 11/65 (16%), Positives = 29/65 (44%), Frame = -1

Query:   453 IGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKD 274
             +G +++  ++ + ++  DG E+ +  K  ++          +N ++            +D
Sbjct:   159 LGSDSESEEERDKSSC-DGTESDYEPKNKVRSRKPQNRSKSKNGKKILGQKKRQIDSSED 217

Query:   273 EDDEE 259
             EDDE+
Sbjct:   218 EDDED 222


>gi|2291218 (AF016425) contains similarity to the SNF2/RAD54 family of
            helicases [Caenorhabditis elegans]
            Length = 518

  Minus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.018, Sum P(2) = 0.018
 Identities = 23/58 (39%), Positives = 35/58 (60%), Frame = -1

Query:   207 DAGHQIYVRLDGSTNTIERQKIIKRFSKDEN-IFVFLLSTKAGGVGLNLIAANHVILMD 34
             + GH  Y  + G     +RQ+ +  F++++      LLS  AGGVGLNLI  NH+I++D
Sbjct:   377 EGGHG-YTSITGEVAIKDRQERVDSFNQEKGGAQDMLLSLTAGGVGLNLIGGNHLIMVD 434

 Score = 44 (15.5 bits), Expect = 0.018, Sum P(2) = 0.018
 Identities = 9/23 (39%), Positives = 18/23 (78%), Frame = -2

Query:   302 IVNIIKRKKM-KMMKKYVLLHRL 237
             I N ++RKK+  +M+K +++H+L
Sbjct:   319 IHNNMRRKKIVHLMEKNIVIHKL 341


>gnl|PID|e289150 (Z83337) member of the SNF2 helicase family [Bacillus
            subtilis]
            Length = 867

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.018, P = 0.018
 Identities = 24/50 (48%), Positives = 33/50 (66%), Frame = -1

Query:   180 LDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMDQ 31
             L+GS +  ER  ++++F + E     +LS KAGG GLNL AANHVI  D+
Sbjct:   741 LNGSLSKQERDTLVEKFQRKEYP-TLILSLKAGGTGLNLTAANHVIHYDR 789


>gi|452428 (X65740) ATPase 3 [Plasmodium falciparum]
           Length = 493

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.020, P = 0.019
 Identities = 34/123 (27%), Positives = 63/123 (51%), Frame = -1

Query:   603 YEFIYDDSDY-MDHIQTIKSSQSIN--KNDTICKEENNINV--NVFIKEE----QNYHDI 451
             Y +IY   D  MD +    ++ +IN  K++ I +E+ N +V  N+  KE+     N ++I
Sbjct:   236 YNYIYAIEDIRMDSMDNTNANDTINDEKDNEIYEEKQNNDVLYNLNEKEQLIDDNNMNEI 295

Query:   450 GKET-KRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKD 274
              K   K H +N N N     E K    +N ++ N+ +N D  N++ + D N ++N    +
Sbjct:   296 KKTVYKEHFENYNTNDEPNTEEKINM-DNYEELNNDHNND-HNNDHSNDHNNDHNNDHNN 353

Query:   273 EDDEE 259
             + + +
Sbjct:   354 DHNND 358

 Score = 96 (33.8 bits), Expect = 0.21, P = 0.19
 Identities = 35/165 (21%), Positives = 70/165 (42%), Frame = -1

Query:   603 YEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDD 424
             YE + +D +  DH     +  + + N+    + NN + N    +  N H+       ++D
Sbjct:   324 YEELNNDHNN-DHNNDHSNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNNDHNND 382

Query:   423 NNNN-NINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLT 247
             +NN+ N N+   N+F + +N        +   E+S      N + +  +K+ DD     T
Sbjct:   383 HNNDHNNNNNYNNEFNYNDNHHLQYVGIDGVREDSFVMDQRNIQNDYDEKNGDDNHTYNT 442

Query:   246 SSTLST--SSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDEN 115
             S  +S   ++    N+  H  YV  D + +  E +    ++  + N
Sbjct:   443 SFDISNVHNNYHNNNNNNHVDYVNYDYNNHAYENRNTQNKYFNESN 488

 Score = 92 (32.4 bits), Expect = 0.60, P = 0.45
 Identities = 34/146 (23%), Positives = 65/146 (44%), Frame = -1

Query:   594 IYDDSDYMDHIQTIKSSQSI----NKND---TICKEE-NNINVNVFIKEEQNYHDIGKET 439
             IY++    D +  +   + +    N N+   T+ KE   N N N     E+  +    E 
Sbjct:   267 IYEEKQNNDVLYNLNEKEQLIDDNNMNEIKKTVYKEHFENYNTNDEPNTEEKINMDNYEE 326

Query:   438 KRHDDNNN-NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDE 262
               +D NN+ NN +  D N     ++    N+ +N D  N++   D N ++N    ++ + 
Sbjct:   327 LNNDHNNDHNNDHSNDHNNDHNNDHNNDHNNDHNND-HNNDHNNDHNNDHNNDHNNDHNN 385

Query:   261 EICLTSSTLSTSSVGTQNDAGHQIYVRLDG 172
             +    ++  + ++    ND  H  YV +DG
Sbjct:   386 D---HNNNNNYNNEFNYNDNHHLQYVGIDG 412

 Score = 88 (31.0 bits), Expect = 1.7, P = 0.82
 Identities = 36/152 (23%), Positives = 67/152 (44%), Frame = -1

Query:   627 DIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEE-NNINVNVFIKEEQNYHDI 451
             +I EE    + +Y+ ++    I    +   I K  T+ KE   N N N     E+  +  
Sbjct:   266 EIYEEKQNNDVLYNLNEKEQLIDD-NNMNEIKK--TVYKEHFENYNTNDEPNTEEKINMD 322

Query:   450 GKETKRHDDNNN-NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKD 274
               E   +D NN+ NN +  D N     ++    N+ +N D  N++   D N ++N    +
Sbjct:   323 NYEELNNDHNNDHNNDHSNDHNNDHNNDHNNDHNNDHNND-HNNDHNNDHNNDHNNDHNN 381

Query:   273 EDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDG 172
             + + +    ++  + ++    ND  H  YV +DG
Sbjct:   382 DHNND---HNNNNNYNNEFNYNDNHHLQYVGIDG 412


>gi|2281697 (AF010138) transcription factor [Mus musculus]
            Length = 1002

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.022, P = 0.022
 Identities = 30/85 (35%), Positives = 45/85 (52%), Frame = -1

Query:   285 KKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFV 106
             + KD + + + ++  T   S + T   A   ++ RLDGS    +R + I+RF   E    
Sbjct:   840 RTKDPNIKSLVVSQFTTFLSLIETPLKASGFVFTRLDGSMAQKKRVESIQRFQNTEAGSP 899

Query:   105 FLLST-KAGGVGLNLIAANHVILMD 34
              + +  KAGGVGLNL A + V LMD
Sbjct:   900 TISTVLKAGGVGLNLCARSRVFLMD 924


>sp|P34739|LDS_DROME PROBABLE HELICASE LODESTAR
            Length = 1061

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.023, P = 0.023
 Identities = 33/115 (28%), Positives = 52/115 (45%), Frame = -1

Query:   375 KENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGH 196
             K  +K+ N ++N    +S+             K  DD+ I ++  T     +        
Sbjct:   873 KNLLKRSNPVFNLHRPSSKINMVIQILKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDG 932

Query:   195 QIYVRLDGSTNTIERQKIIKRFSKDENIF-VFLLSTKAGGVGLNLIAANHVILMD 34
                + L+G+    +   I+  F+   N   V LLS  AGGVGLNLI ANH++L+D
Sbjct:   933 VATLSLNGTIPVKKPSDIVNEFNDRNNQKRVLLLSLTAGGVGLNLIGANHLLLLD 987


>pir||A25877 cytochrome-c oxidase (EC 1.9.3.1) chain III - Crithidia
            fasciculata mitochondrion (SGC6) (fragment)
            Length = 287

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.024, P = 0.024
 Identities = 21/91 (23%), Positives = 50/91 (54%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIF---FKTKFIFIPIINIIIIVIIMT 435
             ++FI F +++F++ +F  +    +F+I +++   I    F   + FI + N++I   ++ 
Sbjct:    98 VLFISFFYVVFSLVLFVCVEFAFVFVIPVMFCCLICDYGFVFYWYFIDVFNLLINTFLL- 156

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIF 531
             F    ++  +LF F+   ++ ++F L   I+F
Sbjct:   157 FVSGLFVNFVLFLFWFRFFLCVLFVLWSAILF 188

 Score = 84 (29.6 bits), Expect = 2.2, P = 0.89
 Identities = 31/142 (21%), Positives = 65/142 (45%), Frame = +1

Query:   253 TYFFIIFIFFLFI------IFTICI-FSSL*IFHIFIIYIIWFFYIFFK----TKFIFIP 399
             ++F+++F   LF+      +F I + F  L   + F+ Y  W+F   F     T  +F+ 
Sbjct:   102 SFFYVVFSLVLFVCVEFAFVFVIPVMFCCLICDYGFVFY--WYFIDVFNLLINTFLLFVS 159

Query:   400 IINIIIIVIIMTFCFFTYIMIILF--------FFYKHIYIYIIFFLTYGI-IFIYAL*TF 552
              + +  ++ +  F FF  ++ +L+        F +  ++ + + F+T    +F   L   
Sbjct:   160 GLFVNFVLFLFWFRFFLCVLFVLWSAILFGFLFLWNQVWEFALLFVTCSCGVFGSILFLI 219

Query:   553 NSLYMIHIITIIIYKFI*QGLLYN 624
             + L+  H++  I   FI  G  +N
Sbjct:   220 DLLHFSHVLLGIFLLFICFGRCFN 243


>gnl|PID|e255509 (X99021) putative helicase [Schizosaccharomyces pombe]
            Length = 1367

  Minus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.024, P = 0.024
 Identities = 26/53 (49%), Positives = 34/53 (64%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSK-DENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y RLDG+     R+  I  F+  D   FVFLLST+AGG+G+NL  A+ VI+ D
Sbjct:   741 YQRLDGTIPASVRRVSIDHFNAPDSPDFVFLLSTRAGGLGINLNTADTVIIFD 793


>gi|414322 (L11172) [Plasmodium falciparum RNA polymerase I gene, complete
           cds.], gene product [Plasmodium falciparum]
           Length = 2910

  Minus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.025, P = 0.024
 Identities = 37/126 (29%), Positives = 65/126 (51%), Frame = -1

Query:   630 LDIIEEALL--YEFIYDDSD--YMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQN 463
             LD I EA+   YE +++D D  + + +  + S + I K++   K +NN N N       N
Sbjct:   171 LDDIVEAIYDDYENVHEDKDGNFDESVDLLDSLEKI-KDEPDEKNKNNNNKNN--NNNNN 227

Query:   462 YHDIGKETKRHDDNNNNNIN-DGDENKFCFKENIKK--PND-IYNEDME---NSERTKDT 304
              ++   +     DNNNNN++ + D N   F  ++    PN+ IY E+ +   + +  K+ 
Sbjct:   228 NNNYNNDVDIDVDNNNNNVDINVDNNNNYFNSDLVDLAPNEEIYEEETDAGRSDDNNKEN 287

Query:   303 NCEYNKKKK 277
               +YNK K+
Sbjct:   288 KPDYNKLKE 296

 Score = 101 (35.6 bits), Expect = 0.44, P = 0.36
 Identities = 41/130 (31%), Positives = 60/130 (46%), Frame = -1

Query:   588 DDSDYMDHIQT----IKSSQSINKNDTIC------KEENNINVN-VFIK-EEQNYHDIGK 445
             DD D M H+      + S QS N+N+ +       K E N NVN   IK EE N  D  K
Sbjct:   404 DDVDNMQHMNDDESQLNSIQSRNENNKLMIKRESKKIEYNNNVNDESIKIEEDNNEDDDK 463

Query:   444 ETKR-----HDDNNNNNINDGDENKFCFKENIKKP-NDIYNEDMENSERTKDTNCEY-NK 286
             +  R     H++NNNNN ND +EN        +   N+I  +++ N +    T  +  N 
Sbjct:   464 QMDRESSYPHNNNNNNN-NDNNENYNKLSGGYENSFNEISTDNIRNDKNKNSTFADMVNH 522

Query:   285 KKKDEDDEEIC 253
               + +  +E C
Sbjct:   523 YNRTQAPKEKC 533

 Score = 91 (32.0 bits), Expect = 5.9, P = 1.0
 Identities = 37/126 (29%), Positives = 57/126 (45%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVN-VFIK-EEQNYHDIGKETKR-----H 430
             DD   ++ IQ+   +  +       K E N NVN   IK EE N  D  K+  R     H
Sbjct:   414 DDESQLNSIQSRNENNKLMIKRESKKIEYNNNVNDESIKIEEDNNEDDDKQMDRESSYPH 473

Query:   429 DDNNNNNINDGDENKFCFKENIKKP-NDIYNEDMENSERTKDTNCE----YNKKKKDEDD 265
             ++NNNNN ND +EN        +   N+I  +++ N +    T  +    YN+ +  ++ 
Sbjct:   474 NNNNNNN-NDNNENYNKLSGGYENSFNEISTDNIRNDKNKNSTFADMVNHYNRTQAPKEK 532

Query:   264 EEICLTS 244
               I L S
Sbjct:   533 CTIRLFS 539


>pir||A35349 H+-transporting ATP synthase (EC 3.6.1.34) protein 6 - Trypanosoma
            brucei mitochondrion (SGC6)
            Length = 214

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.028, P = 0.028
 Identities = 22/115 (19%), Positives = 58/115 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII---IIVII 429
             F I+F+ ++  +F  C      +F+  ++   +    F +    F+   +++   +   +
Sbjct:    86 FCIVFLLYIAFLFLFCFLCDFFLFNNLLVGDSFMDVFFIRPLLCFLECFSLLCRCLSTFL 145

Query:   430 MTFC--FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
               FC    ++ ++++FF + + +I++ FFL   ++ IY +  F  L++  I+ + I+
Sbjct:   146 RLFCNLLSSHFLLLMFFDFFY-FIFVFFFLWCFLLLIYFI-YFCVLFLFIILCVFIF 200

 Score = 83 (29.2 bits), Expect = 1.7, P = 0.81
 Identities = 30/124 (24%), Positives = 60/124 (48%), Frame = +1

Query:   262 FIIFIFFLFIIFTIC---IFSSL*I----FHIFIIY-IIWF---FYIFFKTKFIFIPII- 405
             F+++I FLF+   +C   +F++L +      +F I  ++ F   F +  +    F+ +  
Sbjct:    90 FLLYIAFLFLFCFLCDFFLFNNLLVGDSFMDVFFIRPLLCFLECFSLLCRCLSTFLRLFC 149

Query:   406 NIII--IVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHII 579
             N++    +++M F FF +I +  F +   + IY I+F    +  I  +  F      HI 
Sbjct:   150 NLLSSHFLLLMFFDFFYFIFVFFFLWCFLLLIYFIYFCVLFLFIILCVFIFVGFICRHI- 208

Query:   580 TIIIY 594
             T+I +
Sbjct:   209 TVIYF 213

 Score = 80 (28.2 bits), Expect = 3.8, P = 0.98
 Identities = 25/93 (26%), Positives = 49/93 (52%), Frame = +1

Query:   259 FFII-FIFFL--FIIFTICIFSSL*IFHIFII--YIIWFFYIFFKTKFIFIPIINIIIIV 423
             FFI   + FL  F +   C+ + L +F   +   +++  F+ FF   F+F  +   ++++
Sbjct:   122 FFIRPLLCFLECFSLLCRCLSTFLRLFCNLLSSHFLLLMFFDFFYFIFVFFFLWCFLLLI 181

Query:   424 IIMTFC-FFTYIMIILFFFYKHI--YIYIIFFL 513
               + FC  F +I++ +F F   I  +I +I+FL
Sbjct:   182 YFIYFCVLFLFIILCVFIFVGFICRHITVIYFL 214

 Score = 79 (27.8 bits), Expect = 4.9, P = 0.99
 Identities = 17/62 (27%), Positives = 35/62 (56%), Frame = +1

Query:   262 FIIFIFF-LFIIFTICIFSSL*IFHIFIIY-IIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             F++F  F L++   +C+F  L  F +F +Y +I ++ I +   ++   I+ ++ I  +  
Sbjct:    41 FLLFCLFDLYLFVGLCVFLLL-WFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFL 99

Query:   436 FCF 444
             FCF
Sbjct:   100 FCF 102

 Score = 79 (27.8 bits), Expect = 4.9, P = 0.99
 Identities = 15/78 (19%), Positives = 44/78 (56%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHI--FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             +IF F LF +F + +F  L +F +  F+++ ++   +++   ++ + ++  I+ ++ + F
Sbjct:    37 LIFDFLLFCLFDLYLFVGLCVFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAF 96

Query:   439 CFFTYIMIILFFFYKHIYI 495
              F  +  +  FF + ++ +
Sbjct:    97 LFL-FCFLCDFFLFNNLLV 114

 Score = 78 (27.5 bits), Expect = 6.5, P = 1.0
 Identities = 30/122 (24%), Positives = 58/122 (47%), Frame = +1

Query:   259 FFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             FF   +F+L ++  +  C++S L     FI+Y      IF    F+   + ++ + V + 
Sbjct:     4 FFFCDLFWLRLLLCMYYCVWSRL----CFIVYPNCLMLIF---DFLLFCLFDLYLFVGL- 55

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QG 612
               C F  +  +LF  Y  I  Y I +L      +Y L  F  +++++I  + ++ F+   
Sbjct:    56 --CVFLLLWFMLFNLYSLILYYCITYLN-----LYLL--FCIVFLLYIAFLFLFCFLCDF 106

Query:   613 LLYN 624
              L+N
Sbjct:   107 FLFN 110


>sp|P38439|LEO1_YEAST LEO1 PROTEIN >pir||S45363 LEO1 protein - yeast
            (Saccharomyces cerevisiae) >gi|443971 (X77135) Leo1 protein
            [Saccharomyces cerevisiae] >gi|1050827 (X90518) pid:e194988
            [Saccharomyces cerevisiae] >gnl|PID|e217745 (X94335) YOR3278c
            [Saccharomyces cerevisiae] >gnl|PID|e252019 (Z75031) ORF YOR123c
            [Saccharomyces cerevisiae]
            Length = 464

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.031, P = 0.030
 Identities = 38/146 (26%), Positives = 69/146 (47%), Frame = -1

Query:   549 SSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKE 370
             SS+S    D   KE+ + NV V      N     +ET R  D+N   +N  D+ K   +E
Sbjct:     2 SSES--PQDQPQKEQISNNVGVTTNSTSN-----EETSRSQDDNVKEVNGNDDTKEEEQE 54

Query:   369 NIKKPNDIYNEDMENSER--TKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGH 196
                + +D++ +D ++ +    K +  E +    DEDDE   +   +    S+G  +D   
Sbjct:    55 EDAELDDLFGDDNDDDDDDDVKKSETEKSDSDSDEDDEGENINHRSRHRESLGLDDDEAE 114

Query:   195 Q--IYVRL---DGSTNTIERQKIIKRFSKDENI 112
             +  +Y R    + + N  ++ +    F K+EN+
Sbjct:   115 EQAMYTRKFYGEDANNFSDQDETTHTF-KEENV 146


>gi|1255425 (U53154) C33G8.2 gene product [Caenorhabditis elegans]
            Length = 390

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.031, P = 0.030
 Identities = 31/110 (28%), Positives = 55/110 (50%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             DD D  D  +  K      K D   K++++       K+++  +D  +E K+ D     +
Sbjct:   226 DDKDD-DENEDDKKKDKKKKKDDKEKDDDDEEEKDKKKKDKKKNDDDEEDKKKDKKKKKD 284

Query:   408 INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              +D DE++   K++ KK  D  ++D E+ E+ KD   +  KK  D+DD+E
Sbjct:   285 -DDDDEDEDNKKKDKKKKKD--DKDDEDEEKEKDKKKKDKKKDDDDDDDE 331

 Score = 98 (34.5 bits), Expect = 0.089, P = 0.086
 Identities = 26/91 (28%), Positives = 48/91 (52%), Frame = -1

Query:   531 KNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPN 352
             KND   +E+   +     K++ N  +  ++ K+  D   ++ +D DEN    K++ KK  
Sbjct:   170 KNDDDDEEDKKKDKKK--KKDDNDEEEKEKDKKKKDKKKDDDDDEDENDK--KKDKKKKK 225

Query:   351 DIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
             D  ++D    ++ KD   + + K+KD+DDEE
Sbjct:   226 DDKDDDENEDDKKKDKKKKKDDKEKDDDDEE 256

 Score = 95 (33.4 bits), Expect = 0.20, P = 0.18
 Identities = 31/110 (28%), Positives = 50/110 (45%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             DD D  D     K      K D   +EE   +     K++ +  D  +  K+ D     +
Sbjct:   172 DDDDEED-----KKKDKKKKKDDNDEEEKEKDKKKKDKKKDDDDDEDENDKKKDKKKKKD 226

Query:   408 INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
               D DEN+   K++ KK  D   +D ++ E  KD   + +KKK D+D+E+
Sbjct:   227 DKDDDENEDDKKKDKKKKKDDKEKD-DDDEEEKDKK-KKDKKKNDDDEED 274

 Score = 90 (31.7 bits), Expect = 0.74, P = 0.52
 Identities = 25/73 (34%), Positives = 41/73 (56%), Frame = -1

Query:   477 KEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNC 298
             KEE +  +  K+ K+ D+ N++   D +E+K   K+  KK +D   E+ E  ++ KD   
Sbjct:   152 KEEDDEEEEQKDKKKKDEKNDD---DDEEDKK--KDKKKKKDDNDEEEKEKDKKKKD--- 203

Query:   297 EYNKKKKDEDDEE 259
                KKK D+DDE+
Sbjct:   204 ---KKKDDDDDED 213

 Score = 90 (31.7 bits), Expect = 0.74, P = 0.52
 Identities = 27/73 (36%), Positives = 41/73 (56%), Frame = -1

Query:   477 KEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNC 298
             K+E+N  D  +E K+ D     + ND +E +   K+  KK +D  +ED EN ++ KD   
Sbjct:   167 KDEKNDDD-DEEDKKKDKKKKKDDNDEEEKEKDKKKKDKKKDDDDDED-ENDKK-KDKK- 222

Query:   297 EYNKKKKDEDDEE 259
                KKK D+DD+E
Sbjct:   223 ---KKKDDKDDDE 232

 Score = 90 (31.7 bits), Expect = 0.74, P = 0.52
 Identities = 28/110 (25%), Positives = 52/110 (47%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             DD+D  +  +  K  +   K+D   ++EN+   +   K++    D  ++ K+ D     +
Sbjct:   188 DDNDEEEK-EKDKKKKDKKKDDDDDEDENDKKKDKKKKKDDKDDDENEDDKKKDKKKKKD 246

Query:   408 INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
               + D++    +E  KK  D    D +  ++ KD      KKKKD+DD+E
Sbjct:   247 DKEKDDDDE--EEKDKKKKDKKKNDDDEEDKKKD-----KKKKKDDDDDE 289

 Score = 89 (31.3 bits), Expect = 0.96, P = 0.62
 Identities = 25/73 (34%), Positives = 41/73 (56%), Frame = -1

Query:   477 KEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNC 298
             KEE +  +  K+ K+ D+ N++   D +E+K   K+  KK +D   E+ E  ++ KD   
Sbjct:   152 KEEDDEEEEQKDKKKKDEKNDD---DDEEDKK--KDKKKKKDDNDEEEKEKDKKKKD--- 203

Query:   297 EYNKKKKDEDDEE 259
                 KKKD+DD+E
Sbjct:   204 ----KKKDDDDDE 212

 Score = 87 (30.6 bits), Expect = 1.6, P = 0.80
 Identities = 27/103 (26%), Positives = 55/103 (53%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIK-EEQNYHDIGKET-KRHDDNNNNNINDGDENKFC 379
             K  +   K+D   ++E+N   +   K ++++  D  KE  K+  D   ++ +D DE +  
Sbjct:   276 KKDKKKKKDDDDDEDEDNKKKDKKKKKDDKDDEDEEKEKDKKKKDKKKDDDDDDDEKEKK 335

Query:   378 FKENIKKPNDIYNEDMENSERTKDT---NCEYNKKKKDEDDEE 259
              K+     +D  +ED ++ ++ KD    + + +KKKK++DD+E
Sbjct:   336 DKKKKDDKDDDEDEDKDDKKKKKDDVDDDMKKDKKKKEDDDKE 378

 Score = 85 (29.9 bits), Expect = 2.7, P = 0.93
 Identities = 33/121 (27%), Positives = 57/121 (47%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDN---N 418
             DD+D  +  +  K  +   K+D   ++EN+   +   K++    D  ++ K+ D     +
Sbjct:   188 DDNDEEEK-EKDKKKKDKKKDDDDDEDENDKKKDKKKKKDDKDDDENEDDKKKDKKKKKD 246

Query:   417 NNNINDGDENKFCFKENIKKPNDIYNEDMENSERTK----DTNCEYNKKK-----KDEDD 265
             +   +D DE +   K+  KK ND   ED +  ++ K    D   E NKKK     KD+ D
Sbjct:   247 DKEKDDDDEEEKDKKKKDKKKNDDDEEDKKKDKKKKKDDDDDEDEDNKKKDKKKKKDDKD 306

Query:   264 EE 259
             +E
Sbjct:   307 DE 308


>pir||S34959 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 - Crithidia
            oncopelti mitochondrion (SGC6) >gi|12881 (X56015) NADH
            dehydrogenase subunit 4 [Crithidia oncopelti]
            Length = 437

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.036, P = 0.036
 Identities = 33/115 (28%), Positives = 57/115 (49%), Frame = +1

Query:   256 YFFIIFIFFL-FIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIIN-IIIIVII 429
             Y  I FIFF+  I+F +    +  I      + I   YIF     +FI +I+  +  +I+
Sbjct:    44 YINIWFIFFMGLIVFFLVFLLTRKIVSYSKYFCIVCTYIFIYIDVVFIILIDDFVCFMIL 103

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
                 FF    + LFF + + +I+ IF+L    + + ++   +S+  I I  III+ F
Sbjct:   104 FESLFFPICFVSLFFNFNNRFIFAIFYL----VIVSSI---SSIMCIMICIIIIFHF 153

 Score = 85 (29.9 bits), Expect = 3.2, P = 0.96
 Identities = 28/90 (31%), Positives = 41/90 (45%), Frame = +1

Query:   262 FIIF-IFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F+ F I F  + F IC  S    F+   I+ I++  I      I   +I IIII      
Sbjct:    97 FVCFMILFESLFFPICFVSLFFNFNNRFIFAIFYLVIVSSISSIMCIMICIIIIFHFNVL 156

Query:   439 CFFTYIMIILF-FFYKHIYIYIIFFLTYGI 525
                ++I I  F   Y  IYI+I+ F+ + I
Sbjct:   157 NLQSFIDICFFDSLYLAIYIWILLFIMFAI 186

 Score = 84 (29.6 bits), Expect = 4.2, P = 0.98
 Identities = 35/113 (30%), Positives = 55/113 (48%), Frame = +1

Query:   262 FIIFIFFLFI-IFTICIFSSL*IFHIFIIYIIW-FFYIFFKTKFIFIPIINIIIIVIIMT 435
             F + IF +    F + I+SSL    +F+  I + F  +F+   FI   +I++  I II  
Sbjct:   319 FGLRIFLIMTSFFGVSIWSSL-FLGMFLFNIDFPFMLLFYIDIFILYGLISLSFIYII-- 375

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGII----FIYAL*TFNSLYMIHIITIIIYKF 600
              CF+   +I+L  F   IYIYI     Y  +    +I    T N +Y+  I   +   F
Sbjct:   376 -CFY---VIVLSVFVSSIYIYICLSY-YSFVWMDKYIRLDLTINDIYLYFITASMTMSF 429

 Score = 83 (29.2 bits), Expect = 5.4, P = 1.0
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFSSL*IFHI-FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F+I   F  +     +F  + +F+I F   ++++  IF     I +  I II   +I+  
Sbjct:   324 FLIMTSFFGVSIWSSLFLGMFLFNIDFPFMLLFYIDIFILYGLISLSFIYIICFYVIVLS 383

Query:   439 CFFTYIMI-ILFFFYKHIYI--YIIFFLTYGIIFIY---AL*TFNSLYMIHII 579
              F + I I I   +Y  +++  YI   LT   I++Y   A  T +  Y+I+++
Sbjct:   384 VFVSSIYIYICLSYYSFVWMDKYIRLDLTINDIYLYFITASMTMSFFYLIYLL 436


>sp|P18160|KYK1_DICDI NON-RECEPTOR TYROSINE KINASE SPORE LYSIS A
            (TYROSINE-PROTEIN KINASE 1) >gi|974334 (U32174) non-receptor
            tyrosine kinase [Dictyostelium discoideum]
            Length = 1584

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.037, P = 0.036
 Identities = 44/152 (28%), Positives = 65/152 (42%), Frame = -1

Query:   558 TIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFC 379
             T  S  SIN N+ I    NN N N       N ++       +++NNNNN N  + N   
Sbjct:   433 TSTSPSSINNNEDISSNNNNNNNN----NNNNNNNNNNNNNNNNNNNNNNSNSSNTNNNN 488

Query:   378 FKE----NIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTS-----ST--LS 232
                    N    N+  N +  NS    + N   N    + ++  I LT      ST   S
Sbjct:   489 INNTTNNNNSNSNNNNNNNNSNSNSNSNNNNINNNNNNNNNNNNIYLTKKPSIGSTDESS 548

Query:   231 TSSVGTQNDAGHQIYVRLDGSTNTI-ERQKIIKRFSKDENI 112
             T S+G  N +G+      + S+ +I     IIK+ S   +I
Sbjct:   549 TGSLGGNNSSGNN-----NSSSGSIGNNSSIIKQRSPPHSI 584

 Score = 99 (34.8 bits), Expect = 0.39, P = 0.32
 Identities = 51/192 (26%), Positives = 76/192 (39%), Frame = -1

Query:   558 TIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFC 379
             T  S  SIN N+ I    NN N N       N ++       +++NNNNN N  + N   
Sbjct:   433 TSTSPSSINNNEDISSNNNNNNNN----NNNNNNNNNNNNNNNNNNNNNNSNSSNTNNNN 488

Query:   378 FKE----NIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTS-----ST--LS 232
                    N    N+  N +  NS    + N   N    + ++  I LT      ST   S
Sbjct:   489 INNTTNNNNSNSNNNNNNNNSNSNSNSNNNNINNNNNNNNNNNNIYLTKKPSIGSTDESS 548

Query:   231 TSSVGTQNDAGHQIYVRLD-GSTNTIERQK----------IIKRFS--KDENIFVFLLST 91
             T S+G  N +G+        G+ ++I +Q+          ++   S   + NI+    ST
Sbjct:   549 TGSLGGNNSSGNNNSSSGSIGNNSSIIKQRSPPHSINGPLMLPPSSTNNNNNIYSSYNST 608

Query:    90 KAGGVGLNLIAANHVI 43
              AG     L   NH I
Sbjct:   609 TAGSSTTILPTLNHPI 624

 Score = 90 (31.7 bits), Expect = 4.0, P = 0.98
 Identities = 42/164 (25%), Positives = 64/164 (39%), Frame = -1

Query:   534 NKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKP 355
             N N+      NN N N       N ++I   T  ++ N+NNN N+ + N      N    
Sbjct:   462 NNNNNNNNNNNNNNNNNSNSSNTNNNNINNTTNNNNSNSNNNNNNNNSNSNSNSNN---- 517

Query:   354 NDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQI----- 190
             N+I N    N+    + N  Y  KK      +   T S    +S G  N +   I     
Sbjct:   518 NNINN----NNNNNNNNNNIYLTKKPSIGSTDESSTGSLGGNNSSGNNNSSSGSIGNNSS 573

Query:   189 YVRLDGSTNTIERQKIIKRFS--KDENIFVFLLSTKAGGVGLNLIAANHVI 43
              ++     ++I    ++   S   + NI+    ST AG     L   NH I
Sbjct:   574 IIKQRSPPHSINGPLMLPPSSTNNNNNIYSSYNSTTAGSSTTILPTLNHPI 624


>sp|P14196|AAC2_DICDI AAC-RICH MRNA CLONE AAC11 PROTEIN >pir||S05355
            hypothetical protein (clone AAC11) - slime mold (Dictyostelium
            discoideum) (fragment) >gi|7174 (X16522) coding region (AA 448);
            pid:g7174 [Dictyostelium discoideum]
            Length = 448

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.038, P = 0.037
 Identities = 34/151 (22%), Positives = 63/151 (41%), Frame = -1

Query:   567 HIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             +I  I ++ + N N+      NN N N       N ++    T  + +NNNNNIN+ + N
Sbjct:   281 NINNINNNNNNNSNNNNNSSNNNNNNNNSTNNNTNNNN--NNTNNNTNNNNNNINNNNNN 338

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQN 208
                   N    N+  N++  N+    ++N   N    +  +     TS+  +T++  T  
Sbjct:   339 T-----N-NNNNNANNQNTNNNNMGNNSNNNNNPNNNNHQNNNNNNTSNNSNTTTATTTA 392

Query:   207 DAGHQIYVRLDGSTNTIERQKIIKRFSKDEN 115
               G+ +   L+ + N     ++    S D N
Sbjct:   393 PGGNNLTNSLNNAGNLGNLGRVSGLHSSDPN 423

 Score = 93 (32.7 bits), Expect = 0.40, P = 0.33
 Identities = 30/142 (21%), Positives = 57/142 (40%), Frame = -1

Query:   540 SINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIK 361
             +IN N+      NN + N       N +     T  +++N NNN N+ + N      N  
Sbjct:   284 NINNNNNNNSNNNNNSSN---NNNNNNNSTNNNTNNNNNNTNNNTNNNNNNINNNNNNTN 340

Query:   360 KPND-IYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYV 184
               N+   N++  N+    ++N   N    +  +     TS+  +T++  T    G+ +  
Sbjct:   341 NNNNNANNQNTNNNNMGNNSNNNNNPNNNNHQNNNNNNTSNNSNTTTATTTAPGGNNLTN 400

Query:   183 RLDGSTNTIERQKIIKRFSKDEN 115
              L+ + N     ++    S D N
Sbjct:   401 SLNNAGNLGNLGRVSGLHSSDPN 423


>pir||S47661 topoisomerase II - Plasmodium falciparum
            Length = 160

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.042, P = 0.041
 Identities = 25/74 (33%), Positives = 39/74 (52%), Frame = -1

Query:   492 VNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERT 313
             V++++K+  N  D  K  K  +DNNNNN N+ DEN     +N+     + NE  + +  T
Sbjct:    32 VDLYLKDNSN--D-NKNNKGQNDNNNNNNNNNDENANQNNDNLDV--SLSNEPADGTP-T 85

Query:   312 KDTNCEYNKKKKDE 271
             K+ N   N   +DE
Sbjct:    86 KNNNNNNNNNDEDE 99

 Score = 75 (26.4 bits), Expect = 7.5, P = 1.0
 Identities = 26/77 (33%), Positives = 37/77 (48%), Frame = -1

Query:   600 EFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHD-----IGKE-- 442
             EFI    DY+D    +K + + NKN+    + NN N N   +     +D     +  E  
Sbjct:    23 EFIVQCGDYVDLY--LKDNSNDNKNNKGQNDNNNNNNNNNDENANQNNDNLDVSLSNEPA 80

Query:   441 --TKRHDDNNNNNINDGDE 391
               T   ++NNNNN ND DE
Sbjct:    81 DGTPTKNNNNNNNNNDEDE 99

 Score = 74 (26.0 bits), Expect = 9.8, P = 1.0
 Identities = 26/77 (33%), Positives = 39/77 (50%), Frame = -1

Query:   600 EFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYH----DIGKETKR 433
             EFI    DY+D    +K + + NKN+   + +NN N N    E  N +    D+    + 
Sbjct:    23 EFIVQCGDYVDLY--LKDNSNDNKNNK-GQNDNNNNNNNNNDENANQNNDNLDVSLSNEP 79

Query:   432 HDD----NNNNNINDGDENK 385
              D     NNNNN N+ DE++
Sbjct:    80 ADGTPTKNNNNNNNNNDEDE 99


>gi|1620150 (U42580) Phe-rich [Paramecium bursaria Chlorella virus 1]
            Length = 108

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.046, P = 0.045
 Identities = 26/85 (30%), Positives = 43/85 (50%), Frame = +1

Query:   253 TYFFIIFIFF--LFIIFT------ICIFSSL*IFHIFIIYIIWF--FYIFFKTKF-IFIP 399
             ++ FI F FF   + IFT        IF +L  F+  I + I+   F I F   F +F  
Sbjct:    11 SFTFIFFEFFGICYTIFTGPFSEFFGIFRTLFTFNFIIFFEIFLTSFTITFSDFFCMFCT 70

Query:   400 IINIIIIVIIMTFCFFTYIMIILFFFY 480
             I  I+ + +  T+C  T++ + + FF+
Sbjct:    71 IFTIVYLFLFFTWC--THLRVFIMFFF 95


>gi|1931638 (U95973) transcription factor RUSH-1alpha isolog [Arabidopsis
            thaliana]
            Length = 1227

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.047, Sum P(2) = 0.046
 Identities = 19/52 (36%), Positives = 31/52 (59%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             Y R DG      R   ++ F+   ++ V ++S KA  +GLN++AA HVI++D
Sbjct:  1099 YRRFDGKMTVPARDAAVQDFNTLPDVSVMIMSLKAASLGLNMVAACHVIMLD 1150

 Score = 52 (18.3 bits), Expect = 0.047, Sum P(2) = 0.046
 Identities = 9/19 (47%), Positives = 15/19 (78%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL 607
             K+I+F+Q+T  LD++E  L
Sbjct:  1074 KAIVFTQWTKMLDLLEAGL 1092

 Score = 44 (15.5 bits), Expect = 0.14, Sum P(3) = 0.13
 Identities = 31/96 (32%), Positives = 43/96 (44%), Frame = -1

Query:   456 DIGKETKRHDDNNNNNINDGDENKF--CFKENIKKPNDIYNEDMENSERTKDTNCEYNKK 283
             D+GKE             D D   F  CF  +    N + + D E S RT+  + +Y   
Sbjct:   372 DVGKEYPFIPPQTAFPGQDIDGRSFYSCFDSDDCFQN-VTDPDPETS-RTE--SLDY--L 425

Query:   282 KKDEDDEEICLTSSTLSTSSVGT-QNDAGHQIYVRLDGS 169
               DED E I  T   LS+ S GT ++ +  +I  R D S
Sbjct:   426 VGDEDHEYIKRTCFNLSSFSSGTVESLSSKRIPEREDDS 464

 Score = 40 (14.1 bits), Expect = 0.14, Sum P(3) = 0.13
 Identities = 8/17 (47%), Positives = 11/17 (64%), Frame = -1

Query:   603 YEFIYDDSDYMDHIQTI 553
             +EF  DD D+M  I+ I
Sbjct:    19 FEFGADDEDFMIDIEAI 35


>pir||C22845 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 4 - Trypanosoma
            brucei mitochondrion (SGC6)
            Length = 439

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.048, P = 0.047
 Identities = 35/115 (30%), Positives = 58/115 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIF--SSL*IFHIFIIYIIWFF-YIFFKTKFIFIPIINIIIIVI 426
             Y  + F+FF+ II  I IF  S   + +    YI+  + YI+     I I + + +  +I
Sbjct:    47 YISLWFVFFMGIIMYILIFLLSKKCVSYNKYFYIVMIYMYIYINVVLIII-LDDFMCFMI 105

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
                  FF   ++ LFF + + +I+ IF+L   IIF     + +S+  I I  I+I  F
Sbjct:   106 AFESLFFPICLVSLFFNFNNRFIFAIFYL---IIFS----SVSSVVCIIICIIVISHF 156

 Score = 91 (32.0 bits), Expect = 0.67, P = 0.49
 Identities = 42/111 (37%), Positives = 59/111 (53%), Frame = +1

Query:   274 IFFLFI-IFTICIFSSL*IFHIFIIYIIW-FFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             IF L I  F I I+SSL    +F+  I + F  +F+   FI   +I+I  I II +F   
Sbjct:   325 IFLLLISFFGISIWSSL-FLCLFLFNIDFPFMLLFYVDIFILYGLISISFIYII-SF--- 379

Query:   448 TYIMIILFFFYKHIYIYIIFFLTYGIIFI--YAL*--TFNSLYM---IHIITIIIYKFI 603
              YI I L  F   IYIY+     Y  +++  Y     + N +Y+   I I TI+ Y FI
Sbjct:   380 -YI-ITLTIFLSSIYIYMCLSF-YSFVWLDKYLRLDVSINDIYVFMSISISTIVFYYFI 435

 Score = 87 (30.6 bits), Expect = 1.9, P = 0.85
 Identities = 28/112 (25%), Positives = 57/112 (50%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFH--IFIIYI-IWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             I+ I +++I ++ CI   +   +  I++ YI +WF +        F+ II  I+I ++  
Sbjct:    18 IVTIIYIYINYSFCIGIEINYVYVNIYLNYISLWFVF--------FMGIIMYILIFLLSK 69

Query:   436 FC--FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
              C  +  Y  I++ + Y +I + +I  L   + F+ A   F SL+    +  + + F
Sbjct:    70 KCVSYNKYFYIVMIYMYIYINVVLIIILDDFMCFMIA---FESLFFPICLVSLFFNF 123

 Score = 86 (30.3 bits), Expect = 2.5, P = 0.92
 Identities = 25/90 (27%), Positives = 40/90 (44%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F    I F  + F IC+ S    F+   I+ I++  IF     +   II II+I      
Sbjct:   100 FMCFMIAFESLFFPICLVSLFFNFNNRFIFAIFYLIIFSSVSSVVCIIICIIVISHFNII 159

Query:   439 CFFTYIMIILF-FFYKHIYIYIIFFLTYGI 525
                 +I +  F   Y  I+I+I+ F+ + I
Sbjct:   160 NLQAFIDVCYFDSLYSAIFIWILLFIMFAI 189


>sp|P48935|C560_CYACA SUCCINATE DEHYDROGENASE CYTOCHROME B560 SUBUNIT
            (SUCCINATE DEHYDROGENASE, SUBUNIT III) >pir||S62755 succinate
            dehydrogenase (ubiquinone) (EC 1.3.5.1) cytochrome b560 - red alga
            (Cyanidium caldarium) mitochondrion >gi|758171 (Z48930) succinate
            dehydrogenase (cytochrome b560 subunit) [Cyanidium caldarium]
            Length = 132

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.055, P = 0.054
 Identities = 25/84 (29%), Positives = 38/84 (45%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCF 444
             +  +FFLF++F  C    L  F  F     WF Y F KT F FI    I+ IV  M   F
Sbjct:    32 LYLVFFLFVLF--CSIKFLFCFSTF-----WFVYKFVKTCFFFILSFFIVFIVFSMYSLF 84

Query:   445 FTYIMIILFFFYKHIYIYIIFFLT 516
             + + + +    +  + +    F+T
Sbjct:    85 YHFFIGLRHLVWDEVILMEDNFVT 108


>gi|1407719 (U60409) L2759-20 [Leishmania major]
            Length = 925

  Minus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.057, P = 0.056
 Identities = 21/52 (40%), Positives = 34/52 (65%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             + ++DG T +  R   + RF+ D  ++V LL+T+ GGVGL   AA+ V+L+D
Sbjct:   523 HTQVDGDTPSERRCAEVDRFNNDAGVWVCLLTTQVGGVGLTFNAASAVVLLD 574


>gi|343539 (M14820) NADH dehydrogenase subunit 4 [Trypanosoma brucei]
           Length = 437

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.062, P = 0.060
 Identities = 35/115 (30%), Positives = 58/115 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIF--SSL*IFHIFIIYIIWFF-YIFFKTKFIFIPIINIIIIVI 426
             Y  + F+FF+ II  I IF  S   + +    YI+  + YI+     I I + + +  +I
Sbjct:    44 YISLWFVFFMGIIMYILIFLLSKKCVSYNKYFYIVMIYMYIYINVVLIII-LDDFMCFMI 102

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
                  FF   ++ LFF + + +I+ IF+L   IIF     + +S+  I I  I+I  F
Sbjct:   103 AFESLFFPICLLSLFFNFNNRFIFAIFYL---IIFS----SVSSVVCIIICIIVISHF 153

 Score = 91 (32.0 bits), Expect = 0.66, P = 0.48
 Identities = 42/111 (37%), Positives = 59/111 (53%), Frame = +1

Query:   274 IFFLFI-IFTICIFSSL*IFHIFIIYIIW-FFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             IF L I  F I I+SSL    +F+  I + F  +F+   FI   +I+I  I II +F   
Sbjct:   323 IFLLLISFFGISIWSSL-FLCLFLFNIDFPFMLLFYVDIFILYGLISISFIYII-SF--- 377

Query:   448 TYIMIILFFFYKHIYIYIIFFLTYGIIFI--YAL*--TFNSLYM---IHIITIIIYKFI 603
              YI I L  F   IYIY+     Y  +++  Y     + N +Y+   I I TI+ Y FI
Sbjct:   378 -YI-ITLTIFLSSIYIYMCLSF-YSFVWLDKYLRLDVSINDIYVFMSISISTIVFYYFI 433

 Score = 88 (31.0 bits), Expect = 1.5, P = 0.77
 Identities = 25/90 (27%), Positives = 40/90 (44%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             F    I F  + F IC+ S    F+   I+ I++  IF     +   II II+I      
Sbjct:    97 FMCFMIAFESLFFPICLLSLFFNFNNRFIFAIFYLIIFSSVSSVVCIIICIIVISHFNII 156

Query:   439 CFFTYIMIILF-FFYKHIYIYIIFFLTYGI 525
                 +I +  F   Y  I+I+I+ F+ + I
Sbjct:   157 NLQAFIHVCYFDSLYSAIFIWILLFIMFAI 186

 Score = 86 (30.3 bits), Expect = 2.5, P = 0.91
 Identities = 28/112 (25%), Positives = 57/112 (50%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFH--IFIIYI-IWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             I+ I +++I ++ CI   +   +  I++ YI +WF +        F+ II  I+I ++  
Sbjct:    15 IVTIIYIYINYSFCIGIEINYVYVNIYLNYISLWFVF--------FMGIIMYILIFLLSK 66

Query:   436 FC--FFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
              C  +  Y  I++ + Y +I + +I  L   + F+ A   F SL+    +  + + F
Sbjct:    67 KCVSYNKYFYIVMIYMYIYINVVLIIILDDFMCFMIA---FESLFFPICLLSLFFNF 120


>gnl|PID|d1000902 (D00570) open reading frame (251 AA) [Mus musculus]
            Length = 250

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.069, P = 0.067
 Identities = 30/120 (25%), Positives = 56/120 (46%), Frame = +1

Query:   256 YFFIIFIFFLFIIFT-ICIFSS-L*IFHIFI---IYIIWFFYIFFKTKFIFIPIINIIII 420
             Y  I    +L I  + +C+ S  L I+H+ I   IY+  +  I+       + I+++ + 
Sbjct:    65 YLSIYLSIYLSIYLSYVCLSSIYLSIYHLSIYLSIYLSIYLSIYLSIMSDCLSIMSVCLS 124

Query:   421 VIIMTFCFFTYIMIILFFFYKHIY--IYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             + +   C   Y+ II    Y  IY  IY+  +L+Y  +    L  + S+Y+ ++    IY
Sbjct:   125 ICLSYVCLSIYLSIICLSVYLSIYLCIYLSIYLSYVCLSSICLSIYLSIYLSYVCLSSIY 184


>sp|P04540|NU5M_TRYBB NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >pir||QQUTC5 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Trypanosoma
            brucei mitochondrion (SGC6) >gi|343540 (M14820) NADH dehydrogenase
            subunit 5 [Trypanosoma brucei]
            Length = 590

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.072, P = 0.070
 Identities = 31/123 (25%), Positives = 61/123 (49%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             YF + F+ F+F  F +  C+F  L  +   ++Y +   Y+   + F    II+ + I + 
Sbjct:   427 YFLLFFLMFVFKCFCLVDCLFL-LFDYECCLVYCLISLYMCILSIFF---IIDFVCIFVF 482

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIF------FLTYGIIFIY-----AL*TFNSLYMIHI 576
              ++C F +   + F+ +  I I+++F      FL YG +F Y      +  F  ++ + I
Sbjct:   483 SSYCVF-WSFFLNFYNFFDIAIFVVFLILSVGFLYYGCLFFYFFNIDCIMLFWRIFFVII 541

Query:   577 ITIIIYKF 600
             I ++   F
Sbjct:   542 ILVVFMIF 549

 Score = 99 (34.8 bits), Expect = 0.12, P = 0.11
 Identities = 30/98 (30%), Positives = 49/98 (50%), Frame = +1

Query:   259 FFIIFIFFL--FIIFTICIFSSL*IFHI-FIIYIIWFFYIF-FKTKFIFIPIINIIIIVI 426
             + + + FFL  +  F I IF    I  + F+ Y   FFY F      +F  I  +III++
Sbjct:   485 YCVFWSFFLNFYNFFDIAIFVVFLILSVGFLYYGCLFFYFFNIDCIMLFWRIFFVIIILV 544

Query:   427 I-MTFCFFTYIMIILFF--FYKHIYIYIIFFLTYGIIF 531
             + M FC + ++ +I+F   F  +  IY  + L Y + F
Sbjct:   545 VFMIFCCWYFVCMIIFMLLFVWNFVIYFRYNLKYCLFF 582

 Score = 93 (32.7 bits), Expect = 0.58, P = 0.44
 Identities = 28/113 (24%), Positives = 57/113 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             YF + F+ F+F  F +  C+F  L  +   ++Y +   Y+   + F    II+ + I + 
Sbjct:   427 YFLLFFLMFVFKCFCLVDCLFL-LFDYECCLVYCLISLYMCILSIFF---IIDFVCIFVF 482

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
              ++C F +   + F+ +  I I+++F L   + F+Y    F   Y  +I  I+++
Sbjct:   483 SSYCVF-WSFFLNFYNFFDIAIFVVF-LILSVGFLYYGCLF--FYFFNIDCIMLF 533

 Score = 89 (31.3 bits), Expect = 1.7, P = 0.81
 Identities = 35/125 (28%), Positives = 64/125 (51%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y  I+ IFF  II  +CIF    +F  + ++  W F++ F   + F  I  I ++ +I++
Sbjct:   464 YMCILSIFF--IIDFVCIF----VFSSYCVF--WSFFLNF---YNFFDIA-IFVVFLILS 511

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFF-LTYGIIFIYAL*TFNSLY---MIHIITIIIYKFI 603
               F  Y    LFF++ +I   ++F+ + + II +     F   Y   MI  + + ++ F+
Sbjct:   512 VGFLYYGC--LFFYFFNIDCIMLFWRIFFVIIILVVFMIFCCWYFVCMIIFMLLFVWNFV 569

Query:   604 *QGLLYNIK 630
                  YN+K
Sbjct:   570 IY-FRYNLK 577

 Score = 88 (31.0 bits), Expect = 2.2, P = 0.88
 Identities = 23/122 (18%), Positives = 54/122 (44%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYI----IWFFYIFFKTKFIFIPIINIIIIVI 426
             F ++ + F F++ ++C++         I+ +    IW  Y+        + +IN++   I
Sbjct:    37 FIVLCMIFSFLMVSVCLYGYYYYDFCLILMLDFCFIWLTYVCSGFYMFIMLLINMVFCFI 96

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYII----FFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             +    ++ Y  ++L  F    +I+++    F L+Y  +  Y       L+   +I+   Y
Sbjct:    97 VFYAFYYMYFDMLLGRFLIIFWIFVVCMNLFILSYDFLTAYCGWELLGLFSFFLISYFWY 156

Query:   595 KF 600
             +F
Sbjct:   157 RF 158

 Score = 86 (30.3 bits), Expect = 3.6, P = 0.97
 Identities = 28/113 (24%), Positives = 52/113 (46%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTK-FIFIPIINIIIIVI-I 429
             Y  I+ IFF+     I +FSS  +F  F +     FY FF    F+   I+++  +    
Sbjct:   464 YMCILSIFFIIDFVCIFVFSSYCVFWSFFLN----FYNFFDIAIFVVFLILSVGFLYYGC 519

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             + F FF    I+LF+    + I ++ F+ +   +   +  F  L++ + +    Y
Sbjct:   520 LFFYFFNIDCIMLFWRIFFVIIILVVFMIFCCWYFVCMIIFMLLFVWNFVIYFRY 574

 Score = 84 (29.6 bits), Expect = 6.1, P = 1.0
 Identities = 28/123 (22%), Positives = 59/123 (47%), Frame = +1

Query:   253 TYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIII-IVII 429
             +++ II   F+ IIF   IF ++ I++ F+++ + F    FK  F  +  + ++      
Sbjct:   404 SFYNIIEFLFISIIF---IFFTM-IYNYFLLFFLMFV---FKC-FCLVDCLFLLFDYECC 455

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*Q 609
             + +C  +  M IL  F+   ++ I  F +Y + + + L  +N      I   +++  +  
Sbjct:   456 LVYCLISLYMCILSIFFIIDFVCIFVFSSYCVFWSFFLNFYN---FFDIAIFVVFLILSV 512

Query:   610 GLLY 621
             G LY
Sbjct:   513 GFLY 516


>pir||S43288 MURF4 protein - Herpetomonas muscarum
            Length = 81

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.077, P = 0.074
 Identities = 23/80 (28%), Positives = 38/80 (47%), Frame = +1

Query:   268 IFIFFLF--IIFTICIFSSL*IFHIFIIYIIW---FFYIFFKTKFIFIPIINIIIIV--- 423
             +F FF F  I+F  C+         F+   +W    F ++F   FI++    + ++    
Sbjct:     1 MFFFFCFCDIVFLRCLLC-------FVYCSLWSNCVFVVYFNCLFIYLADFCLFVLFDFN 53

Query:   424 IIMTFCFFTYIMIILFFFYKHIYIYII 504
             + +  CF   +  ILF FY  I  Y I
Sbjct:    54 LFVGLCFLLCVWFILFNFYSLIVYYCI 80

 Score = 60 (21.1 bits), Expect = 5.8, P = 1.0
 Identities = 16/70 (22%), Positives = 30/70 (42%), Frame = +1

Query:   334 IFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIY-IYIIFF 510
             +F+  ++ F Y    +  +F+   N + I +   FC F      LF     +  ++ I F
Sbjct:    11 VFLRCLLCFVYCSLWSNCVFVVYFNCLFIYLA-DFCLFVLFDFNLFVGLCFLLCVWFILF 69

Query:   511 LTYGIIFIYAL 543
               Y +I  Y +
Sbjct:    70 NFYSLIVYYCI 80


>pir||C26696 hypothetical protein (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 211

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.081, P = 0.078
 Identities = 39/133 (29%), Positives = 63/133 (47%), Frame = +1

Query:   259 FFIIFIFFL-FIIFTICIFSS--L*IFHI-FIIYIIWFFYIFFKTKFIFIPII-NIIIIV 423
             F   F F L FI+F   +     + +F + +++ ++  F +  +    F+ +  N++   
Sbjct:    74 FLFCFCFLLDFILFGSLLVGDAFMDVFFLRYLLCVLECFSLLCRCISTFLRMFCNLLSSH 133

Query:   424 IIMT-FCFFTYIMIILF-FFYKHIYIYIIFF---LTYGIIF---IYAL*TFNSLYMIHII 579
              +M  FC F Y  II F FF    +IY I F   + + IIF   +YAL  F +L  I I 
Sbjct:   134 FLMLMFCDFVYFFIIFFLFFIMCDFIYFIIFTFAMLFCIIFYLFLYALDMFCALLQIFIF 193

Query:   580 TIIIYKFI*QGLL 618
               +I + I   LL
Sbjct:   194 CNMIMQLIMDFLL 206

 Score = 92 (32.4 bits), Expect = 0.14, P = 0.13
 Identities = 26/116 (22%), Positives = 52/116 (44%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII---IIVII 429
             F I+F++++  +F  C      +F   ++   +    F +     +   +++   I   +
Sbjct:    64 FCIVFMYYMAFLFCFCFLLDFILFGSLLVGDAFMDVFFLRYLLCVLECFSLLCRCISTFL 123

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGII-FIY-AL*TFNSLYMIHIITIIIY 594
               FC       ++  F   +Y +IIFFL + +  FIY  + TF  L+ I I  + +Y
Sbjct:   124 RMFCNLLSSHFLMLMFCDFVYFFIIFFLFFIMCDFIYFIIFTFAMLFCI-IFYLFLY 179

 Score = 83 (29.2 bits), Expect = 0.14, Sum P(2) = 0.13
 Identities = 27/72 (37%), Positives = 37/72 (51%), Frame = +1

Query:   424 IIMTFCFFTYIMIILF-FFYKHIYIYIIFF---LTYGIIF---IYAL*TFNSLYMIHIIT 582
             +++ FC F Y  II F FF    +IY I F   + + IIF   +YAL  F +L  I I  
Sbjct:   135 LMLMFCDFVYFFIIFFLFFIMCDFIYFIIFTFAMLFCIIFYLFLYALDMFCALLQIFIFC 194

Query:   583 IIIYKFI*QGLL 618
              +I + I   LL
Sbjct:   195 NMIMQLIMDFLL 206

 Score = 81 (28.5 bits), Expect = 2.8, P = 0.94
 Identities = 22/72 (30%), Positives = 37/72 (51%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             YFFIIF  FLF  F +C F    IF   +++ I  FY+F     +F  ++ I I   ++ 
Sbjct:   144 YFFIIF--FLF--FIMCDFIYFIIFTFAMLFCI-IFYLFLYALDMFCALLQIFIFCNMIM 198

Query:   436 FCFFTYIMIILF 471
                  +++++ F
Sbjct:   199 QLIMDFLLLLSF 210

 Score = 43 (15.1 bits), Expect = 0.14, Sum P(2) = 0.13
 Identities = 8/33 (24%), Positives = 21/33 (63%), Frame = +3

Query:   276 LFSFYYIHNLYL*FSLNFPYLHYIYHLVFLYFL 374
             LF+FY    L + + + +  ++ ++ +VF+Y++
Sbjct:    43 LFNFY---GLIVYYCITYLNVYILFCIVFMYYM 72


>sp|Q05854|YL78_YEAST PUTATIVE 151.3 KD TRANSCRIPTIONAL REGULATORY PROTEIN
            >pir||S50366 probable membrane protein YLR278c - yeast
            (Saccharomyces cerevisiae) >gi|596040 (U17243) Serine, glutamine,
            asparagine rich central portion of protein [Saccharomyces
            cerevisiae]
            Length = 1341

  Minus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.088, P = 0.084
 Identities = 27/85 (31%), Positives = 43/85 (50%), Frame = -1

Query:   549 SSQSINKNDTIC---KEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFC 379
             SS S + + T+     +E N+ +NV    + N   I    + H++N+NNN ND + N   
Sbjct:   877 SSSSSSSSSTLSFPSSQEKNLKINV--NNDNNGMTISSVNREHNNNHNNN-NDNNNNNNN 933

Query:   378 FKENIKKPNDIYNEDME-NSERTKDTNC 298
                N    N++ N D E NS  T + +C
Sbjct:   934 NNNNSNNNNNVNNNDNESNSRSTTNNSC 961


>gnl|PID|e311435 (Y08926) AARP1 protein [Plasmodium falciparum]
            Length = 3844

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.094, P = 0.090
 Identities = 40/172 (23%), Positives = 77/172 (44%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             DD+D  D         + + N+    ++NN N N    ++ N  D   +   +DD+NN++
Sbjct:  1209 DDNDDNDDDNDDNDDDNDDDNNDDNNDDNNDNDN---NDDDNNDDDNNDDDNNDDDNNDD 1265

Query:   408 INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK----DEDDEEICLTSS 241
              N+ D+N      N    ND  N D +N +  +D+N   +        +  D      SS
Sbjct:  1266 DNNDDDNNDD-DNNDDDNNDDDNNDDDNDDNDEDSNLHGSSSNMLNIINSRDNNSVTNSS 1324

Query:   240 TLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVG 73
              ++T+    +N+    I V  +G   T+  + +I R + + +I + +++     VG
Sbjct:  1325 NINTA----RNNNSTYIIVDQNGDNETLFAEILINR-NPNNSINMEIVNVTDNNVG 1375

 Score = 102 (35.9 bits), Expect = 0.45, P = 0.36
 Identities = 40/179 (22%), Positives = 75/179 (41%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNN 409
             DD +YMD           + +D    ++N+ + N    ++ N +D   +    DDNN+++
Sbjct:  1199 DDINYMDDNDDDNDDNDDDNDDN--DDDNDDDNNDDNNDDNNDNDNNDDDNNDDDNNDDD 1256

Query:   408 INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLST 229
              ND D N      N    ND  N D +N++   D N   N    D++DE+  L  S+ + 
Sbjct:  1257 NNDDDNNDD--DNNDDDNNDDDNNDDDNND---DDN---NDDDNDDNDEDSNLHGSSSNM 1308

Query:   228 SSVGTQNDAGHQIYV-RLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAAN 52
              ++    D         ++ + N      I+ +   +E +F  +L  +     +N+   N
Sbjct:  1309 LNIINSRDNNSVTNSSNINTARNNNSTYIIVDQNGDNETLFAEILINRNPNNSINMEIVN 1368

 Score = 96 (33.8 bits), Expect = 2.2, P = 0.88
 Identities = 26/98 (26%), Positives = 50/98 (51%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVN---VFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKF 382
             ++++S   +  +   E+ IN+N   V  +E  N  DI       DDN++N+ +D D+N  
Sbjct:  1165 EANRSSGMSQNVVTYESGINMNNDDVLGEERTNNDDINYMDDNDDDNDDND-DDNDDND- 1222

Query:   381 CFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
                +N    ND  N+D  +++   D N + +    D +D++
Sbjct:  1223 --DDNDDDNNDDNNDDNNDNDNNDDDNNDDDNNDDDNNDDD 1261

 Score = 94 (33.1 bits), Expect = 3.6, P = 0.97
 Identities = 25/90 (27%), Positives = 39/90 (43%), Frame = -1

Query:   534 NKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKP 355
             NK +   K  N    N      +N  +       +++NNNNN N+ + N    + ++ KP
Sbjct:  3133 NKKERKKKNTNLYPTNSQTNNNENDDNNNNNNNNNNNNNNNNNNNNNNNNNDSRGDVNKP 3192

Query:   354 NDIYNEDMENSERTKDTNCEYNKKKKDEDD 265
              +  N    N+  TK  N    KKKK+  D
Sbjct:  3193 KN--NNSFNNNSETKGGN---KKKKKNHSD 3217


>pir||S35458 SNF2 protein homolog - human (fragment) >gi|292498 (M89907)
            transcription activator [Homo sapiens]
            Length = 769

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.096, Sum P(2) = 0.091
 Identities = 27/68 (39%), Positives = 42/68 (61%), Frame = -1

Query:   201 GHQIYVRLDGSTNTIERQ------------KIIKRFSK-DENIFVFLLSTKAGGVGLNLI 61
             G++ Y RLDG T   ER+            + I+ F+  + + F+F+LST+AGG+G+NL 
Sbjct:   526 GYE-YCRLDGQTPHEEREDKFLEVEFLGQREAIEAFNAPNSSKFIFMLSTRAGGLGINLA 584

Query:    60 AANHVILMD 34
             +A+ VIL D
Sbjct:   585 SADVVILYD 593

 Score = 49 (17.2 bits), Expect = 0.096, Sum P(2) = 0.091
 Identities = 9/19 (47%), Positives = 14/19 (73%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY 601
             +IFSQ T  LDI+E+  ++
Sbjct:   506 LIFSQMTRLLDILEDYCMW 524


>sp|P34780|YCX5_ASTLO HYPOTHETICAL 13.3 KD PROTEIN IN RPL23-RPL5 INTERGENIC
            REGION (ORF105) >pir||S38605 hypothetical protein 105 (rpl23 3'
            region) - euglenid (Astasia longa) plastid >gi|414871 (X75653)
            orf105 [Astasia longa]
            Length = 105

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.099, P = 0.094
 Identities = 30/106 (28%), Positives = 50/106 (47%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             FF ++   L+I+F  C+     IF+ F+ +I  F+Y+    K         II +II  F
Sbjct:     2 FFDLYEIILYILF-FCV-----IFYGFLSFIELFYYLRDPRKR------KKIIYIIIYIF 49

Query:   439 CFFTYIMIILFFFYKHIYIYII-FFLTYGIIFIYAL*TFNSLYMIHI 576
             CF   +M IL     +  + II F+  Y   F +     N + ++H+
Sbjct:    50 CFLI-LMYILLIMDSYFIVNIIEFYQKYENGFKF-FDNINRVILMHL 94

 Score = 73 (25.7 bits), Expect = 1.3, P = 0.73
 Identities = 19/70 (27%), Positives = 37/70 (52%), Frame = +1

Query:   388 IFIPIINIIIIVIIMTFCFFTYIMIILFFFY-------KHIYIYIIFFLTYGIIFIYAL* 546
             +F  +  II+ ++     F+ ++  I  F+Y       K I IYII ++   +I +Y L 
Sbjct:     1 MFFDLYEIILYILFFCVIFYGFLSFIELFYYLRDPRKRKKI-IYIIIYIFCFLILMYILL 59

Query:   547 TFNSLYMIHII 579
               +S ++++II
Sbjct:    60 IMDSYFIVNII 70

 Score = 64 (22.5 bits), Expect = 0.88, Sum P(2) = 0.59
 Identities = 23/66 (34%), Positives = 36/66 (54%), Frame = +1

Query:   250 KTYFFIIFIF-FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             K  + II+IF FL +++ + I  S      FI+ II F Y  ++  F F   IN +I++ 
Sbjct:    40 KIIYIIIYIFCFLILMYILLIMDSY-----FIVNIIEF-YQKYENGFKFFDNINRVILMH 93

Query:   427 IMT-FCFF 447
             +   F FF
Sbjct:    94 LEKGFNFF 101

 Score = 42 (14.8 bits), Expect = 0.88, Sum P(2) = 0.59
 Identities = 9/15 (60%), Positives = 9/15 (60%), Frame = +1

Query:   112 YIFIF*KTFYDFLSF 156
             YI  F   FY FLSF
Sbjct:    11 YILFFCVIFYGFLSF 25


>gi|456385 (U05813) 3'-end [Blastocrithidia culicis]
           Length = 97

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.099, P = 0.094
 Identities = 22/65 (33%), Positives = 35/65 (53%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*I-FHIFII----YIIWFFYIFFKTKFIFIPIINI 411
             S  +  II+IF+  +I  I IFS   + F +  +    Y+  FF+I F T  +F  IIN+
Sbjct:    33 SVIWLIIIYIFYFRLIINIFIFSYQFMGFWVVRLQTYSYLTVFFFISFCTFILFFDIINL 92

Query:   412 IIIVI 426
               I++
Sbjct:    93 FDIIL 97

 Score = 71 (25.0 bits), Expect = 0.36, P = 0.30
 Identities = 28/81 (34%), Positives = 37/81 (45%), Frame = +1

Query:   274 IFFLFIIFTICIFSSL*IFHIFIIY--IIWFFYIFFKTKFIFIPIINIIIIVI-IMTFCF 444
             I F F I   C+   L    + II+  +IW   I+    F F  IINI I     M F  
Sbjct:     7 IVFGFFIKVFCLLLHLNHLGVCIIFFSVIWLIIIYI---FYFRLIINIFIFSYQFMGFWV 63

Query:   445 F---TYIMIILFFFYKHIYIYIIFF 510
                 TY  + +FFF      +I+FF
Sbjct:    64 VRLQTYSYLTVFFFISFC-TFILFF 87


>pir||S59078 hypothetical protein 262 - red alga (Chondrus crispus)
            mitochondrion (SGC3) >gnl|PID|e138022 (Z47547)
            Pwi=orf234.1;Mpo=orf244;Angio=orfx; no ATG start codon [Chondrus
            crispus]
            Length = 262

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.10, P = 0.096
 Identities = 37/137 (27%), Positives = 64/137 (46%), Frame = +1

Query:   256 YFFIIFI----FFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIV 423
             YF+ I I    F++ I F  C+        I+++   + F  F   KFI     ++I  V
Sbjct:    20 YFYSIEIAYRFFYIIISFVFCLIICFWYVQIWLLIETYPFLQFSNKKFIATQTTDLIDAV 79

Query:   424 IIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNS-LYMIHIITIIIYKF 600
              I+TF   +++ +  FF Y+ I      +  Y + FI  L  ++S LY+I ++    Y  
Sbjct:    80 WIITFST-SFLFVYPFFVYQIILFSKNSWYEYQMYFIIKLFCYSSILYVISLLFCYYYLL 138

Query:   601 -I*QGLL--YNIKKSSKL 645
              I  G L  + IK++  +
Sbjct:   139 PILLGFLSQWEIKQTESI 156

 Score = 82 (28.9 bits), Expect = 3.2, P = 0.96
 Identities = 27/85 (31%), Positives = 41/85 (48%), Frame = +1

Query:   259 FFIIFIFFLFII-FTICIFSSL*IFHIFIIYIIWFF----YIFFKTKFIF-IPIINIIII 420
             F  +F F  +I+ F IC FS L   +  I Y +  F    +IF  T F F I   +  + 
Sbjct:   175 FRYVFSFLFYIVTFFICFFSFL--LNSMIKYNLLKFHRKIFIFLNTLFFFLITPSDFYLQ 232

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYIYI 501
             + ++ + F  Y +I LF  YK    Y+
Sbjct:   233 LFVILYSFIFYEIIFLFLCYKCNITYL 259

 Score = 78 (27.5 bits), Expect = 9.3, P = 1.0
 Identities = 24/79 (30%), Positives = 41/79 (51%), Frame = +1

Query:   337 FIIYIIWFFYIFFKTKFIFIPII--NII-----IIVIIMTFCFFTYIMIILFFFYKHIYI 495
             F+ YI+ FF  FF   F+   +I  N++     I + + T  FF   +I    FY  +++
Sbjct:   181 FLFYIVTFFICFFS--FLLNSMIKYNLLKFHRKIFIFLNTLFFF---LITPSDFYLQLFV 235

Query:   496 YIIFFLTYGIIFIYAL*TFNSLYM 567
              +  F+ Y IIF++     N  Y+
Sbjct:   236 ILYSFIFYEIIFLFLCYKCNITYL 259


>pir||A45612 ATPase 6 - Sauroleishmania tarentolae >gi|340586 (M33229) ATPase 6
            [Leishmania tarentolae] >gi|340615 (L07543) MURF4 [Leishmania
            tarentolae]
            Length = 232

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.10, P = 0.097
 Identities = 39/133 (29%), Positives = 63/133 (47%), Frame = +1

Query:   259 FFIIFIFFL-FIIFTICIFSS--L*IFHI-FIIYIIWFFYIFFKTKFIFIPII-NIIIIV 423
             F   F F L FI+F   +     + +F + +++ ++  F +  +    F+ +  N++   
Sbjct:    95 FLFCFCFLLDFILFGSLLVGDAFMDVFFLRYLLCVLECFSLLCRCISTFLRMFCNLLSSH 154

Query:   424 IIMT-FCFFTYIMIILF-FFYKHIYIYIIFF---LTYGIIF---IYAL*TFNSLYMIHII 579
              +M  FC F Y  II F FF    +IY I F   + + IIF   +YAL  F +L  I I 
Sbjct:   155 FLMLMFCDFVYFFIIFFLFFIMCDFIYFIIFTFAMLFCIIFYLFLYALDMFCALLQIFIF 214

Query:   580 TIIIYKFI*QGLL 618
               +I + I   LL
Sbjct:   215 CNMIMQLIMDFLL 227

 Score = 92 (32.4 bits), Expect = 0.18, P = 0.16
 Identities = 26/116 (22%), Positives = 52/116 (44%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII---IIVII 429
             F I+F++++  +F  C      +F   ++   +    F +     +   +++   I   +
Sbjct:    85 FCIVFMYYMAFLFCFCFLLDFILFGSLLVGDAFMDVFFLRYLLCVLECFSLLCRCISTFL 144

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGII-FIY-AL*TFNSLYMIHIITIIIY 594
               FC       ++  F   +Y +IIFFL + +  FIY  + TF  L+ I I  + +Y
Sbjct:   145 RMFCNLLSSHFLMLMFCDFVYFFIIFFLFFIMCDFIYFIIFTFAMLFCI-IFYLFLY 200

 Score = 83 (29.2 bits), Expect = 2.0, P = 0.86
 Identities = 27/72 (37%), Positives = 37/72 (51%), Frame = +1

Query:   424 IIMTFCFFTYIMIILF-FFYKHIYIYIIFF---LTYGIIF---IYAL*TFNSLYMIHIIT 582
             +++ FC F Y  II F FF    +IY I F   + + IIF   +YAL  F +L  I I  
Sbjct:   156 LMLMFCDFVYFFIIFFLFFIMCDFIYFIIFTFAMLFCIIFYLFLYALDMFCALLQIFIFC 215

Query:   583 IIIYKFI*QGLL 618
              +I + I   LL
Sbjct:   216 NMIMQLIMDFLL 227

 Score = 82 (28.9 bits), Expect = 2.6, P = 0.92
 Identities = 23/85 (27%), Positives = 40/85 (47%), Frame = +1

Query:   283 LFIIFTICIFSSL*IFHIFIIYIIW---FFYIFFKTKFIFIPIINIII-IVIIMTFCFFT 450
             +F+ F +C    + I   F  Y +W    F +F+   +I   ++  I  + + +  C F 
Sbjct:     1 MFVFF-VCDLVIMRILLCFC-YSVWSRIIFVLFYNVFYICTELMFCIFDVYLFVGLCMFI 58

Query:   451 YIMIILFFFYKHIYIYIIFFLTYGIIF 531
              +  +LF FY  I  Y I +L   I+F
Sbjct:    59 CLWFVLFNFYGLIVYYCITYLNVYILF 85

 Score = 81 (28.5 bits), Expect = 3.4, P = 0.97
 Identities = 22/72 (30%), Positives = 37/72 (51%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             YFFIIF  FLF  F +C F    IF   +++ I  FY+F     +F  ++ I I   ++ 
Sbjct:   165 YFFIIF--FLF--FIMCDFIYFIIFTFAMLFCI-IFYLFLYALDMFCALLQIFIFCNMIM 219

Query:   436 FCFFTYIMIILF 471
                  +++++ F
Sbjct:   220 QLIMDFLLLLSF 231

 Score = 80 (28.2 bits), Expect = 4.4, P = 0.99
 Identities = 24/91 (26%), Positives = 43/91 (47%), Frame = +1

Query:   283 LFIIFTICIFSSL*IFHIFIIYIIW---FFYIFFKTKFIFIPIINIII-IVIIMTFCFFT 450
             +F+ F +C    + I   F  Y +W    F +F+   +I   ++  I  + + +  C F 
Sbjct:     1 MFVFF-VCDLVIMRILLCFC-YSVWSRIIFVLFYNVFYICTELMFCIFDVYLFVGLCMFI 58

Query:   451 YIMIILFFFYKHIYIYIIFFLT----YGIIFIY 537
              +  +LF FY  I  Y I +L     + I+F+Y
Sbjct:    59 CLWFVLFNFYGLIVYYCITYLNVYILFCIVFMY 91

 Score = 78 (27.5 bits), Expect = 7.5, P = 1.0
 Identities = 25/89 (28%), Positives = 43/89 (48%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCF 444
             IIF+ F + +F IC  + L +F IF +Y+     +F    F+      +I+   I T+  
Sbjct:    26 IIFVLF-YNVFYIC--TEL-MFCIFDVYLFVGLCMFICLWFVLFNFYGLIVYYCI-TY-L 79

Query:   445 FTYIMIILFFFYKHIYIYIIFFLTYGIIF 531
               YI+  + F Y   +++   FL   I+F
Sbjct:    80 NVYILFCIVFMYYMAFLFCFCFLLDFILF 108


>gi|2408073 (Z99167) helicase [Schizosaccharomyces pombe]
            Length = 1388

  Minus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.11, Sum P(2) = 0.10
 Identities = 24/51 (47%), Positives = 34/51 (66%), Frame = -1

Query:   183 RLDGSTNTIERQKIIKRFSKDENI-FVFLLSTKAGGVGLNLIAANHVILMD 34
             RLDG+     R+  I  F+   +  FVFLLST+AGG+G+NL+ A+ VI+ D
Sbjct:   735 RLDGTVPAAVRRTSIDHFNAPNSPDFVFLLSTRAGGLGINLMTADTVIIFD 785

 Score = 38 (13.4 bits), Expect = 0.11, Sum P(2) = 0.10
 Identities = 8/17 (47%), Positives = 11/17 (64%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEAL 607
             +IFSQ    LDI+ + L
Sbjct:   710 LIFSQMVRMLDILGDYL 726

 Score = 38 (13.4 bits), Expect = 0.11, Sum P(2) = 0.10
 Identities = 13/49 (26%), Positives = 22/49 (44%), Frame = -1

Query:   651 FSQFTTFLDIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEE 505
             FS+  T  D+ +EA        +SD   +  T K      K++T  ++E
Sbjct:    98 FSRHRTIRDLDDEAESVTSEESESDDSSYGGTPKKRSRQKKSNTYVQDE 146


>sp|P75093|Y018_MYCPN HYPOTHETICAL HELICASE MG018/MG017/MG016 HOMOLOG
            >pir||S73460 probable helicase yb95 - Mycoplasma pneumoniae (SGC3)
            (ATCC 29342) >gi|1673793 (AE000015) Mycoplasma pneumoniae,
            hypothetical helicase (yb95) homolog; similar to Swiss-Prot
            Accession Number P38144, from S. cerevisiae [Mycoplasma pneumoniae]
            Length = 1030

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.11, P = 0.10
 Identities = 25/61 (40%), Positives = 35/61 (57%), Frame = -1

Query:   216 TQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILM 37
             T  + G + ++  DG  +   R  II++F+  +N  V L S KAGGVG+NL AA  VI  
Sbjct:   897 TFKEQGIEYFI-FDGRKSPKSRHSIIEKFNNAKNPCVLLASLKAGGVGINLTAAEVVIHF 955

Query:    36 D 34
             D
Sbjct:   956 D 956


>sp|P54682|D7_DICDI CAMP-INDUCIBLE PRESPORE PROTEIN D7 PRECURSOR >gi|915201
            (U25143) cAMP-inducible prespore protein [Dictyostelium discoideum]
            Length = 850

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.11, P = 0.11
 Identities = 41/174 (23%), Positives = 73/174 (41%), Frame = -1

Query:   630 LDIIEEALLYEFIYDD--SDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQN-Y 460
             L++ E+   YE + D    +     Q + + Q + +      E+    +N   +  Q+ Y
Sbjct:   450 LNLQEDQEQYELLLDQLYDEQQQQPQKVSNKQQLQEQQINSPEDIQYQLNHLNQPFQDDY 509

Query:   459 HDIGKETKRHDDNNNNN--INDGD-ENKFCFKENIKKPNDIY---NEDMENSERTKDTNC 298
             H+   E  + DD N N+  IN+G  EN      ++   ND +   N +  N     + N 
Sbjct:   510 HNDQTEELKDDDYNFNDQQINNGQFENNVEEFPDLNDANDNFEQVNNNNNNINNNNNNNF 569

Query:   297 EYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDGST--NTIERQKIIKR 133
             + +K KK     EI L +  L    V    DA  ++Y  +  S     ++  + I+R
Sbjct:   570 KVDKSKKSAQQVEIALENERLYLQEV---EDAPERLYEEIHNSNLNKAVQEAEEIER 623


>gi|1947112 (AF000196) strong similarity to the SNF2/RAD54 family of helicases;
            partial CDS [Caenorhabditis elegans]
            Length = 1096

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.12, Sum P(2) = 0.11
 Identities = 20/54 (37%), Positives = 34/54 (62%), Frame = -1

Query:   189 YVRLDGSTNTIERQKIIKRFSKDENIF--VFLLSTKAGGVGLNLIAANHVILMD 34
             Y+ +DGS  + +R  +   F+   N+   + L+ST+AG +G N++AAN VI+ D
Sbjct:   753 YMTIDGSVQSGKRDAVQTSFNDPLNLRARLMLISTRAGSLGTNMVAANRVIIFD 806

 Score = 48 (16.9 bits), Expect = 0.12, Sum P(2) = 0.11
 Identities = 22/100 (22%), Positives = 43/100 (43%), Frame = -1

Query:   510 EENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDM 331
             EE+++ V    K+      I       D  + +  +D +E     K+  KK  +      
Sbjct:    32 EESDVEVLPQKKKRGAVTLISDSEDEKDQKSESEASDVEEK--VSKKKAKK-QESSESGS 88

Query:   330 ENSERTKDTNCEYNKKKKDEDDEE-ICLTSSTLSTSSVGTQ 211
             ++SE +   N +  KK+K E  ++ I + SS L   ++  +
Sbjct:    89 DSSEGSITVNRKSKKKEKPEKKKKGIIMDSSKLQKETIDAE 129


>sp|Q03100|CYAA_DICDI ADENYLATE CYCLASE, AGGREGATION SPECIFIC (ATP
            PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >pir||B42239 adenylate
            cyclase (EC 4.6.1.1) aggregation stage - slime mold (Dictyostelium
            discoideum) >gi|457431 (L05499) adenylyl cyclase aggregation
            protein [Dictyostelium discoideum]
            Length = 1407

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.12, Sum P(2) = 0.11
 Identities = 26/70 (37%), Positives = 33/70 (47%), Frame = -1

Query:   465 NYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNK 286
             N  D+ K+ K  D+NNNNN N    N F  K NI   N+  N +  N+      N     
Sbjct:   524 NNIDLDKDNK--DNNNNNNNNKNSNNNFKNKNNIINNNN--NSNSNNTTNNNSNNNNITT 579

Query:   285 KKKDEDDEEI 256
                D+DDEEI
Sbjct:   580 SGNDDDDEEI 589

 Score = 40 (14.1 bits), Expect = 0.12, Sum P(2) = 0.11
 Identities = 10/38 (26%), Positives = 21/38 (55%), Frame = -1

Query:   192 IYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGG 79
             +++++ G     E + +IK+ +   + F  LL+ K GG
Sbjct:  1191 MFIQIAGFQEYDEPKDLIKKLNDIFSFFDGLLNQKYGG 1228


>gi|499325 (Z26314) STARP antigen [Plasmodium falciparum]
           Length = 604

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.13, P = 0.12
 Identities = 40/148 (27%), Positives = 64/148 (43%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINV------NVFIKEEQNYHDIGKET--KRHD---- 427
             D+I T ++  +     T+  + NNIN       N  IK   NY+   KET  K  D    
Sbjct:   250 DNINTTQNLTTSTNTTTVSTDNNNINTKPIDNNNTDIKSTDNYNTGTKETDNKNTDIKAT 309

Query:   426 DNNNNNINDGDENKFCFKENIKKPNDIYNEDME-NSERTKDTNCEYNKKKKDEDDEEICL 250
             DNNN      + N      +  K N I  ++ + N+  T + N +      D ++ +I L
Sbjct:   310 DNNNITTTTDNTNTNVISTDNSKTNVISTDNSKTNTISTDNDNADTILTDND-NNTDIIL 368

Query:   249 TSSTLSTSSVGTQNDAGHQIYVRLDGSTNT 160
             T +  +T ++ T ND         + +TNT
Sbjct:   369 TDNN-NTDTISTDNDNADTKATDNNNNTNT 397

 Score = 92 (32.4 bits), Expect = 0.79, P = 0.54
 Identities = 37/139 (26%), Positives = 53/139 (38%), Frame = -1

Query:   558 TIKSSQSINKND---TICKEENNINVNVFIKEEQNYHDIGKETKRHD----DNNNNNIND 400
             T  S+ + N  D   T  K  +NIN    +    N   +  +    +    DNNN +I  
Sbjct:   229 TDNSNTNTNLTDNTSTTKKLTDNINTTQNLTTSTNTTTVSTDNNNINTKPIDNNNTDIKS 288

Query:   399 GDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV 220
              D      KE   K  DI   D  N   T D N   N    D     +  T ++  T+++
Sbjct:   289 TDNYNTGTKETDNKNTDIKATDNNNITTTTD-NTNTNVISTDNSKTNVISTDNS-KTNTI 346

Query:   219 GTQNDAGHQIYVRLDGSTNTI 157
              T ND    I    D +T+ I
Sbjct:   347 STDNDNADTILTDNDNNTDII 367

 Score = 92 (32.4 bits), Expect = 0.79, P = 0.54
 Identities = 33/141 (23%), Positives = 59/141 (41%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKE-----TKRHDDNNNNNI 406
             D+ +T   S   +  DTI  + +N N ++ + +  N   I  +     TK  D+NNN N 
Sbjct:   339 DNSKTNTISTDNDNADTILTDNDN-NTDIILTDNNNTDTISTDNDNADTKATDNNNNTNT 397

Query:   405 NDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTS 226
                D N               + D  N+  TK T+    K    +++    +++   +T 
Sbjct:   398 KATDNNNTKIISPDNNNTKTTSTDNNNNTNTKATDNNNTKTISTDNNNTKTISTDNNNTK 457

Query:   225 SVGTQNDAGHQIYVRLDGSTNTI 157
             ++ T N+    I    + +TNTI
Sbjct:   458 TISTDNNNTKTIS-NDNNNTNTI 479

 Score = 90 (31.7 bits), Expect = 1.3, P = 0.74
 Identities = 37/146 (25%), Positives = 62/146 (42%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNINVNVFIKEEQNYH----DIGKETKRHDDNNNN--NIND 400
             Q +  + +   N +  +  NNIN N    +  N +    D    TK+  DN N   N+  
Sbjct:   201 QILTGNNNTTTNTSTTEHNNNINTNTNSTDNSNTNTNLTDNTSTTKKLTDNINTTQNLTT 260

Query:   399 GDENKFCFKENIK---KPNDIYNEDMENSER----TKDTNCEYNKKKKDEDDEEICLTSS 241
                      +N     KP D  N D+++++     TK+T+ + N   K  D+  I  T+ 
Sbjct:   261 STNTTTVSTDNNNINTKPIDNNNTDIKSTDNYNTGTKETDNK-NTDIKATDNNNITTTTD 319

Query:   240 TLSTSSVGTQNDAGHQIYVRLDGSTNTI 157
               +T+ + T N   + I    +  TNTI
Sbjct:   320 NTNTNVISTDNSKTNVISTD-NSKTNTI 346

 Score = 86 (30.3 bits), Expect = 3.7, P = 0.98
 Identities = 36/161 (22%), Positives = 63/161 (39%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKE-----TKRHDDNNNNNI 406
             D+ +T   S   +  DTI  + +N N ++ + +  N   I  +     TK  D+NNN N 
Sbjct:   339 DNSKTNTISTDNDNADTILTDNDN-NTDIILTDNNNTDTISTDNDNADTKATDNNNNTNT 397

Query:   405 NDGDEN--KFCFKENIK-KPNDIYNEDMENSERTKDTNC-----EYNKKKKDEDDEEICL 250
                D N  K    +N   K     N +  N++ T + N      + N  K    D     
Sbjct:   398 KATDNNNTKIISPDNNNTKTTSTDNNNNTNTKATDNNNTKTISTDNNNTKTISTDNNNTK 457

Query:   249 TSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSK 124
             T ST + ++    ND  +   +  D + N   +      +++
Sbjct:   458 TISTDNNNTKTISNDNNNTNTISTDNNNNNTNQYVFANNYNE 499


>gi|1294789 (L76261) ND3 gene product [Meloidogyne javanica]
            Length = 103

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.13, P = 0.12
 Identities = 25/83 (30%), Positives = 44/83 (53%), Frame = +1

Query:   232 RKSR*SK-TYFFIIFIFF--LFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPI 402
             +K++  K +YF   F +   L   ++I  F  + IF +F + +  F +I+F    I+  I
Sbjct:    20 KKNKLMKNSYFESGFNYLGKLLFSYSIHFFMIILIFILFDLELFLFLFIYFNLNLIYWMI 79

Query:   403 INIIIIVIIMTFCF-FTYIMIILF 471
               ++II I+MT    + YI +I F
Sbjct:    80 F-LLIIFIMMTLVLEWKYIKLIWF 102

 Score = 69 (24.3 bits), Expect = 5.4, P = 1.0
 Identities = 20/61 (32%), Positives = 33/61 (54%), Frame = +1

Query:   331 HIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFF 510
             H F+I +I  F +F    F+F+ I   + ++  M F    +IM+ L   +K  YI +I+F
Sbjct:    47 HFFMIILI--FILFDLELFLFLFIYFNLNLIYWMIFLLIIFIMMTLVLEWK--YIKLIWF 102

Query:   511 L 513
             L
Sbjct:   103 L 103

 Score = 69 (24.3 bits), Expect = 5.4, P = 1.0
 Identities = 21/86 (24%), Positives = 42/86 (48%), Frame = +1

Query:   343 IYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYG 522
             ++I+ F  +FF   F F    N ++         F Y+  +LF +  H ++ I+ F+ + 
Sbjct:     1 MFIVIFSLVFFFVTFFFNKKKNKLMKNSYFE-SGFNYLGKLLFSYSIHFFMIILIFILFD 59

Query:   523 I---IFIYAL*TFNSLY-MIHIITIII 591
             +   +F++     N +Y MI ++ I I
Sbjct:    60 LELFLFLFIYFNLNLIYWMIFLLIIFI 86


>gi|160385 (M63277) malaria antigen [Plasmodium falciparum]
           Length = 232

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.13, P = 0.12
 Identities = 35/124 (28%), Positives = 64/124 (51%), Frame = -1

Query:   420 NNNNINDGDENKF--CFK-ENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICL 250
             NN  IN+GD +K     K ++I   +++ N+D+ N ER  + + E  K++K++ +E    
Sbjct:     3 NNGMINEGDNDKIEDTNKNDDISNNSEVTNKDIINGERNSNDSEEKEKEEKEDYNEN--- 59

Query:   249 TSSTLST-SSVGTQNDAGHQI------YVRLDGSTNTIERQKIIKRFSKDENIFVFLLST 91
             T + ++T ++    ND   QI      Y+ L+ + N I ++  I     + N   F L  
Sbjct:    60 TYNNMNTDNNTSNSNDDNEQIINNENDYI-LNKTNNEINKE--INTSINEFNDIAFQLCP 116

Query:    90 KAGGVGLNLI 61
                G+  NL+
Sbjct:   117 WKKGIQWNLL 126


>gi|1022918 (U38184) ATPase subunit 6 [Trypanosoma cruzi]
            Length = 233

  Plus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.13, P = 0.12
 Identities = 23/129 (17%), Positives = 59/129 (45%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII---IIVII 429
             F I+F++++  +F  C      +F+  ++   +    F +    F+   +++   +   +
Sbjct:    86 FCIVFLYYMSFLFLFCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSLLCRCLSTFL 145

Query:   430 MTFC--FFTYIMIILFF-FYKHIYIYIIFF--------LTYGIIFIYAL*TFNSLYMIHI 576
               FC    ++ ++++FF F    +++ IFF        + +  +F + L  +  LY++ +
Sbjct:   146 RLFCNLLSSHFLLLMFFDFLYFFFVFFIFFCFLDFLVFILFIFVFCFCLLFYGFLYLLDL 205

Query:   577 ITIIIYKFI 603
                I+  FI
Sbjct:   206 FAAILQLFI 214

 Score = 88 (31.0 bits), Expect = 0.52, P = 0.40
 Identities = 27/117 (23%), Positives = 52/117 (44%), Frame = +1

Query:   271 FIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII--IIVIIMTFCF 444
             F+   FI F +C      +    +   +  F     + F+ +   + +    V  + FCF
Sbjct:   118 FMDVFFIRFLLCFLECFSLLCRCLSTFLRLFCNLLSSHFLLLMFFDFLYFFFVFFIFFCF 177

Query:   445 FTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGLLY 621
               +++ ILF F   ++ + + F  YG  F+Y L  F ++  + I   +I + I   LL+
Sbjct:   178 LDFLVFILFIF---VFCFCLLF--YG--FLYLLDLFAAILQLFIFCNMILQLIMDFLLF 229

 Score = 85 (29.9 bits), Expect = 1.2, P = 0.69
 Identities = 19/95 (20%), Positives = 54/95 (56%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHI--FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             +IF F LF +F +  F  L +F +  F+++ ++   +++   ++ + ++  I+ +  M+F
Sbjct:    37 LIFDFLLFCLFDLYSFIGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLYYMSF 96

Query:   439 CFFTYIMIILFFFYKHIYI---YI-IFFLTYGIIFI 534
              F  +  ++ FF + ++ +   ++ +FF+ + + F+
Sbjct:    97 LFL-FCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFL 131

 Score = 80 (28.2 bits), Expect = 4.4, P = 0.99
 Identities = 20/72 (27%), Positives = 35/72 (48%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             +FF+ FIFF F+ F + I     +F IF+      FY F     +F  I+ + I   ++ 
Sbjct:   167 FFFVFFIFFCFLDFLVFI-----LF-IFVFCFCLLFYGFLYLLDLFAAILQLFIFCNMIL 220

Query:   436 FCFFTYIMIILF 471
                  +++ +LF
Sbjct:   221 QLIMDFLLFLLF 232

 Score = 79 (27.8 bits), Expect = 5.7, P = 1.0
 Identities = 23/71 (32%), Positives = 36/71 (50%), Frame = +2

Query:   341 LYISFGFFIFSLKQNLFSSPSLILLLLLSS*RFVSLPIS**FCSSFINTFTFILFSSLHM 520
             L + F F +F L  +L+S   L L LLL    F    +   +C +++N +       L+ 
Sbjct:    35 LLLIFDFLLFCLF-DLYSFIGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLYY 93

Query:   521 VSFLFMLCELL 553
             +SFLF+ C LL
Sbjct:    94 MSFLFLFCFLL 104

 Score = 78 (27.5 bits), Expect = 7.6, P = 1.0
 Identities = 22/93 (23%), Positives = 47/93 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII--IIVI 426
             FF   +F+L ++  +  C++S L     F++Y      IF    F    + + I   + +
Sbjct:     4 FFFCDLFWLRLLLWLYYCVWSRL----CFVVYFNCLLLIFDFLLFCLFDLYSFIGLCLFL 59

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIY 537
             ++ F  F    +IL++   ++ +Y++F     I+F+Y
Sbjct:    60 LLWFMLFNLYSLILYYCITYLNLYLLFC----IVFLY 92

 Score = 78 (27.5 bits), Expect = 7.6, P = 1.0
 Identities = 25/94 (26%), Positives = 43/94 (45%), Frame = +1

Query:   259 FFIIFIF-FL--FIIFTICIFSSL*IF------HIFIIYI---IWFFYIFFKTKFIFIPI 402
             FFI F+  FL  F +   C+ + L +F      H  ++     ++FF++FF   F F+  
Sbjct:   122 FFIRFLLCFLECFSLLCRCLSTFLRLFCNLLSSHFLLLMFFDFLYFFFVFF-IFFCFLDF 180

Query:   403 INIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIF 507
             +  I+ + +  FC   Y  + L   +  I    IF
Sbjct:   181 LVFILFIFVFCFCLLFYGFLYLLDLFAAILQLFIF 215

 Score = 77 (27.1 bits), Expect = 9.9, P = 1.0
 Identities = 27/124 (21%), Positives = 60/124 (48%), Frame = +1

Query:   259 FFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII--IIVI 426
             FF   +F+L ++  +  C++S L     F++Y      IF    F    + + I   + +
Sbjct:     4 FFFCDLFWLRLLLWLYYCVWSRL----CFVVYFNCLLLIFDFLLFCLFDLYSFIGLCLFL 59

Query:   427 IMTFCFFTYIMIILFFFYKHIYIYIIF---FLTY-GIIFIYAL*T----FNSLYM-IHII 579
             ++ F  F    +IL++   ++ +Y++F   FL Y   +F++        FN+L +  + +
Sbjct:    60 LLWFMLFNLYSLILYYCITYLNLYLLFCIVFLYYMSFLFLFCFLLDFFLFNNLLVGDNFM 119

Query:   580 TIIIYKFI 603
              +   +F+
Sbjct:   120 DVFFIRFL 127


>gi|2447053 (U42580) similar to Caenorhabditis transcription activator,
            corresponds to Swiss-Prot Accession Number P41877 [Paramecium
            bursaria Chlorella virus 1]
            Length = 458

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.15, P = 0.14
 Identities = 21/54 (38%), Positives = 33/54 (61%), Frame = -1

Query:   201 GHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVIL 40
             GH+  V L+G T   +R   IK F++D +I  F++  ++GG+GLNL  A  V +
Sbjct:   322 GHKS-VTLNGKTPNSQRDVNIKSFNEDNDINFFIIQIESGGIGLNLQVATRVFI 374


>sp|P28370|SN21_HUMAN POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L1
            >pir||S35457 SNF2 protein homolog - human >gi|292496 (M88163)
            transcription activator [Homo sapiens]
            Length = 976

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.16, Sum P(2) = 0.15
 Identities = 27/68 (39%), Positives = 42/68 (61%), Frame = -1

Query:   201 GHQIYVRLDGSTNTIERQ------------KIIKRFSK-DENIFVFLLSTKAGGVGLNLI 61
             G++ Y RLDG T   ER+            + I+ F+  + + F+F+LST+AGG+G+NL 
Sbjct:   448 GYE-YCRLDGQTPHEEREDKFLEVEFLGQREAIEAFNAPNSSKFIFMLSTRAGGLGINLA 506

Query:    60 AANHVILMD 34
             +A+ VIL D
Sbjct:   507 SADVVILYD 515

 Score = 49 (17.2 bits), Expect = 0.16, Sum P(2) = 0.15
 Identities = 9/19 (47%), Positives = 14/19 (73%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEALLY 601
             +IFSQ T  LDI+E+  ++
Sbjct:   428 LIFSQMTRLLDILEDYCMW 446


>pir||S23692 hypothetical protein 9 - Plasmodium falciparum
            Length = 518

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.17, P = 0.16
 Identities = 26/87 (29%), Positives = 41/87 (47%), Frame = -1

Query:   537 INKNDTIC--KEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENI 364
             +NK+D  C  K  N  N N   K   N ++  K    +++NN NN N+ + NK     N 
Sbjct:   325 VNKDDDRCIRKNMNPNNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNN 384

Query:   363 K-KPNDIYNEDMENSERTKDTNCEYNK 286
               K ND  N + +N++     N +Y +
Sbjct:   385 NNKNNDNNNNNNKNNDNNNGDNVDYEE 411

 Score = 94 (33.1 bits), Expect = 0.38, P = 0.32
 Identities = 22/72 (30%), Positives = 34/72 (47%), Frame = -1

Query:   480 IKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTN 301
             I++  N ++     K +D+NNNNN N+ D N    K N    N+  N D  N+    + N
Sbjct:   333 IRKNMNPNNNNNNNKNNDNNNNNNKNN-DNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDN 391

Query:   300 CEYNKKKKDEDD 265
                N K  D ++
Sbjct:   392 NNNNNKNNDNNN 403

 Score = 85 (29.9 bits), Expect = 4.0, P = 0.98
 Identities = 27/110 (24%), Positives = 45/110 (40%), Frame = -1

Query:   648 SQFTTFLDIIEEALLYEFIYDDSDYMDHIQTIKSS-QSINKNDTICKEENNINVNVFIKE 472
             S +   +D+  + L+   ++  S  M+++   K   + I KN       NN   N     
Sbjct:   296 SNWQAIIDLSSQCLVLPKMFWLS-LMEYLPVNKDDDRCIRKNMNPNNNNNNNKNNDNNNN 354

Query:   471 EQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSE 319
                 +D      +++DNNNNN  + D N    K N    N+  N D  N +
Sbjct:   355 NNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNGD 405

 Score = 83 (29.2 bits), Expect = 6.7, P = 1.0
 Identities = 24/91 (26%), Positives = 42/91 (46%), Frame = -1

Query:   543 QSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENI 364
             +++N N+     +NN N N   K   N ++  K    +++NN NN N+ + NK     N 
Sbjct:   335 KNMNPNNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNNNNKNNDNNNN 394

Query:   363 K-KPNDIYNED-MENSERTKDTNCEYNKKKK 277
               K ND  N D ++  E +    C  + + +
Sbjct:   395 NNKNNDNNNGDNVDYEENSLPRMCSVDHRNR 425


>gi|343544 (M33228) ATPase 6 [Trypanosoma brucei]
           Length = 231

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.17, P = 0.16
 Identities = 32/120 (26%), Positives = 64/120 (53%), Frame = +1

Query:   256 YFFIIFIF-FL--FIIFTICIF--SSL*IFHI-FIIYIIWFFYIFFKTKFIFIPII-NII 414
             Y   +F+F FL  F +F   +   S + +F I F++  +  F +  +    F+ +  N++
Sbjct:    93 YIAFLFLFCFLCDFFLFNNLLVGDSFMDVFFIRFLLCFLECFSLLCRCLSTFLRLFCNLL 152

Query:   415 I--IVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITII 588
                 +++M F FF +I +  FFFY  ++ Y  +F+ +  +F + L  +  LY++ +   I
Sbjct:   153 SSHFLLLMFFDFFYFIFV--FFFYG-VFCY--WFILFIFVFCFCLLFYVFLYLLDLFAAI 207

Query:   589 IYKFI 603
             +  FI
Sbjct:   208 LQLFI 212

 Score = 84 (29.6 bits), Expect = 1.5, P = 0.78
 Identities = 18/95 (18%), Positives = 54/95 (56%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHI--FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             +IF F LF +F + +F  L +F +  F+++ ++   +++   ++ + ++  I+ ++ + F
Sbjct:    37 LIFDFLLFCLFDLYLFVGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAF 96

Query:   439 CFFTYIMIILFFFYKHIYI---YI-IFFLTYGIIFI 534
              F  +  +  FF + ++ +   ++ +FF+ + + F+
Sbjct:    97 LFL-FCFLCDFFLFNNLLVGDSFMDVFFIRFLLCFL 131

 Score = 83 (29.2 bits), Expect = 2.0, P = 0.86
 Identities = 17/70 (24%), Positives = 32/70 (45%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFC 441
             F  F +F+F+ F   +F    I  IF+      FY+F     +F  I+ + I   ++   
Sbjct:   161 FFDFFYFIFVFFFYGVFCYWFILFIFVFCFCLLFYVFLYLLDLFAAILQLFIFCNMILQL 220

Query:   442 FFTYIMIILF 471
                +++ +LF
Sbjct:   221 IMDFLLFLLF 230

 Score = 82 (28.9 bits), Expect = 2.5, P = 0.92
 Identities = 30/122 (24%), Positives = 58/122 (47%), Frame = +1

Query:   259 FFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             FF   +F+L ++  +  C++S L     FI+Y      IF    F+   + ++ + V + 
Sbjct:     4 FFFCDLFWLRLLLCMYYCVWSRL----CFIVYFNCLMLIF---DFLLFCLFDLYLFVGL- 55

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QG 612
               C F  +  +LF  Y  I  Y I +L      +Y L  F  +++++I  + ++ F+   
Sbjct:    56 --CLFLLLWFMLFNLYSLILYYCITYLN-----LYLL--FCIVFLLYIAFLFLFCFLCDF 106

Query:   613 LLYN 624
              L+N
Sbjct:   107 FLFN 110


>pir||S34960 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - Crithidia
            oncopelti mitochondrion (SGC6) >gi|12882 (X56015) NADH
            dehydrogenase subunit 5 [Crithidia oncopelti]
            Length = 590

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.18, Sum P(2) = 0.17
 Identities = 31/113 (27%), Positives = 50/113 (44%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y   I IFF+     I +FSS  +F  F +Y   FF I   T F+ I +  I    ++  
Sbjct:   464 YMCFILIFFVIDFLYIFVFSSYCMFWSFYLYYFNFFDIASFTVFVMISLAFIYYGCVL-- 521

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             F FF    I+LF+    I++ I     +G+   +    F    ++ +   +IY
Sbjct:   522 FYFFNVDCIMLFW---RIFLIICVTFMFGLFSCWYFACFFIYLLLFVWNFVIY 571

 Score = 97 (34.1 bits), Expect = 0.18, Sum P(2) = 0.17
 Identities = 33/125 (26%), Positives = 59/125 (47%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y   I IFF+     I +FSS  +F  F +Y   FF I   T F+ I +  I    ++  
Sbjct:   464 YMCFILIFFVIDFLYIFVFSSYCMFWSFYLYYFNFFDIASFTVFVMISLAFIYYGCVL-- 521

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QGL 615
             F FF    I+LF+    I++ I     +G+   +    + + + I+++ + ++ F+    
Sbjct:   522 FYFFNVDCIMLFW---RIFLIICVTFMFGLFSCW----YFACFFIYLL-LFVWNFVIY-F 572

Query:   616 LYNIK 630
              YN+K
Sbjct:   573 RYNLK 577

 Score = 96 (33.8 bits), Expect = 0.24, Sum P(2) = 0.21
 Identities = 32/122 (26%), Positives = 67/122 (54%), Frame = +1

Query:   265 IIFIFF-LFIIFTICIFSSL*IFHIFII--Y-IIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             +I+ F  L++ F I IF  +   +IF+   Y + W FY+++   F F  I +  + V+I 
Sbjct:   456 LIYCFLGLYMCF-ILIFFVIDFLYIFVFSSYCMFWSFYLYY---FNFFDIASFTVFVMI- 510

Query:   433 TFCFFTYIMIILFFFYKH-IYIYIIFFLTYGIIFIYAL*T--FNSLYMIHIITIIIYKFI 603
             +  F  Y  ++ +FF    I ++   FL   + F++ L +  + + + I+++ + ++ F+
Sbjct:   511 SLAFIYYGCVLFYFFNVDCIMLFWRIFLIICVTFMFGLFSCWYFACFFIYLL-LFVWNFV 569

Query:   604 *QGLLYNIK 630
                  YN+K
Sbjct:   570 IY-FRYNLK 577

 Score = 91 (32.0 bits), Expect = 0.99, P = 0.63
 Identities = 27/97 (27%), Positives = 48/97 (49%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             YF + F+ F+F  F +  C+F  L  F   +IY     Y+ F    IF  +I+ + I + 
Sbjct:   427 YFLLFFLCFVFKCFCLADCLFL-LFDFECCLIYCFLGLYMCFI--LIFF-VIDFLYIFVF 482

Query:   430 MTFCFFTYIMIILFFFYK----HIYIYI-IFFLTYGIIFIY 537
              ++C F    +  F F+      +++ I + F+ YG +  Y
Sbjct:   483 SSYCMFWSFYLYYFNFFDIASFTVFVMISLAFIYYGCVLFY 523

 Score = 90 (31.7 bits), Expect = 1.3, P = 0.72
 Identities = 27/113 (23%), Positives = 48/113 (42%), Frame = +1

Query:   253 TYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIII-IVII 429
             T   + F F L  +F +CIF     F +   Y + FF  F    F     + ++      
Sbjct:   399 TLMLVSFHFILEFLF-VCIFFIF--FTVIYNYFLLFFLCFVFKCFCLADCLFLLFDFECC 455

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
             + +CF    M  +  F+   ++YI  F +Y + + + L  FN  + I   T+ +
Sbjct:   456 LIYCFLGLYMCFILIFFVIDFLYIFVFSSYCMFWSFYLYYFN-FFDIASFTVFV 508

 Score = 88 (31.0 bits), Expect = 2.2, P = 0.88
 Identities = 27/94 (28%), Positives = 46/94 (48%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTI--CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVII 429
             YF + F+ F+F  F +  C+F  L  F   +IY     Y+ F    IF  +I+ + I + 
Sbjct:   427 YFLLFFLCFVFKCFCLADCLFL-LFDFECCLIYCFLGLYMCFI--LIFF-VIDFLYIFVF 482

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIY 537
              ++C F    +  F F+  I  + +F +   + FIY
Sbjct:   483 SSYCMFWSFYLYYFNFFD-IASFTVFVMI-SLAFIY 516

 Score = 87 (30.6 bits), Expect = 2.8, P = 0.94
 Identities = 30/113 (26%), Positives = 57/113 (50%), Frame = +1

Query:   256 YFFIIFIFFLF---IIFTICIFSSL*IFHIFIIYIIW--FFYIFFKTKFIFIPIINIIII 420
             +F +   FF+     +   C +  L +F  F+I   W  FF + F  K  FI  I  +++
Sbjct:   119 WFVLCMNFFILSYDYLTAYCGWELLGLFSFFLISYFWYRFFALKFGFKSFFISKIGDVLL 178

Query:   421 VI--IMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TF--NSLYMIHI 576
             ++  +MTF    Y MI  F+F    ++ + F+ T  ++F+  +  F  ++ + +HI
Sbjct:   179 LLSFVMTFISTGYGMIN-FYFVN--FLCVDFYFTAFMLFLLIMCAFTKSTQFGLHI 231

 Score = 39 (13.7 bits), Expect = 0.18, Sum P(2) = 0.17
 Identities = 9/23 (39%), Positives = 12/23 (52%), Frame = +1

Query:   145 FLSFNSVC*SIQSYINLMTCVIL 213
             FL F+  C  I  ++ L  C IL
Sbjct:   447 FLLFDFECCLIYCFLGLYMCFIL 469


>gi|1216394 (U40265) ATPase subunit 6 [Trypanosoma cruzi]
            Length = 174

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.19, P = 0.17
 Identities = 19/95 (20%), Positives = 55/95 (57%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHI--FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTF 438
             +IF F LF +F + +F  L +F +  F+++ ++   +++   ++ + ++  I+ +  M+F
Sbjct:    34 LIFDFLLFCLFDLYLFIGLCLFLLLWFMLFNLYSLILYYCITYLNLYLLFCIVFLYYMSF 93

Query:   439 CFFTYIMIILFFFYKHIYI---YI-IFFLTYGIIFI 534
              F  +  ++ FF + ++ +   ++ +FF+ + + F+
Sbjct:    94 LFL-FCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFL 128

 Score = 84 (29.6 bits), Expect = 0.77, P = 0.54
 Identities = 14/92 (15%), Positives = 44/92 (47%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINII---IIVII 429
             F I+F++++  +F  C      +F+  ++   +    F +    F+   +++       +
Sbjct:    83 FCIVFLYYMSFLFLFCFLLDFFLFNNLLVGDNFMDVFFIRFLLCFLECFSLLCRCFATFL 142

Query:   430 MTFC--FFTYIMIILFFFYKHIYIYIIFFLTY 519
               FC    ++ ++++FF + + +++ +FF  +
Sbjct:   143 RLFCNLLSSHFLLLMFFDFLYFFLFFLFFFVF 174

 Score = 75 (26.4 bits), Expect = 9.2, P = 1.0
 Identities = 23/71 (32%), Positives = 34/71 (47%), Frame = +2

Query:   341 LYISFGFFIFSLKQ-NLFSSPSLILLLLLSS*RFVSLPIS**FCSSFINTFTFILFSSLH 517
             L + F F +F L    LF    L LLL        SL +   +C +++N +       L+
Sbjct:    32 LLLIFDFLLFCLFDLYLFIGLCLFLLLWFMLFNLYSLILY--YCITYLNLYLLFCIVFLY 89

Query:   518 MVSFLFMLCELL 553
              +SFLF+ C LL
Sbjct:    90 YMSFLFLFCFLL 101


>pir||S54157 extensin-like protein - cowpea (fragment)
            Length = 279

  Plus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.19, P = 0.17
 Identities = 30/95 (31%), Positives = 50/95 (52%), Frame = +3

Query:   255 IFLHHLHL-FSFYYIHNLYL*F-SLNFPYL-HYIYHLVFLYFL*NKIYFHPHH*YYYYCY 425
             + LHHLH+  S ++ H L+L   +   P+L H + H + ++   + ++  PHH       
Sbjct:   158 LLLHHLHMCISHHHHHLLHLRLPTFTSPHLLHLLPHHLPMFTSLHLLHLLPHHLPMCISP 217

Query:   426 HHDVLFLYLYHDNFVLLL*THLHLYYFLPYIWYHFYLC 539
             HH  L   L+H    LL+ T  HL + LP+   H ++C
Sbjct:   218 HHHHL---LHHH---LLMFTSHHLLHLLPH---HLHMC 246

 Score = 79 (27.8 bits), Expect = 7.8, P = 1.0
 Identities = 30/113 (26%), Positives = 53/113 (46%), Frame = +3

Query:   264 HHLHLFSFYYIHNL---YL*FSLNFPYLHYIYHLVFLYFL*NKIYFHPHH*YYYYCYHHD 434
             HHLH+    + H+L   +L    +   LH + H + ++   + ++  PHH       HH 
Sbjct:    38 HHLHMCISRHHHHLLHHHLLMFTSHHLLHLLPHHLPMFTSLHLLHLLPHHLPMCISPHHH 97

Query:   435 VLFLYLYHDNFVLLL*THLHLYYFLPYIWYHFYLCFVNF**FV-YDPYNHYHHI*IH 602
                 +L H +  LL+ T  HL + LP+   H ++C       +      H+HH+ +H
Sbjct:    98 ----HLLHRH--LLMFTSHHLLHLLPH---HLHMCISRHHHHLPMSTSPHHHHL-LH 144


>pir||S53808 hypothetical protein B - Acanthamoeba castellanii mitochondrion
            (SGC6) >gi|562062 (U12386) ORFB [Acanthamoeba castellanii]
            Length = 142

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.19, P = 0.17
 Identities = 29/91 (31%), Positives = 48/91 (52%), Frame = +1

Query:   256 YFFIIFIFF-LFII----FTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIII 420
             YF++   FF L+ +    F I +F +L + +I  IY IW+F+++   +F ++   N    
Sbjct:    13 YFWLTLFFFGLYFLSVNFFVILVFKNLKLRNI--IYKIWYFFLY---RFDYVDYNNKHKS 67

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGII 528
             ++  +F F  Y + I FF    I    IF  T  II
Sbjct:    68 LVNTSFSFIYYTLYINFFILTKINF--IFEKTKSII 101


>sp|P08116|PVA_PLAFA PROCESSED VARIABLE ANTIGEN >pir||A54517 variable antigen
            (clone Ag7) - Plasmodium falciparum (isolate FCQ27/PNG) (fragment)
            >gi|552170 (M15319) antigen [Plasmodium falciparum]
            Length = 224

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.21, P = 0.19
 Identities = 33/116 (28%), Positives = 53/116 (45%), Frame = -1

Query:   621 IEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKE 442
             I E   Y  I  +    ++++  + S+    N      EN+ N NV  + E+    + ++
Sbjct:   106 IYEETKYNKITSEFRETENVKITEESKDREGNKVSGPYENSENSNVTSESEET-KKLAEK 164

Query:   441 TKRHDDNNNNNINDG-DENKFCFKENIKKPNDIY-NEDMENSERTKDTNCEYNKKKKD 274
              +   +    N+NDG  EN     E+ KK  +   N   E+SE TKD   E N+KK D
Sbjct:   165 EENEGEKLGENVNDGASENS----EDPKKLTEQEENGTKESSEETKDDKPEENEKKAD 218


>pir||S51911 cryptogene protein G5(ND3) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 89

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.22, P = 0.19
 Identities = 18/72 (25%), Positives = 34/72 (47%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCF 444
             + F+ F  II  I     + ++ +  ++ +WF ++F     +F  I+  I   ++  F F
Sbjct:    18 LCFVMFYSIIGLILFLIVVVLYFMCKLFFVWFCFVFL----LFWSIVFNIWFCVLFVFIF 73

Query:   445 FTYIMIILFFFY 480
             F  I+I   F Y
Sbjct:    74 FLLILINSVFSY 85

 Score = 65 (22.9 bits), Expect = 1.6, P = 0.81
 Identities = 16/70 (22%), Positives = 38/70 (54%), Frame = +1

Query:   388 IFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYM 567
             +F  II +I+ +I++   F   +  + F F   ++  I+F + + ++F++    F  L +
Sbjct:    22 MFYSIIGLILFLIVVVLYFMCKLFFVWFCFVFLLFWSIVFNIWFCVLFVFI---FFLLIL 78

Query:   568 IH-IITIIIYK 597
             I+ + + +I K
Sbjct:    79 INSVFSYLILK 89

 Score = 64 (22.5 bits), Expect = 4.2, P = 0.99
 Identities = 15/67 (22%), Positives = 35/67 (52%), Frame = +1

Query:   388 IFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYA---L*TFNS 558
             +F  II +I+ +I++   F   +  + F F   ++  I+F + + ++F++    L   NS
Sbjct:    22 MFYSIIGLILFLIVVVLYFMCKLFFVWFCFVFLLFWSIVFNIWFCVLFVFIFFLLILINS 81

Query:   559 LYMIHII 579
             ++   I+
Sbjct:    82 VFSYLIL 88


>gnl|PID|e220245 (X95275) frameshift [Plasmodium falciparum]
            Length = 960

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.22, P = 0.20
 Identities = 43/129 (33%), Positives = 70/129 (54%), Frame = +1

Query:   277 FFLFIIFTICIFSSL*IFH-IFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTY 453
             +F  + F +  F+++ I + +F +  I+ +Y + K  FI++ IIN III   + F  +TY
Sbjct:   522 YFKKMNFILKNFNNIQILNKLFYVNNIFIYYKYEKKLFIYLNIINNIIIKKYLNFYKYTY 581

Query:   454 IMIILFFFYKH---IYIYIIFFLTYGIIFIYAL*TFNSLYMIHII--TII--IYKFI*QG 612
                 LFF  K+   +Y+Y IF   +   + Y L   N+ Y ++II    I  +YK+    
Sbjct:   582 NK--LFFIKKYNNFLYLYEIFKYNW---YKYLL--LNNKYNLYIIYNNYIKYLYKYNINI 634

Query:   613 LLYNIKKSSKL*KNNTF 663
              LY IK  +    NN F
Sbjct:   635 NLYFIK--NLFYNNNNF 649

 Score = 87 (30.6 bits), Expect = 5.0, P = 0.99
 Identities = 35/134 (26%), Positives = 69/134 (51%), Frame = +3

Query:   180 ILHKFDDLRHFVYQQMR*KESMK*DIFLHHLHLFSFY-YI-----HNLYL*FSLNFPYLH 341
             I+ K+ +   + Y ++   +     ++L+ +  +++Y Y+     +NLY+ ++    YL 
Sbjct:   569 IIKKYLNFYKYTYNKLFFIKKYNNFLYLYEIFKYNWYKYLLLNNKYNLYIIYNNYIKYL- 627

Query:   342 YIYHL-VFLYFL*NKIY-----FHPHH*YY--YYCYHHDVLFLYLYHDNFVLLL*THLHL 497
             Y Y++ + LYF+ N  Y      H H  Y   YY Y+++ + LY Y+ N +L+    L+ 
Sbjct:   628 YKYNININLYFIKNLFYNNNNFIHNHIIYKNNYYIYNNN-MNLYQYNKN-ILINNNLLYN 685

Query:   498 YYFLPYIWYHFYLCFVN 548
               F  YI  + Y  ++N
Sbjct:   686 KLFYNYINNNIYNLYLN 702


>pir||S50977 hypothetical protein YDL005c - yeast (Saccharomyces cerevisiae)
            >gi|642801 (Z48008) unknown [Saccharomyces cerevisiae] >gi|683692
            (Z48432) unknown [Saccharomyces cerevisiae] >gnl|PID|e252970
            (Z74053) ORF YDL005c [Saccharomyces cerevisiae]
            Length = 431

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.23, P = 0.20
 Identities = 39/131 (29%), Positives = 61/131 (46%), Frame = -1

Query:   591 YDDSD----YMD-HIQTIKSS--QSIN--KNDTICKEENNINVNVFIKEEQNYHDIGKET 439
             +DD+D    Y D +I +I+++   +IN  KN      E+N N N   K + N  D     
Sbjct:   261 FDDNDSGNNYNDINISSIENNINNNINSTKNGKDNNNESNKNNNGDEKNKNNNEDNENNN 320

Query:   438 KRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
                + NNNNN N+ + N     +N    N+    D  N+    D+N + N      D+E 
Sbjct:   321 NSSEKNNNNNNNNNNNND----DNGNNNNNNSGND-NNNTTNNDSNNKNNSITTGNDNEN 375

Query:   258 ICLTSSTLSTSSVGTQND 205
             I   ++ L T+ V    D
Sbjct:   376 I--VNNDLPTTVVSNPGD 391

 Score = 89 (31.3 bits), Expect = 1.1, P = 0.67
 Identities = 34/118 (28%), Positives = 49/118 (41%), Frame = -1

Query:   552 KSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFK 373
             K++   N+N+    E+NN N N       N  D G     +  N+NNN  + D N    K
Sbjct:   310 KNNNEDNENNNNSSEKNNNNNN---NNNNNNDDNGNNNNNNSGNDNNNTTNNDSNN---K 363

Query:   372 EN-IKKPNDIYNEDMENSE--RTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDA 202
              N I   ND  NE++ N++   T  +N   N    D  +E + L           T  D 
Sbjct:   364 NNSITTGND--NENIVNNDLPTTVVSNPGDNPPPADNGEEYLTLNDFNDLNIDWSTTGDN 421

Query:   201 G 199
             G
Sbjct:   422 G 422

 Score = 86 (30.3 bits), Expect = 2.4, P = 0.91
 Identities = 28/101 (27%), Positives = 46/101 (45%), Frame = -1

Query:   546 SQSINKNDTICKEENNINVNVFIKEEQNYHDIGK------ETKRHDDNNNNNINDGDENK 385
             SQ    +D +  + N++++++F   +    D         ETK  DDN++ N N  D N 
Sbjct:   217 SQQAQPSDVMFNDLNSMDISMFSGLDSTGFDSTAFNATVDETKGFDDNDSGN-NYNDINI 275

Query:   384 FCFKENIKKP-NDIYNEDMENSERTKDTNCEYNKKKKDEDDE 262
                + NI    N   N    N+E  K+ N +   K  +ED+E
Sbjct:   276 SSIENNINNNINSTKNGKDNNNESNKNNNGDEKNKNNNEDNE 317


>sp|P54673|P3K1_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 1 (PI3-KINASE)
            (PTDINS-3-KINASE) (PI3K) >gi|733520 (U23476)
            phosphatidylinositol-4,5-diphosphate 3-kinase [Dictyostelium
            discoideum]
            Length = 1570

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.23, P = 0.20
 Identities = 39/126 (30%), Positives = 64/126 (50%), Frame = -1

Query:   573 MDHIQTIKS-SQSINKNDTICKEENNINVNVFIKEEQNYHDIGKE--TKRHDDNNNNNIN 403
             M+ I++  + S  INKN      +NN ++N       NY++I K   T  +++NN+NNI 
Sbjct:     1 MNSIESSSNDSNEINKNSN----KNNTHLN------SNYNNIYKNNSTSSNNNNNHNNIE 50

Query:   402 D-GDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTS 226
               G +N    K N K  ND  N +    ++ KD+  + N++   E  E   + +S  S  
Sbjct:    51 IIGIDNN---KNNNKNNNDNNNNNNNIDKKRKDSKNKQNQEINQEMSENKKIYNSNDSNC 107

Query:   225 SVGTQNDAGH 196
             S G+ +  GH
Sbjct:   108 SSGSSS-GGH 116

 Score = 101 (35.6 bits), Expect = 0.23, P = 0.20
 Identities = 46/147 (31%), Positives = 75/147 (51%), Frame = -1

Query:   573 MDHIQTIKS-SQSINKNDTICKEENNINVNVFIKEEQNYHDIGKE--TKRHDDNNNNNIN 403
             M+ I++  + S  INKN      +NN ++N       NY++I K   T  +++NN+NNI 
Sbjct:     1 MNSIESSSNDSNEINKNSN----KNNTHLN------SNYNNIYKNNSTSSNNNNNHNNIE 50

Query:   402 D-GDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTS 226
               G +N    K N K  ND  N +    ++ KD+  + N++   E  E   + +S  S  
Sbjct:    51 IIGIDNN---KNNNKNNNDNNNNNNNIDKKRKDSKNKQNQEINQEMSENKKIYNSNDSNC 107

Query:   225 SVGTQNDA----GHQIYV----RLDGSTNTIERQKIIKR 133
             S G+ +      GH I +    RL+     I  Q+I K+
Sbjct:   108 SSGSSSGGHVNNGHHILIEENERLEHENQEI--QEIYKQ 144


>gi|1448983 (L77907) chromodomain-helicase-DNA-binding protein [Drosophila
            melanogaster]
            Length = 1883

  Minus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.27, Sum P(2) = 0.24
 Identities = 24/56 (42%), Positives = 35/56 (62%), Frame = -1

Query:   198 HQIYVRLDGSTNTIERQKIIKRFSKD-ENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             H  + RLDGS     R++ +  F+ +    F FLLST+AGG+G+NL  A+ VI+ D
Sbjct:   876 HFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFD 931

 Score = 38 (13.4 bits), Expect = 0.27, Sum P(2) = 0.24
 Identities = 7/17 (41%), Positives = 11/17 (64%), Frame = -1

Query:   657 IIFSQFTTFLDIIEEAL 607
             +IFSQ    LD++ + L
Sbjct:   856 LIFSQMVRMLDVLADYL 872

 Score = 38 (13.4 bits), Expect = 0.27, Sum P(2) = 0.24
 Identities = 10/24 (41%), Positives = 13/24 (54%), Frame = -1

Query:   324 SERTKDTNCEYNKKK---KDEDDE 262
             +E++K      NKKK    DE DE
Sbjct:   195 AEKSKKAPAPKNKKKTWDSDESDE 218


>gi|453517 (L28677) ORF3 [Tetrahymena pyriformis]
           Length = 98

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.28, P = 0.24
 Identities = 13/38 (34%), Positives = 22/38 (57%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYI 369
             Y F+IFI FLF++     F  L  FH+ + Y++  + +
Sbjct:     3 YHFLIFINFLFLLIFYFFFEILIKFHMIVYYLLLLYVV 40

 Score = 67 (23.6 bits), Expect = 6.9, P = 1.0
 Identities = 23/75 (30%), Positives = 38/75 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y F+IFI FLF++     F  L  FH+ + Y++   Y+          +INI++I +   
Sbjct:     3 YHFLIFINFLFLLIFYFFFEILIKFHMIVYYLL-LLYV----------VINIMMISLNNN 51

Query:   436 ----FCFFTYIMIILFFFY 480
                 F     I ++LFF +
Sbjct:    52 KNNKFNLKYNIFMMLFFMF 70


>pir||S23689 hypothetical protein 6 - Plasmodium falciparum
            Length = 78

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.28, P = 0.24
 Identities = 16/53 (30%), Positives = 25/53 (47%), Frame = -1

Query:   534 NKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCF 376
             N N+   K  NN N N       N ++   +   +++NN NN N+ + N  CF
Sbjct:     5 NNNNNNNKNNNNNNKN---NNNNNNNNNNNKNNNNNNNNKNNNNNNNNNNDCF 54

 Score = 65 (22.9 bits), Expect = 1.6, P = 0.81
 Identities = 15/45 (33%), Positives = 23/45 (51%), Frame = -1

Query:   534 NKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNIND 400
             NKN+    + NN N N       N ++      ++++NNNNN ND
Sbjct:    11 NKNNNNNNKNNNNNNN---NNNNNKNNNNNNNNKNNNNNNNNNND 52

 Score = 65 (22.9 bits), Expect = 1.6, P = 0.81
 Identities = 15/48 (31%), Positives = 25/48 (52%), Frame = -1

Query:   432 HDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYN 289
             +++NNNNN N+ + NK     N    N+  N++  N+   K+ N   N
Sbjct:     4 NNNNNNNNKNNNNNNK---NNNNNNNNNNNNKNNNNNNNNKNNNNNNN 48

 Score = 62 (21.8 bits), Expect = 3.5, P = 0.97
 Identities = 15/49 (30%), Positives = 25/49 (51%), Frame = -1

Query:   465 NYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSE 319
             N ++  K    ++ NNNNN N+ + NK     N  K N+  N +  N++
Sbjct:     6 NNNNNNKNNNNNNKNNNNNNNNNNNNKNNNNNNNNKNNN--NNNNNNND 52

 Score = 62 (21.8 bits), Expect = 3.5, P = 0.97
 Identities = 13/51 (25%), Positives = 21/51 (41%), Frame = -1

Query:   450 GKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNC 298
             G     +++ NNNN N  + N      N K  N+  N    N+    + +C
Sbjct:     3 GNNNNNNNNKNNNNNNKNNNNNNNNNNNNKNNNNNNNNKNNNNNNNNNNDC 53


>pir||S49604 hypothetical protein 126 - euglenid (Astasia longa)
            >gnl|PID|e156256 (X82630) ata start [Astasia longa]
            Length = 125

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.28, P = 0.24
 Identities = 33/108 (30%), Positives = 54/108 (50%), Frame = +1

Query:   280 FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIM 459
             F  IIFT  +  SL  F   ++Y+I+ +    K+K  F   +N+ I++   T     + +
Sbjct:    18 FYKIIFTP-VNLSL-FFCFLVLYMIYSYVKDKKSKRYFDYRVNLYIVIGFWTRFGIRFGI 75

Query:   460 IILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSL-YMIHIITIIIYKFI 603
               L F  K+I+ +I   L Y   FI+++  F SL + I I   II  +I
Sbjct:    76 RFLIFILKYIFYFIFDILCYIYWFIFSI--FLSLIFNIFIYVKIILLYI 122

 Score = 72 (25.3 bits), Expect = 7.5, P = 1.0
 Identities = 14/48 (29%), Positives = 26/48 (54%), Frame = +1

Query:   364 YIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIF 507
             ++ F  K+IF  I +I+  +    F  F  ++  +F + K I +YI+F
Sbjct:    77 FLIFILKYIFYFIFDILCYIYWFIFSIFLSLIFNIFIYVKIILLYIVF 124


>sp|P27625|RPC1_PLAFA DNA-DIRECTED RNA POLYMERASE III LARGEST SUBUNIT
            >gi|160596 (M73770) RNA polymerase III largest subunit [Plasmodium
            falciparum]
            Length = 2339

  Minus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.32, Sum P(2) = 0.27
 Identities = 34/125 (27%), Positives = 60/125 (48%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNV 484
             +SII++  +   +I         I++++  M++I    S++SI  N       N+ N+N 
Sbjct:  1088 RSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHN-------NDSNMNS 1140

Query:   483 FIKEEQNYHDIGKETKRHDDNNN-NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKD 307
                 + N + I      H++N+N NNI++ D N+     N    N I+N D  N+   KD
Sbjct:  1141 IHNNDSNMNSI------HNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSNNNNNYKD 1194

Query:   306 TNCEYN 289
               C +N
Sbjct:  1195 --CTHN 1198

 Score = 99 (34.8 bits), Expect = 0.59, P = 0.44
 Identities = 33/131 (25%), Positives = 62/131 (47%), Frame = -1

Query:   576 YMDHIQTIKSSQSINKNDTICKEENNINVN-----VFIKEEQNYHDIGKETKR----HDD 424
             Y+ H+Q    +++ N N+ I    NNIN N     +    + N ++I          H++
Sbjct:  1058 YLPHVQ--HQNKTSNMNN-IYNNMNNINNNDSNRSIIYNNDSNMNNINNNDSNMNSIHNN 1114

Query:   423 NNN-NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLT 247
             N+N NNI++ D N+     N    N I+N D  N     + N   N    ++ +  I + 
Sbjct:  1115 NSNMNNIHNNDSNRSIIHNNDSNMNSIHNND-SNMNSIHNNNSNMNNIHNNDSNRSI-IH 1172

Query:   246 SSTLSTSSVGTQNDAGH 196
             ++  + +S+   ND+ +
Sbjct:  1173 NNDSNMNSIHN-NDSNN 1188

 Score = 97 (34.1 bits), Expect = 0.99, P = 0.63
 Identities = 36/140 (25%), Positives = 58/140 (41%), Frame = -1

Query:   576 YMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDG 397
             Y + I  +   Q  NK   +    NN+N N+      N +D  +    ++D+N NNIN+ 
Sbjct:  1052 YKNKIPYLPHVQHQNKTSNMNNIYNNMN-NI------NNNDSNRSIIYNNDSNMNNINNN 1104

Query:   396 DENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVG 217
             D N      N    N+I+N D   S R+   N + N      +D  +    +  S  +  
Sbjct:  1105 DSNMNSIHNNNSNMNNIHNND---SNRSIIHNNDSNMNSIHNNDSNMNSIHNNNSNMNNI 1161

Query:   216 TQNDAGHQIYVRLDGSTNTI 157
               ND+   I    D + N+I
Sbjct:  1162 HNNDSNRSIIHNNDSNMNSI 1181

 Score = 93 (32.7 bits), Expect = 9.9, Sum P(2) = 1.0
 Identities = 44/189 (23%), Positives = 78/189 (41%), Frame = -1

Query:   528 NDTICKEENNINVNVF-----IKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENI 364
             +D + KEEN I V+       +K E+   DI  +   +DDNNNNN +D   N   F ++I
Sbjct:  2017 DDNLEKEENIIYVSEKDSVNQLKSEKK-KDINDDNNNNDDNNNNNDDDNKINDTIFNDDI 2075

Query:   363 KKPNDIYNEDMENSERTKDTNCE---YNKKKKDEDDEEI----------CLTSSTLSTSS 223
                 +   E+    E   +   E   Y  K+K+   E I           +   TL+   
Sbjct:  2076 DSDRNNLKENGSKLENVGEHIIERLSYKMKEKNVKKEHIKKEPNLINLDTINLDTLNFDE 2135

Query:   222 VGTQNDAGHQIYVRLDGSTNTIE-RQKIIKRFSKDENIFVFLLSTKAGG--VGLNLIAAN 52
             +   N    +I    D   N  +  +K I++  K + ++  L+   +    +GL  +   
Sbjct:  2136 INVHNINNEKIEF-YDEHLNICQGNKKHIQKKKKKKTVYSILVEGNSLNYVLGLEGVDFK 2194

Query:    51 HVILMDQVKIY 19
             H+I    + ++
Sbjct:  2195 HIISNHVINVF 2205

 Score = 92 (32.4 bits), Expect = 3.6, P = 0.97
 Identities = 30/118 (25%), Positives = 53/118 (44%), Frame = -1

Query:   540 SINKNDTICKEENNINVNVFIKEEQNYH--DIGKETKRHDDNNNNNINDGDENKFCFKEN 367
             +IN ND+     +N N N+      N H  D  +    ++D+N N+I++ D N      N
Sbjct:  1100 NINNNDSNMNSIHNNNSNM-----NNIHNNDSNRSIIHNNDSNMNSIHNNDSNMNSIHNN 1154

Query:   366 IKKPNDIYNEDMENSE-RTKDTNCE--YNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGH 196
                 N+I+N D   S     D+N    +N    + ++ + C  +  +   S+  +N    
Sbjct:  1155 NSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSNNNNNYKDCTHNPYICNESLIIRNIMNR 1214

Query:   195 QIY 187
              IY
Sbjct:  1215 LIY 1217

 Score = 39 (13.7 bits), Expect = 9.9, Sum P(2) = 1.0
 Identities = 9/35 (25%), Positives = 19/35 (54%), Frame = -2

Query:   602 MNLYMMIVIIWIIYKLLKVHK--A*IKMIPYVRKK 504
             M +Y+  +  W+  K + ++K  +  K I  ++KK
Sbjct:  1698 MKIYIEEIKKWLFIKAINIYKYFSFKKSIELIKKK 1732

 Score = 38 (13.4 bits), Expect = 0.32, Sum P(2) = 0.27
 Identities = 7/19 (36%), Positives = 13/19 (68%), Frame = -2

Query:   311 KIQIVNIIKRKKMKMMKKY 255
             KI+I+N I R + K + ++
Sbjct:  1455 KIEIINNIYRNEKKKLNRW 1473


>pir||A45597 DNA-directed RNA polymerase (EC 2.7.7.6) III largest chain -
            Plasmodium falciparum
            Length = 2339

  Minus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.32, Sum P(2) = 0.27
 Identities = 34/125 (27%), Positives = 60/125 (48%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNV 484
             +SII++  +   +I         I++++  M++I    S++SI  N       N+ N+N 
Sbjct:  1088 RSIIYNNDSNMNNINNNDSNMNSIHNNNSNMNNIHNNDSNRSIIHN-------NDSNMNS 1140

Query:   483 FIKEEQNYHDIGKETKRHDDNNN-NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKD 307
                 + N + I      H++N+N NNI++ D N+     N    N I+N D  N+   KD
Sbjct:  1141 IHNNDSNMNSI------HNNNSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSNNNNNYKD 1194

Query:   306 TNCEYN 289
               C +N
Sbjct:  1195 --CTHN 1198

 Score = 99 (34.8 bits), Expect = 0.59, P = 0.44
 Identities = 33/131 (25%), Positives = 62/131 (47%), Frame = -1

Query:   576 YMDHIQTIKSSQSINKNDTICKEENNINVN-----VFIKEEQNYHDIGKETKR----HDD 424
             Y+ H+Q    +++ N N+ I    NNIN N     +    + N ++I          H++
Sbjct:  1058 YLPHVQ--HQNKTSNMNN-IYNNMNNINNNDSNRSIIYNNDSNMNNINNNDSNMNSIHNN 1114

Query:   423 NNN-NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLT 247
             N+N NNI++ D N+     N    N I+N D  N     + N   N    ++ +  I + 
Sbjct:  1115 NSNMNNIHNNDSNRSIIHNNDSNMNSIHNND-SNMNSIHNNNSNMNNIHNNDSNRSI-IH 1172

Query:   246 SSTLSTSSVGTQNDAGH 196
             ++  + +S+   ND+ +
Sbjct:  1173 NNDSNMNSIHN-NDSNN 1188

 Score = 97 (34.1 bits), Expect = 0.99, P = 0.63
 Identities = 36/140 (25%), Positives = 58/140 (41%), Frame = -1

Query:   576 YMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDG 397
             Y + I  +   Q  NK   +    NN+N N+      N +D  +    ++D+N NNIN+ 
Sbjct:  1052 YKNKIPYLPHVQHQNKTSNMNNIYNNMN-NI------NNNDSNRSIIYNNDSNMNNINNN 1104

Query:   396 DENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVG 217
             D N      N    N+I+N D   S R+   N + N      +D  +    +  S  +  
Sbjct:  1105 DSNMNSIHNNNSNMNNIHNND---SNRSIIHNNDSNMNSIHNNDSNMNSIHNNNSNMNNI 1161

Query:   216 TQNDAGHQIYVRLDGSTNTI 157
               ND+   I    D + N+I
Sbjct:  1162 HNNDSNRSIIHNNDSNMNSI 1181

 Score = 93 (32.7 bits), Expect = 9.9, Sum P(2) = 1.0
 Identities = 44/189 (23%), Positives = 78/189 (41%), Frame = -1

Query:   528 NDTICKEENNINVNVF-----IKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENI 364
             +D + KEEN I V+       +K E+   DI  +   +DDNNNNN +D   N   F ++I
Sbjct:  2017 DDNLEKEENIIYVSEKDSVNQLKSEKK-KDINDDNNNNDDNNNNNDDDNKINDTIFNDDI 2075

Query:   363 KKPNDIYNEDMENSERTKDTNCE---YNKKKKDEDDEEI----------CLTSSTLSTSS 223
                 +   E+    E   +   E   Y  K+K+   E I           +   TL+   
Sbjct:  2076 DSDRNNLKENGSKLENVGEHIIERLSYKMKEKNVKKEHIKKEPNLINLDTINLDTLNFDE 2135

Query:   222 VGTQNDAGHQIYVRLDGSTNTIE-RQKIIKRFSKDENIFVFLLSTKAGG--VGLNLIAAN 52
             +   N    +I    D   N  +  +K I++  K + ++  L+   +    +GL  +   
Sbjct:  2136 INVHNINNEKIEF-YDEHLNICQGNKKHIQKKKKKKTVYSILVEGNSLNYVLGLEGVDFK 2194

Query:    51 HVILMDQVKIY 19
             H+I    + ++
Sbjct:  2195 HIISNHVINVF 2205

 Score = 92 (32.4 bits), Expect = 3.6, P = 0.97
 Identities = 30/118 (25%), Positives = 53/118 (44%), Frame = -1

Query:   540 SINKNDTICKEENNINVNVFIKEEQNYH--DIGKETKRHDDNNNNNINDGDENKFCFKEN 367
             +IN ND+     +N N N+      N H  D  +    ++D+N N+I++ D N      N
Sbjct:  1100 NINNNDSNMNSIHNNNSNM-----NNIHNNDSNRSIIHNNDSNMNSIHNNDSNMNSIHNN 1154

Query:   366 IKKPNDIYNEDMENSE-RTKDTNCE--YNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGH 196
                 N+I+N D   S     D+N    +N    + ++ + C  +  +   S+  +N    
Sbjct:  1155 NSNMNNIHNNDSNRSIIHNNDSNMNSIHNNDSNNNNNYKDCTHNPYICNESLIIRNIMNR 1214

Query:   195 QIY 187
              IY
Sbjct:  1215 LIY 1217

 Score = 39 (13.7 bits), Expect = 9.9, Sum P(2) = 1.0
 Identities = 9/35 (25%), Positives = 19/35 (54%), Frame = -2

Query:   602 MNLYMMIVIIWIIYKLLKVHK--A*IKMIPYVRKK 504
             M +Y+  +  W+  K + ++K  +  K I  ++KK
Sbjct:  1698 MKIYIEEIKKWLFIKAINIYKYFSFKKSIELIKKK 1732

 Score = 38 (13.4 bits), Expect = 0.32, Sum P(2) = 0.27
 Identities = 7/19 (36%), Positives = 13/19 (68%), Frame = -2

Query:   311 KIQIVNIIKRKKMKMMKKY 255
             KI+I+N I R + K + ++
Sbjct:  1455 KIEIINNIYRNEKKKLNRW 1473


>gi|2315689 (AF016674) No definition line found [Caenorhabditis elegans]
            Length = 287

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.35, P = 0.29
 Identities = 36/151 (23%), Positives = 63/151 (41%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNIND-GD 394
             +H + +  SQ  + +D    E   ++V+VF  +  ++ D   E     D  +NN     D
Sbjct:    74 EHKEIVAPSQENSVDDDA--ESTQLSVDVFA-DPSDFEDDDDEVVPETDYEDNNEEPKND 130

Query:   393 ENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGT 214
             +N     +N    +D   E ME S +   T+ E N +  D DD+E    +S     SV  
Sbjct:   131 QNPVEIPDNSDSDDD---EPMEISSKNPVTSIE-NPENSDSDDDEPMEATSKAPEMSVAE 186

Query:   213 QNDAGHQIYVRLDGSTNTIERQKIIKRFSKDE 118
                   ++  +    +  +  +K+ KR  K E
Sbjct:   187 PKSIIEKLLEKKAEKSAKLAAKKLKKRSKKKE 218


>gi|453389 (U05814) cytochrome C oxidase subunit III [Blastocrithidia culicis]
           Length = 288

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.35, P = 0.29
 Identities = 24/113 (21%), Positives = 60/113 (53%), Frame = +1

Query:   247 SKTYFFIIFIFFLF--IIFTICIFSSL*IFHI-FIIYIIWFFYIFFKTKFIFIPIINIII 417
             S+   F  F + +F  ++F +C F+ +    + F   +  + ++F+   + F+ I N++I
Sbjct:    96 SELLLFASFFYVVFGLVLFMVCEFAFVFCLPLLFCCLLCDYGFVFY---WYFLDIFNLLI 152

Query:   418 IVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITI 585
                ++ F    ++  +LF F+  +Y+  +F L   I+F + L  +N ++   ++++
Sbjct:   153 NTFLL-FVSGLFVNFVLFCFWFRLYVCCMFMLWCAILFGF-LFMWNQMWEFALLSV 206


>pir||S21342 ring-infected erythrocyte surface antigen - Plasmodium falciparum
            (fragment) >gi|9959 (X55124) ring-infected erythrocyte surface
            antigen [Plasmodium falciparum]
            Length = 304

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.38, P = 0.32
 Identities = 33/111 (29%), Positives = 54/111 (48%), Frame = -1

Query:   591 YDDSD---YMDH-IQTIKSSQSINKNDTICKE-ENNINVNVFIKEEQNYHDIGKETKRHD 427
             YD  D   Y+ H I TI      N+N+ + +  ++N   NV    E+N     +E   HD
Sbjct:   102 YDTQDVVGYIMHGISTINKEMK-NQNENVPEHVQHNAEANVEHDAEENVEHDAEENVEHD 160

Query:   426 DNNNNNINDGDENKFCFKENIKKPNDIYNEDME-NSERTKDTNCEYNKKKKDEDDEE 259
                N      +EN    +EN+++  +   E++E N E   + N E N ++  E+ EE
Sbjct:   161 AEEN-----AEEN---VEENVEEVEENVEENVEENVEENVEENVEENVEENVEEVEE 209


>gnl|PID|e316524 (Y13119) pleiotropic effects on cellular differentiation and
            slug behaviour [Dictyostelium discoideum]
            Length = 791

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.38, P = 0.32
 Identities = 34/162 (20%), Positives = 66/162 (40%), Frame = -1

Query:   573 MDHIQTIKSSQSINKN--DTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNIND 400
             MD +  I+  Q   +     +C  +   N+   I+++Q    +      ++ NNNNNIN+
Sbjct:   332 MDTLNRIEHQQKEQQRLLKKLCYHDKENNIIQLIQQQQQQQQLLNNVT-NNINNNNNINN 390

Query:   399 GDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSV 220
              + N           N+  N +  N+    + N   N    +        T++T S ++ 
Sbjct:   391 NNNNN----------NN--NNNNNNNNNNNNNNNNNNNNNNNTTSTTTTTTTTTSSCNNN 438

Query:   219 GTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTK 88
                N+   +  V+++ +        II     DENI   +L++K
Sbjct:   439 NNNNNENTEHIVKIENTECNNNNNNIINNTENDENINKPILNSK 482

 Score = 94 (33.1 bits), Expect = 0.65, P = 0.48
 Identities = 33/130 (25%), Positives = 53/130 (40%), Frame = -1

Query:   618 EEALLYEFIYDDSD--YMDHIQTIKSSQSINKNDTI-CKEENNINVNVFIKEEQNYHDIG 448
             ++ LL +  Y D +   +  IQ  +  Q +  N T      NNIN N       N ++  
Sbjct:   345 QQRLLKKLCYHDKENNIIQLIQQQQQQQQLLNNVTNNINNNNNINNNNNNNNNNNNNNNN 404

Query:   447 KETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSE---RTKDTNCEYNKKK- 280
                  +++NNNNN N+               N+  N + EN+E   + ++T C  N    
Sbjct:   405 NNNNNNNNNNNNNNNNTTSTTTTTTTTTSSCNNNNNNNNENTEHIVKIENTECNNNNNNI 464

Query:   279 --KDEDDEEI 256
                 E+DE I
Sbjct:   465 INNTENDENI 474

 Score = 85 (29.9 bits), Expect = 6.7, P = 1.0
 Identities = 31/125 (24%), Positives = 54/125 (43%), Frame = -1

Query:   594 IYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNN 415
             + D  + ++H Q  K  Q + K      +ENNI + +  +++Q    +   T   ++NNN
Sbjct:   331 LMDTLNRIEHQQ--KEQQRLLKKLCYHDKENNI-IQLIQQQQQQQQLLNNVTNNINNNNN 387

Query:   414 -NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDT--------NCEYNKKKKDEDDE 262
              NN N+ + N      N    N+  N +  N+  T  T        +C  N    +E+ E
Sbjct:   388 INNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTSTTTTTTTTTSSCNNNNNNNNENTE 447

Query:   261 EICLTSST 238
              I    +T
Sbjct:   448 HIVKIENT 455


>gi|2393951 (AF012944) ORF DG1053 [Dictyostelium discoideum]
            Length = 565

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.40, Sum P(2) = 0.33
 Identities = 24/101 (23%), Positives = 43/101 (42%), Frame = -1

Query:   522 TICKEENNINVNVFIKEEQNY-HDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDI 346
             T  +  NN N N  I   +N   D       +++NNNNN N+ + N      N    N+ 
Sbjct:   263 TTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 322

Query:   345 YNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSS 223
              N +  + E+ K+ +  ++      + E +   S+   T+S
Sbjct:   323 NNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDTNS 363

 Score = 89 (31.3 bits), Expect = 0.68, Sum P(2) = 0.49
 Identities = 27/100 (27%), Positives = 48/100 (48%), Frame = -1

Query:   537 INKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKK 358
             IN N+ I ++++N N N       N ++       +++NNNNN N+ + N     E  K+
Sbjct:   277 INNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNS-GEKEKE 335

Query:   357 PNDIYNED--MENSERT--KDTNCEYNKKKKDEDDEEICLTSS 241
              +  ++ D  + NSE      TN + N        E + +TS+
Sbjct:   336 ISSFFSSDDNVNNSEVLFFNSTNSDTNSSANSI--ETVSVTSA 376

 Score = 86 (30.3 bits), Expect = 1.5, Sum P(2) = 0.77
 Identities = 25/90 (27%), Positives = 42/90 (46%), Frame = -1

Query:   537 INKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKK 358
             IN N+ I ++++N N N       N ++       +++NNNNN N+ + N     E  K+
Sbjct:   277 INNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNS-GEKEKE 335

Query:   357 PNDIYNED--MENSE------RTKDTNCEYN 289
              +  ++ D  + NSE         DTN   N
Sbjct:   336 ISSFFSSDDNVNNSEVLFFNSTNSDTNSSAN 366

 Score = 81 (28.5 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 24/111 (21%), Positives = 46/111 (41%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQN---YHDIGKETKRHDDNN 418
             D+ D +D+I  I  + +   N+     + N N++     E        I   T+  ++NN
Sbjct:   213 DNIDNIDNIDNIDDNNNNTNNNNNSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNN 272

Query:   417 NNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDD 265
              NNI + +EN     +N    N+  N +  N+    + N   N    + ++
Sbjct:   273 ENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 323

 Score = 42 (14.8 bits), Expect = 0.40, Sum P(2) = 0.33
 Identities = 10/29 (34%), Positives = 16/29 (55%), Frame = -1

Query:   246 SSTLSTSSVGTQNDAGHQIYVRLDGSTNT 160
             SS  +T  + +QND    I+   + S+NT
Sbjct:   447 SSFFATPEMESQNDPSGNIFQSFNISSNT 475


>gi|2425143 (AF020407) WimA [Dictyostelium discoideum]
            Length = 565

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.40, Sum P(2) = 0.33
 Identities = 24/101 (23%), Positives = 43/101 (42%), Frame = -1

Query:   522 TICKEENNINVNVFIKEEQNY-HDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDI 346
             T  +  NN N N  I   +N   D       +++NNNNN N+ + N      N    N+ 
Sbjct:   263 TTTEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 322

Query:   345 YNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSS 223
              N +  + E+ K+ +  ++      + E +   S+   T+S
Sbjct:   323 NNNNNNSGEKEKEISSFFSSDDNVNNSEVLFFNSTNSDTNS 363

 Score = 89 (31.3 bits), Expect = 0.68, Sum P(2) = 0.49
 Identities = 27/100 (27%), Positives = 48/100 (48%), Frame = -1

Query:   537 INKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKK 358
             IN N+ I ++++N N N       N ++       +++NNNNN N+ + N     E  K+
Sbjct:   277 INNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNS-GEKEKE 335

Query:   357 PNDIYNED--MENSERT--KDTNCEYNKKKKDEDDEEICLTSS 241
              +  ++ D  + NSE      TN + N        E + +TS+
Sbjct:   336 ISSFFSSDDNVNNSEVLFFNSTNSDTNSSANSI--ETVSVTSA 376

 Score = 86 (30.3 bits), Expect = 1.5, Sum P(2) = 0.77
 Identities = 25/90 (27%), Positives = 42/90 (46%), Frame = -1

Query:   537 INKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKK 358
             IN N+ I ++++N N N       N ++       +++NNNNN N+ + N     E  K+
Sbjct:   277 INNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNS-GEKEKE 335

Query:   357 PNDIYNED--MENSE------RTKDTNCEYN 289
              +  ++ D  + NSE         DTN   N
Sbjct:   336 ISSFFSSDDNVNNSEVLFFNSTNSDTNSSAN 366

 Score = 81 (28.5 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 24/111 (21%), Positives = 46/111 (41%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQN---YHDIGKETKRHDDNN 418
             D+ D +D+I  I  + +   N+     + N N++     E        I   T+  ++NN
Sbjct:   213 DNIDNIDNIDNIDDNNNNTNNNNNSGNQENENLSTSSSNEHTPAQSEPIVTTTEGSNNNN 272

Query:   417 NNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDD 265
              NNI + +EN     +N    N+  N +  N+    + N   N    + ++
Sbjct:   273 ENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 323

 Score = 42 (14.8 bits), Expect = 0.40, Sum P(2) = 0.33
 Identities = 10/29 (34%), Positives = 16/29 (55%), Frame = -1

Query:   246 SSTLSTSSVGTQNDAGHQIYVRLDGSTNT 160
             SS  +T  + +QND    I+   + S+NT
Sbjct:   447 SSFFATPEMESQNDPSGNIFQSFNISSNT 475


>gi|552163 (J03986) 10b antigen [Plasmodium falciparum] >prf||1510296A Asn rich
           protein 10b [Plasmodium falciparum]
           Length = 374

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.41, P = 0.34
 Identities = 33/115 (28%), Positives = 51/115 (44%), Frame = -1

Query:   600 EFIYDDSDYMDHIQTIKSSQSINKNDTICK-EENNINVNVFIKEEQNYHDIGKETKRHDD 424
             E I  + +   +I T   ++++NKN+   K  +       F KEEQN      ET    +
Sbjct:   243 ESITKNKNNSQYISTNVENENLNKNEQKGKMNKMKTKTQRFNKEEQN------ETNNFTN 296

Query:   423 NNNNNINDGDENKFC-FKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             NN    N   +NK   FK +    N   N    N ++  +TN + +K K  E + EI
Sbjct:   297 NNKKGSNRYQQNKKGQFKNSNMNYNSWINNQQGNDQQHLNTNVDKDKNKDFEVNHEI 353

 Score = 80 (28.2 bits), Expect = 9.5, P = 1.0
 Identities = 24/86 (27%), Positives = 40/86 (46%), Frame = -1

Query:   549 SSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKE 370
             +S+  N N    K+  N+     IK   N  +  K+ K  + NN NN N  + NK    +
Sbjct:   172 TSKKHNTNVNNKKKSKNVQQETPIKHLPNEEENMKQGKTKNSNNKNNNNKNNNNKNNNNK 231

Query:   369 NIKKPNDIYNEDMENSERTKDTNCEY 292
             N    N+  N ++E+  + K+ N +Y
Sbjct:   232 NNNNNNN--NNNLESITKNKN-NSQY 254


>gnl|PID|e8900 (X05182) RESA FC27 Ag46 (1 is 3rd base in codon) [Plasmodium
            falciparum]
            Length = 318

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.41, P = 0.34
 Identities = 34/112 (30%), Positives = 57/112 (50%), Frame = -1

Query:   591 YDDSD---YMDH-IQTIKSSQSINKNDTICKE-ENNINVNVFIKEEQNYHDIGKETKRHD 427
             +D  D   Y+ H I TI +    N+N+ + +  ++N   NV    E+N     +E   HD
Sbjct:   102 FDTKDIVGYIMHGISTINTEMK-NQNENVPEHVQHNAEENVEHDAEENVEHDAEENVEHD 160

Query:   426 DNNNNNINDGDEN-KFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
                N   +D +EN +   +EN+++ N    E  EN E   + N E N ++ +E+ EE
Sbjct:   161 AEENVE-HDAEENVEHDAEENVEE-N--VEEVEENVEENVEENVEENVEEVEENVEE 213

 Score = 90 (31.7 bits), Expect = 0.54, P = 0.42
 Identities = 32/116 (27%), Positives = 58/116 (50%), Frame = -1

Query:   591 YDDSD---YMDH-IQTIKSSQSINKNDTICKE-ENNINVNVFIKEEQNYHDIGKETKRHD 427
             +D  D   Y+ H I TI +    N+N+ + +  ++N   NV    E+N     +E   HD
Sbjct:   102 FDTKDIVGYIMHGISTINTEMK-NQNENVPEHVQHNAEENVEHDAEENVEHDAEENVEHD 160

Query:   426 DNNNNNINDGDEN-KFCFKENIKKPNDIYNEDME-NSERTKDTNCEYNKKKKDEDDEE 259
                N   +D +EN +   +EN+++  +   E++E N E   + N E  ++  +E+ EE
Sbjct:   161 AEENVE-HDAEENVEHDAEENVEENVEEVEENVEENVEENVEENVEEVEENVEENVEE 217

 Score = 86 (30.3 bits), Expect = 1.5, P = 0.79
 Identities = 25/119 (21%), Positives = 62/119 (52%), Frame = -1

Query:   591 YDDSDYMDHI--QTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH-DDN 421
             +D  + ++H   + ++     N  + + + E N+  NV    E+N  ++ +  + + ++N
Sbjct:   159 HDAEENVEHDAEENVEHDAEENVEENVEEVEENVEENVEENVEENVEEVEENVEENVEEN 218

Query:   420 NNNNINDG-DEN-KFCFKENIKKPNDIYNED-MENSERTKDTNCEYNKKKKDEDD-EEI 256
                N+ +  +EN +   +EN+++  + Y+E+ +E  E   + N E N ++  E++ EE+
Sbjct:   219 VEENVEENVEENVEENVEENVEENVEEYDEENVEEVEENVEENVEENVEENVEENVEEV 277

 Score = 82 (28.9 bits), Expect = 4.4, P = 0.99
 Identities = 22/83 (26%), Positives = 42/83 (50%), Frame = -1

Query:   507 ENNINVNVFIKEEQNYHDIGKETKRH-DDNNNNNINDGDENKFCFKENIKKPNDIYNEDM 331
             E N+  NV    E+N  +  +E     ++N   N+ +  E     +EN+++  +   E++
Sbjct:   228 EENVEENVEENVEENVEEYDEENVEEVEENVEENVEENVEENV--EENVEEVEENVEENV 285

Query:   330 E-NSERTKDTNCEYNKKKKDEDDEE 259
             E N E   + N E N ++ DE++ E
Sbjct:   286 EENVEENVEENVEENVEEYDEENVE 310

 Score = 79 (27.8 bits), Expect = 9.7, P = 1.0
 Identities = 26/106 (24%), Positives = 55/106 (51%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHD--DNNNNNINDG 397
             +H+Q   + +++ ++D     E++   NV    E+N     +E   HD  +N   N+ + 
Sbjct:   131 EHVQH-NAEENV-EHDAEENVEHDAEENVEHDAEENVEHDAEENVEHDAEENVEENVEEV 188

Query:   396 DEN-KFCFKENIKKPNDIYNEDME-NSERTKDTNCEYNKKKKDEDDEE 259
             +EN +   +EN+++  +   E++E N E   + N E N ++  E++ E
Sbjct:   189 EENVEENVEENVEENVEEVEENVEENVEENVEENVEENVEENVEENVE 236


>sp|P04371|COX1_TRYBB CYTOCHROME C OXIDASE POLYPEPTIDE I >pir||ODUTMB
            cytochrome-c oxidase (EC 1.9.3.1) chain I - Trypanosoma brucei
            mitochondrion (SGC6) >gi|343538 (M14820) cytochrome c oxidase
            subunit I [Trypanosoma brucei]
            Length = 549

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.41, P = 0.34
 Identities = 27/95 (28%), Positives = 52/95 (54%), Frame = +1

Query:   253 TYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFY---IFFKTKFIFIPI-INIIII 420
             T + ++ + FL +IF  C+F+ +  +   + +I  F Y   IFF   + ++P+ + I ++
Sbjct:   456 TLYGMLLLTFL-VIFCCCLFNVILFWDYCLFFINLFTYSLSIFFYF-YTWVPVCMAIYLL 513

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIY 537
             VI        Y++IIL F     +++ IFF    ++F Y
Sbjct:   514 VIDFAHIILDYLLIILCF----CFVFYIFFWQAFLLFFY 548


>gi|2078309 (U67264) HOAR [Helicoverpa zea nuclear polyhedrosis virus]
            Length = 712

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.44, P = 0.36
 Identities = 34/194 (17%), Positives = 83/194 (42%), Frame = -1

Query:   585 DSDYMDHIQTIKSSQSINKNDTI--CKEENNINVN-VFIKEEQ----NYHDIGKETKRHD 427
             DS+  D +  + ++ + + N++     ++NN N +   I  E     N + +  + + ++
Sbjct:   291 DSEVYDEVVNVNNTNNNDDNNSTNDSDDDNNSNCDDATIHNEDTAELNTNTVNNDIETNN 350

Query:   426 D---NNNNNIND--GDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDED-- 268
             D   NNN N++D   D++     +++   +D+ ++D+ +     +++ +      D D  
Sbjct:   351 DASVNNNTNVDDQNNDDDDDDVNDDVNDNDDVNDDDVNDVNTNVNSDNQITNTTNDNDTN 410

Query:   267 -DEEICLTSSTLS-TSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLS 94
              D  +C T++ ++  ++V T  +      V  D   N+     +      D N+   +  
Sbjct:   411 VDANVCNTNANVNINANVDTNANVDTNANVDDDDVANSAANDNVQHTVDNDNNVNNNVSQ 470

Query:    93 TKAGGVGLNLIAAN 52
             T    +  N +  N
Sbjct:   471 TSHDNINSNQVNNN 484

 Score = 91 (32.0 bits), Expect = 1.2, P = 0.71
 Identities = 26/107 (24%), Positives = 52/107 (48%), Frame = -1

Query:   555 IKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGK--ETKRHDDNNNNNINDGDENKF 382
             I +  +  +N T   + N+   N    + + Y ++     T  +DDNN+ N +D D N  
Sbjct:   266 INTCMTCKRNKT--SDRNSDGDNSDNSDSEVYDEVVNVNNTNNNDDNNSTNDSDDDNNSN 323

Query:   381 C-----FKENIKKPN-DIYNEDME-NSERTKDTNCEYNKKKKDEDDEEI 256
             C       E+  + N +  N D+E N++ + + N   + +  D+DD+++
Sbjct:   324 CDDATIHNEDTAELNTNTVNNDIETNNDASVNNNTNVDDQNNDDDDDDV 372

 Score = 86 (30.3 bits), Expect = 4.6, P = 0.99
 Identities = 35/176 (19%), Positives = 72/176 (40%), Frame = -1

Query:   570 DHIQTIKSSQSINKN-D--TICKEEN-NINVNVFIKEEQNYHDIGKETKRHDDNNNNNIN 403
             D+  T  S    N N D  TI  E+   +N N    + +  +D       + D+ NN+ +
Sbjct:   309 DNNSTNDSDDDNNSNCDDATIHNEDTAELNTNTVNNDIETNNDASVNNNTNVDDQNNDDD 368

Query:   402 DGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDED---DEEICLTSSTLS 232
             D D N     +++   +D+ ++D+ +     +++ +      D D   D  +C T++ ++
Sbjct:   369 DDDVN-----DDVNDNDDVNDDDVNDVNTNVNSDNQITNTTNDNDTNVDANVCNTNANVN 423

Query:   231 -TSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAA 55
               ++V T  +      V  D   N+     +      D N+   +  T    +  N +  
Sbjct:   424 INANVDTNANVDTNANVDDDDVANSAANDNVQHTVDNDNNVNNNVSQTSHDNINSNQVNN 483

Query:    54 N 52
             N
Sbjct:   484 N 484


>sp|P54637|PTP3_DICDI PROTEIN-TYROSINE PHOSPHATASE 3
            (PROTEIN-TYROSINE-PHOSPHATE PHOSPHOHYDROLASE 3) >gi|1022910
            (U38197) protein tyrosine phosphatase [Dictyostelium discoideum]
            Length = 989

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 8.7, P = 1.0
 Identities = 28/109 (25%), Positives = 45/109 (41%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKET--KRHDDNNNNNINDG 397
             +H+     +  IN N+T     NN N N   K + N   +      K +++NNNNN N+ 
Sbjct:    91 NHLDLNSINNKIN-NNTTTNNNNNNNNNNDDKFDTNALKLSNTMIIKNNNNNNNNNNNNN 149

Query:   396 DENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTS 244
             + N      N    N+  N +  N+    + N   N       + EI + S
Sbjct:   150 NNNN---NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNIEINVPS 197

 Score = 73 (25.7 bits), Expect = 0.46, Sum P(2) = 0.37
 Identities = 16/62 (25%), Positives = 29/62 (46%), Frame = -1

Query:   573 MDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGD 394
             + +   IK++ + N N+      NN N N       N ++       +++NNNNN N+ +
Sbjct:   129 LSNTMIIKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSN 188

Query:   393 EN 388
              N
Sbjct:   189 SN 190

 Score = 67 (23.6 bits), Expect = 0.46, Sum P(2) = 0.37
 Identities = 17/56 (30%), Positives = 23/56 (41%), Frame = -1

Query:   420 NNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEIC 253
             N+NN      N  C   N    N+  N +  N+ +  D N     K KDE+D   C
Sbjct:   928 NSNNSGSSSTNSECSNNNKNNNNNSNNNNNNNNNKNSDNN---GTKDKDENDS--C 978


>gi|1762998 (U67260) RING-finger protein [Helicoverpa armigera
            nucleopolyhedrovirus]
            Length = 357

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.49, P = 0.39
 Identities = 34/147 (23%), Positives = 65/147 (44%), Frame = -1

Query:   585 DSDYMDHIQTIKSSQSINKNDTICK--EENNINVNVFIKEEQNYHDIGKETKRHD----- 427
             DS+  D I  + +S + + N++     ++NN N +      ++  ++   T  +D     
Sbjct:   107 DSEVYDEIVDVNNSNNNDDNNSTNDNDDDNNSNCDDATIHNEDTAELNTNTVNNDIETTV 166

Query:   426 DNN---NNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK------D 274
             DN+   NNN N  D+N     +++   +D+ + D  N +   D N   N   +      D
Sbjct:   167 DNDASVNNNTNVDDQNNDDDDDDVNDNDDVNDNDDVNDDDVNDVNTNVNSDNQITNTTND 226

Query:   273 ED---DEEICLTSSTLSTSS-VGTQND 205
              D   D  +C T++ + T++ V T  D
Sbjct:   227 NDTNVDANVCNTNANVDTNANVDTNAD 253

 Score = 87 (30.6 bits), Expect = 1.4, P = 0.76
 Identities = 24/100 (24%), Positives = 46/100 (46%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKN-DTICKEENNINVNVFIKEEQNYHDIGKETKRHDD-NNN 415
             DD+   +      ++ ++N + +T    + ++N N  + ++QN  D   +   +DD N+N
Sbjct:   141 DDATIHNEDTAELNTNTVNNDIETTVDNDASVNNNTNV-DDQNNDDDDDDVNDNDDVNDN 199

Query:   414 NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYN 289
             +++ND D N      N+   N I N   +N        C  N
Sbjct:   200 DDVNDDDVNDV--NTNVNSDNQITNTTNDNDTNVDANVCNTN 239

 Score = 86 (30.3 bits), Expect = 1.8, P = 0.84
 Identities = 32/128 (25%), Positives = 61/128 (47%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKN-DTICKEENNINVNVFIKEEQNYHDIGKETKRHDD-NNN 415
             DD+   +      ++ ++N + +T    + ++N N  + ++QN  D   +   +DD N+N
Sbjct:   141 DDATIHNEDTAELNTNTVNNDIETTVDNDASVNNNTNV-DDQNNDDDDDDVNDNDDVNDN 199

Query:   414 NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTL 235
             +++ND D N      N+   N I N   +N     DTN + N          +C T++ +
Sbjct:   200 DDVNDDDVNDV--NTNVNSDNQITNTTNDN-----DTNVDAN----------VCNTNANV 242

Query:   234 STSS-VGTQND 205
              T++ V T  D
Sbjct:   243 DTNANVDTNAD 253

 Score = 85 (29.9 bits), Expect = 2.4, P = 0.91
 Identities = 20/101 (19%), Positives = 48/101 (47%), Frame = -1

Query:   558 TIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGD-ENKF 382
             T K +++ ++N      ++ +   +      N +D    T  +DD+NN+N +D    N+ 
Sbjct:    90 TCKRNKTSDRNSDSDNSDSEVYDEIVDVNNSNNNDDNNSTNDNDDDNNSNCDDATIHNED 149

Query:   381 CFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
               + N    N+     ++N + + + N   + +  D+DD+++
Sbjct:   150 TAELNTNTVNNDIETTVDN-DASVNNNTNVDDQNNDDDDDDV 190

 Score = 84 (29.6 bits), Expect = 3.1, P = 0.96
 Identities = 35/190 (18%), Positives = 75/190 (39%), Frame = -1

Query:   585 DSDYMDHIQTIKSSQSINKNDTICK--EENNINVNVFIKEEQNYHDIGKETKRHD----- 427
             DS+  D I  + +S + + N++     ++NN N +      ++  ++   T  +D     
Sbjct:   107 DSEVYDEIVDVNNSNNNDDNNSTNDNDDDNNSNCDDATIHNEDTAELNTNTVNNDIETTV 166

Query:   426 DNN---NNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK---DEDD 265
             DN+   NNN N  D+N     +++   +D+ + D  N +   D N   N   +     +D
Sbjct:   167 DNDASVNNNTNVDDQNNDDDDDDVNDNDDVNDNDDVNDDDVNDVNTNVNSDNQITNTTND 226

Query:   264 EEICLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKA 85
              +  + ++  +T++     +A        D   N+     +      D N+   +  T  
Sbjct:   227 NDTNVDANVCNTNA-NVDTNANVDTNADDDDVANSAANDNVQHTVDSDNNVNNNVSQTSH 285

Query:    84 GGVGLNLIAAN 52
               +  N +  N
Sbjct:   286 DNINSNQVNNN 296

 Score = 81 (28.5 bits), Expect = 6.9, P = 1.0
 Identities = 28/116 (24%), Positives = 53/116 (45%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKN-DTICKEENNINVNVFIKEEQNYHDIGKETKRHDD-NNN 415
             DD+   +      ++ ++N + +T    + ++N N  + ++QN  D   +   +DD N+N
Sbjct:   141 DDATIHNEDTAELNTNTVNNDIETTVDNDASVNNNTNV-DDQNNDDDDDDVNDNDDVNDN 199

Query:   414 NNINDGDENKFCFKENIKKPNDIYN--EDME--------NSERTKDTNCEYNKKKKDED 268
             +++ND D N      N+   N I N   D +        N+    DTN   +    D+D
Sbjct:   200 DDVNDDDVNDV--NTNVNSDNQITNTTNDNDTNVDANVCNTNANVDTNANVDTNADDDD 256


>sp|P34857|NU6M_APIME NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 6 >pir||S52970 NADH
            dehydrogenase chain 6 - honeybee mitochondrion (SGC4) >gi|829009
            (L06178) NADH dehydrogenase subunit 6 [Apis mellifera ligustica]
            Length = 167

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.51, P = 0.40
 Identities = 32/127 (25%), Positives = 60/127 (47%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             Y     I+   ++FT+C  +SL I  I I+++     +F      FI +IN  + + +  
Sbjct:    38 YLISYSIYMSLMMFTMCSMNSLLILMILIVFLSGMLIMFS----YFISLINEPLKLKMKP 93

Query:   436 FCFFTYIMIILFFFYKHIYI---YIIFFLTYGIIFIYAL*TFNS-LYMIHIITIIIYKFI 603
             F    +++II    Y  +     Y  +F    ++++Y     NS L+ I I+ +II   +
Sbjct:    94 FIQTLFLIIITMKIYNKLSQNEHYFNYFKNIDLMYLYM--KMNSTLFFIMILMLIITLIL 151

Query:   604 *QGLLYNIKKS 636
                + Y  KK+
Sbjct:   152 MTKITYIEKKT 162


>sp|P54677|PI4K_DICDI PHOSPHATIDYLINOSITOL 4-KINASE (PI4-KINASE)
            (PTDINS-4-KINASE) (PI4K-ALPHA) >gi|733528 (U23479)
            phosphatidylinositol 4-kinase [Dictyostelium discoideum]
            Length = 1093

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.56, P = 0.43
 Identities = 28/97 (28%), Positives = 45/97 (46%), Frame = -1

Query:   549 SSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKE 370
             ++ +IN N++   + NN   N  +  E + + I  E  ++ ++NNNN   G+ N      
Sbjct:   189 NNNNINNNNSNNDDNNN---NEILPNENSDNSINDENNQYGNSNNNNNISGENN------ 239

Query:   369 NIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
             NIK   +  N+   N E    T CE  K    +DD E
Sbjct:   240 NIKIDINSQNKSDSNIETLNSTLCEETKTSPIKDDME 276

 Score = 86 (30.3 bits), Expect = 7.5, P = 1.0
 Identities = 28/90 (31%), Positives = 43/90 (47%), Frame = -1

Query:   468 QNYHDIGKETKRH---DDNNNNNINDGDENKFCFKENIKKPNDIYNEDME-NSERTKDTN 301
             +N H I  + K+    ++NNNNNIN+ + N      N   PN+  N D   N E  +  N
Sbjct:   170 ENDHHIENDPKKDINSNNNNNNNINNNNSNNDDNNNNEILPNE--NSDNSINDENNQYGN 227

Query:   300 CEYNKKKKDEDDE-EICLTSSTLSTSSVGTQN 208
                N     E++  +I + S   S S++ T N
Sbjct:   228 SNNNNNISGENNNIKIDINSQNKSDSNIETLN 259

 Score = 85 (29.9 bits), Expect = 9.7, P = 1.0
 Identities = 32/119 (26%), Positives = 56/119 (47%), Frame = -1

Query:   591 YDDSDY--MDH---IQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHD 427
             YDD D+   D     + IK      +ND   + +   ++N       N ++I      +D
Sbjct:   145 YDDDDFDLSDDDGGFEIIKKKCHHYENDHHIENDPKKDIN---SNNNNNNNINNNNSNND 201

Query:   426 DNNNNNI--NDGDENKFCFKENIKKPNDIY-NEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             DNNNN I  N+  +N      +I   N+ Y N +  N+   ++ N + +   +++ D  I
Sbjct:   202 DNNNNEILPNENSDN------SINDENNQYGNSNNNNNISGENNNIKIDINSQNKSDSNI 255

Query:   255 CLTSSTL 235
                +STL
Sbjct:   256 ETLNSTL 262


>pir||B45600 asparagine-rich blood stage antigen (clone Pfa55-6) - Plasmodium
            falciparum (fragment) >gi|552186 (M59472) asparagine-rich antigen
            Pfa55-6 [Plasmodium falciparum]
            Length = 480

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.58, P = 0.44
 Identities = 30/106 (28%), Positives = 59/106 (55%), Frame = -1

Query:   573 MDHIQTIKSSQSINKNDTICKEENNIN-VNVFIKEEQNYHDIGKETKRHDDNNNNNIN-- 403
             ++ +    +S +I K++ I    NN+N +N  +K   N +D    T  ++  N  +I   
Sbjct:    21 LNDLNNSMNSLNIPKDNNI-SHVNNMNPINNMMKGINNRND-SVNTHMYNMKNLKDIRLY 78

Query:   402 DGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             +  E K   +EN+   +D  NE+ +N   T++ N + N+KK+++DDE++
Sbjct:    79 NHKEKKNVNEENVNVDHD--NEE-KNLVETQNENDKRNEKKEEDDDEDV 124

 Score = 83 (29.2 bits), Expect = 6.1, P = 1.0
 Identities = 28/100 (28%), Positives = 44/100 (44%), Frame = -1

Query:   504 NNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMEN 325
             NNI +N  +    N  +I K+      NN N IN+         + I   ND  N  M N
Sbjct:    17 NNIVLND-LNNSMNSLNIPKDNNISHVNNMNPINN-------MMKGINNRNDSVNTHMYN 68

Query:   324 SERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQND 205
              +  KD     +K+KK+ ++E + +       + V TQN+
Sbjct:    69 MKNLKDIRLYNHKEKKNVNEENVNVDHDNEEKNLVETQNE 108


>pir||S36956 cytochrome-c oxidase (EC 1.9.3.1) chain III - Herpetomonas
            mariadeanei mitochondrion (SGC6)
            Length = 288

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.59, P = 0.45
 Identities = 22/95 (23%), Positives = 50/95 (52%), Frame = +1

Query:   247 SKTYFFIIF--IFFLFIIFTICIFSSL*IFHI-FIIYIIWFFYIFFKTKFIFIPIINIII 417
             S+   F+ F  + F +++F  C F+ +    I F   ++ F + F+   + ++ + N++I
Sbjct:    96 SEFVLFVTFFAVVFGYVLFLCCEFAFVFCLPISFCCLLVEFGFCFY---WFYLDLFNLLI 152

Query:   418 IVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIF 531
                ++ F    ++  +LF F+   +  +I FL  G++F
Sbjct:   153 NTFLL-FVSGLFLNFVLFLFWFRFFCMVICFLWLGLLF 189

 Score = 83 (29.2 bits), Expect = 2.9, P = 0.95
 Identities = 19/85 (22%), Positives = 45/85 (52%), Frame = +1

Query:   289 IIFTIC---IFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIM 459
             I+F  C   +F S+    +F I I+ F ++F     +FI I    + + + T   F Y++
Sbjct:   203 ILFVTCSCGLFGSI----LFCIDILHFTHVFLGVFLMFICICRCFVFLCMDTRFVFLYVV 258

Query:   460 IILFFFYKHIYIYIIFFLTYGIIFIYAL 543
             ++ + F   ++ +++ F+ + ++ +  L
Sbjct:   259 VLYWHFVDCVWFFLLRFVYFDVLVVMYL 286

 Score = 82 (28.9 bits), Expect = 3.8, P = 0.98
 Identities = 21/99 (21%), Positives = 48/99 (48%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKF-IFIPIINIIIIVIIM 432
             +F +I+I F+ + F   +F  L     F++ +    ++       IF  I + +  +  +
Sbjct:    27 FFVVIWIGFMILCFGSFVFVDLGFVFFFVLGLFCILFLMCDLFCDIFRGIFDFVSFIRCL 86

Query:   433 TFCFFTYIM--IILFF-FYKHIYIYIIFFLTYGIIFIYAL 543
              +CF  +++   +LF  F+  ++ Y++F L     F++ L
Sbjct:    87 QYCFLWFVISEFVLFVTFFAVVFGYVLF-LCCEFAFVFCL 125


>gi|456389 (U05816) 3'-end [Crithidia fasciculata]
           Length = 95

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 0.59, P = 0.45
 Identities = 23/65 (35%), Positives = 36/65 (55%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*I-FHIFIIYIIWFF-YIFFKTKFIFI---PIINI 411
             S  +  II+IF+  +I  + IFS   I F +  ++II  F  +FF +  IFI    IIN+
Sbjct:    31 SVIWLVIIYIFYFRLIINVFIFSYQFIGFWVVRLHIIGLFNLLFFLSWCIFILFFDIINL 90

Query:   412 IIIVI 426
               +V+
Sbjct:    91 FDLVL 95

 Score = 65 (22.9 bits), Expect = 9.8, P = 1.0
 Identities = 14/78 (17%), Positives = 43/78 (55%), Frame = +1

Query:   361 FYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYK---HIYIYIIFFLTYGIIF 531
             F  F K   +F  ++++  + + + F    +++II  F+++   +++I+   F+ + ++ 
Sbjct:     7 FGFFIK---VFCLLLHLSYLGVCVVFFSVIWLVIIYIFYFRLIINVFIFSYQFIGFWVVR 63

Query:   532 IYAL*TFNSLYMIHIITIIIY 594
             ++ +  FN L+ +     I++
Sbjct:    64 LHIIGLFNLLFFLSWCIFILF 84

 Score = 65 (22.9 bits), Expect = 9.8, P = 1.0
 Identities = 24/90 (26%), Positives = 38/90 (42%), Frame = +1

Query:   274 IFFLFIIFTICIFSSL*IFHIFIIY--IIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             I F F I   C+   L    + +++  +IW   I+    F F  IIN+ I        + 
Sbjct:     5 IVFGFFIKVFCLLLHLSYLGVCVVFFSVIWLVIIYI---FYFRLIINVFIFSYQFIGFWV 61

Query:   448 TYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL 543
               + II  F       + IF L + II ++ L
Sbjct:    62 VRLHIIGLFNLLFFLSWCIFILFFDIINLFDL 93


>sp|O10302|GTA_NPVOP PROBABLE GLOBAL TRANSACTIVATOR >gi|1911293 (U75930) global
            transactivator [Orgyia pseudotsugata nuclear polyhedrosis virus]
            Length = 498

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.61, P = 0.46
 Identities = 25/83 (30%), Positives = 42/83 (50%), Frame = -1

Query:   276 DEDDEEICLTSSTLSTSSV--GTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIF-V 106
             D  D+++ L S  +    +  G     G  I +   G     ER  +  +F+  ++ + V
Sbjct:   344 DTPDDKVVLVSQWVEFLQLVAGLLRRRGVPILL-YTGQLRVEERTAVENQFNAADSPYRV 402

Query:   105 FLLSTKAGGVGLNLIAANHVILMD 34
              L+S K GGVGLNL   NH+I+++
Sbjct:   403 LLMSIKCGGVGLNLTGGNHIIMLE 426


>pir||S69562 hypothetical protein YDR504c - yeast (Saccharomyces cerevisiae)
            >gi|927774 (U33057) Ydr504cp; CAI: 0.21 [Saccharomyces cerevisiae]
            Length = 127

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.64, P = 0.48
 Identities = 19/66 (28%), Positives = 30/66 (45%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             YF  IF  FLF+   + +F  +  F++ + Y     + +F    I+     + II I   
Sbjct:    22 YFVNIFSLFLFLFVFVFVFIFVYFFYVILFYRFCSLFTYFPANSIWY---YLSIINIFFP 78

Query:   436 FCFFTY 453
              CFF Y
Sbjct:    79 LCFFLY 84


>sp|P54683|TAGB_DICDI PRESTALK-SPECIFIC PROTEIN TAGB PRECURSOR >gi|664840
            (U20432) TagB [Dictyostelium discoideum]
            Length = 1905

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.65, Sum P(2) = 0.48
 Identities = 28/101 (27%), Positives = 47/101 (46%), Frame = -1

Query:   558 TIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFC 379
             TIK S +IN N+    + NN N N       N ++       +++NNNNN  +  E    
Sbjct:    89 TIKPSININNNNNNNNKLNNNNNN----NNNNNNNNNNNNNNNNNNNNNNYYNSIEYYSS 144

Query:   378 FKENIKKPND---IYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             F   + K ND   IY +D ++  +      ++  +  DE  E++
Sbjct:   145 FVSRLLKSNDDDGIYYDDYQSKYKKNHYIVQFKDRINDETREQL 188

 Score = 87 (30.6 bits), Expect = 4.0, Sum P(2) = 0.98
 Identities = 29/98 (29%), Positives = 45/98 (45%), Frame = -1

Query:   633 FLDIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHD 454
             F +II   + Y    DDS Y +  Q  + S  I  N+     +N I ++  IK   N ++
Sbjct:    42 FNNIINRFINYNI--DDSIYKNKQQQQQFSNKIYSNEKKILLKNKI-IDTTIKPSININN 98

Query:   453 IGKET-KRHDDNNNNNINDGDENKFCFKENIKKPNDIYN 340
                   K +++NNNNN N+ + N      N    N+ YN
Sbjct:    99 NNNNNNKLNNNNNNNNNNNNNNNNNNNNNNNNNNNNYYN 137

 Score = 48 (16.9 bits), Expect = 0.65, Sum P(2) = 0.48
 Identities = 16/51 (31%), Positives = 27/51 (52%), Frame = -1

Query:   213 QNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLI 61
             +   G+ +Y+ L GSTN++     I+R+   EN    +L++    V L LI
Sbjct:   254 EKSIGYPVYIILSGSTNSL-----IQRW---ENTLNSILTSYNSKVKLTLI 296


>pir||S26025 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 - pig
            roundworm mitochondrion (SGC4)
            Length = 528

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.66, P = 0.48
 Identities = 31/134 (23%), Positives = 63/134 (47%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*IFHIFII----YIIW--FFYIFFKTKFIFIP--I 402
             SK Y    F    F++   C+F     F +F+     Y +W  FF  F +  F F    +
Sbjct:   345 SKDYILEFFFSNFFMVVFACMF----FFSVFLTFGYSYRLWKGFFMSFSRPVFCFSSSVV 400

Query:   403 INIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIIT 582
             +N + +++++   FF + M         +++Y+ FF+   + F+  +     L +  ++ 
Sbjct:   401 MNFLSLLLVLFSIFFIWWMNFNMLCMPCLFLYVDFFVP--LFFVVMIMVVGFLCVKLLLK 458

Query:   583 IIIYKFI*----QGLLYNIK 630
               +YKF+     +G +Y +K
Sbjct:   459 EFVYKFLVDFFAKGWVYGLK 478


>pir||S52053 cytochrome-c oxidase (EC 1.9.3.1) chain I - Trypanoplasma borreli
            mitochondrion (SGC6) >gi|563140 (U11683) cytochrome c oxidase
            subunit 1 [Trypanoplasma borreli]
            Length = 546

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.69, P = 0.50
 Identities = 25/92 (27%), Positives = 52/92 (56%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHI-FIIYIIWFFYIF-FKTKFIFIPIINIIIIVIIM 432
             F +IF+  L ++F  C+FS L  +   F +  I+   +F F   FI+ P+  ++ +++  
Sbjct:   457 FGVIFLLCL-VLFCCCLFSVLLFWDCCFFLCCIFLCCLFSFFCFFIWFPLSCVLYLLL-- 513

Query:   433 TFCFFTYIMI-ILFFFYKHIYIYIIFFLTYGIIFI 534
               C F +I+I +LF F    +++ ++F+   + F+
Sbjct:   514 --CDFAHIIIDVLFVFLCCFFVFCVYFVCRLLFFV 546


>sp|P24884|NU5M_ASCSU NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 >gi|559499
            (X54253) ND5 protein [Ascaris suum]
            Length = 547

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.69, P = 0.50
 Identities = 31/134 (23%), Positives = 63/134 (47%), Frame = +1

Query:   247 SKTYFFIIFIFFLFIIFTICIFSSL*IFHIFII----YIIW--FFYIFFKTKFIFIP--I 402
             SK Y    F    F++   C+F     F +F+     Y +W  FF  F +  F F    +
Sbjct:   345 SKDYILEFFFSNFFMVVFACMF----FFSVFLTFGYSYRLWKGFFMSFSRPVFCFSSSVV 400

Query:   403 INIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIIT 582
             +N + +++++   FF + M         +++Y+ FF+   + F+  +     L +  ++ 
Sbjct:   401 MNFLSLLLVLFSIFFIWWMNFNMLCMPCLFLYVDFFVP--LFFVVMIMVVGFLCVKLLLK 458

Query:   583 IIIYKFI*----QGLLYNIK 630
               +YKF+     +G +Y +K
Sbjct:   459 EFVYKFLVDFFAKGWVYGLK 478


>gi|467292 (U07817) glutamine-asparagine rich protein [Dictyostelium
           discoideum]
           Length = 720

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.75, P = 0.53
 Identities = 26/96 (27%), Positives = 37/96 (38%), Frame = -1

Query:   567 HIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDEN 388
             H     ++   N N       NNIN N       NY +       +++NNNNN N+   N
Sbjct:   629 HTNNNNNNHDNNYNGNNYNANNNIN-NYSNNNYNNYSNNNNNNYNNNNNNNNNNNNYGNN 687

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKK 280
              +    N    N+ YN +  N     + N  YN  K
Sbjct:   688 NY---SNNNNNNNNYNNNNYNDYNNNNYNNNYNNNK 720


>gi|1658493 (U75508) unknown [Marinococcus halophilus]
            Length = 93

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.76, P = 0.53
 Identities = 14/45 (31%), Positives = 25/45 (55%), Frame = +1

Query:   262 FIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFI 396
             +I F  F+F +F + +  +L I H+ I+ +I F   FF   F+ +
Sbjct:    47 YISFFAFIFGLFGLILALALQIKHLIIVSLILFILPFFAATFVLL 91


>gnl|PID|d1021481 (AB001684) ORF67 [Chlorella vulgaris]
            Length = 67

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.76, P = 0.53
 Identities = 19/60 (31%), Positives = 35/60 (58%), Frame = +1

Query:   334 IFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFF--TYIMIILFF-FYKHIYIYII 504
             +F+ +++ FF  F+K K I    I I+    ++ F  F   ++   LFF F+  +Y++I+
Sbjct:     1 MFLFFLLLFF--FYKKKKI--KKIKILFFSTLLFFKAFEKNFVFFRLFFRFFLLLYLFIL 56

Query:   505 FFL 513
             F L
Sbjct:    57 FLL 59


>gi|2447150 (U42580) a580R [Paramecium bursaria Chlorella virus 1]
            Length = 73

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.76, P = 0.53
 Identities = 21/70 (30%), Positives = 32/70 (45%), Frame = +1

Query:   310 FSSL*IFHIFIIYIIWFFYIFFKTKF-IFIPII-NIIIIVIIMTFCFFTYIMIILFFFYK 483
             FS L +   F I ++   +I F   F I  P I N++     + F     I  I+ FF+K
Sbjct:     3 FSILTLLSEFFIILLCILFILFSMLFSITFPSIGNLVCFAFSVIFEMLYCIYTIMSFFFK 62

Query:   484 HIYIYIIFFL 513
              IY    F++
Sbjct:    63 LIYQQSRFYI 72


>gi|552199 (M63269) malaria antigen [Plasmodium falciparum]
           Length = 138

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.78, P = 0.54
 Identities = 26/94 (27%), Positives = 47/94 (50%), Frame = -1

Query:   534 NKNDTICKEENNIN-VNVFIKEEQNYHDIGKETKRHDDNNNNNIND--GDENKFCFKENI 364
             N ND   K+    N +  F K + N  +     K ++D  N+N  D   D +K    +N 
Sbjct:    41 NPNDNKLKKIEYTNKITHFFKAKNNKQN-NVTHKNNEDIKNDNSKDIKNDNSKDIKNDNS 99

Query:   363 KKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
             K   +  NED++N + +KD   + +K  K+++ ++I
Sbjct:   100 KDIKNDNNEDIKN-DNSKDIKNDNSKDIKNDNSKDI 134


>gi|2102728 (U96194) Pax-B [Hydra littoralis]
            Length = 607

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.79, P = 0.55
 Identities = 30/121 (24%), Positives = 52/121 (42%), Frame = -1

Query:   447 KETKRHDDNNNNNINDGDENKFCFKENI---KKPNDIYNEDMENSERTKDTNC---EYNK 286
             K  K    + N +  D  +NK     ++   +  N I   D +N+    + +C   EY  
Sbjct:   483 KRAKLRRQDRNEDKQDSSKNKEIISSHLDFQRIQNHIKQYDCKNNSEENNQSCFPDEYQD 542

Query:   285 KKKDEDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDENIFV 106
             +    DD + CL +S L+TSS+ T +   +    RL G+      +  +    KD NI+ 
Sbjct:   543 QINVHDDVKNCLLNSELNTSSLPTDHRFTNSKLKRLKGNPVIFVFEPNVVSSIKDPNIYP 602

Query:   105 F 103
             +
Sbjct:   603 Y 603


>sp|P14248|RPB1_PLAFD DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
            >pir||RNZQ2L DNA-directed RNA polymerase (EC 2.7.7.6) II large
            chain - Plasmodium falciparum >gi|9943 (X16561) RNA polymerase II
            large subunit (AA 1-2452) [Plasmodium falciparum]
            Length = 2452

  Minus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.81, P = 0.55
 Identities = 40/139 (28%), Positives = 70/139 (50%), Frame = -1

Query:   588 DDSDYM--DHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNN 415
             ++ D++  DH  + K+++     +T  K  NN N N   K+  N +     T    D +N
Sbjct:  1756 EEEDFLFGDHNVSPKNTKDGKNKNTNNKSNNNENKN---KKSGNNNSNNSNTYDDGDVDN 1812

Query:   414 NNINDGDENKFCFKENIKKPNDI--YNEDMENSERT---KDTN-CEYNKKKKDEDDEEIC 253
             +N +D D+NK      IK+ ND+       +N+E     K+ N  E+N  ++D +D  + 
Sbjct:  1813 DNDDDNDDNKSDI--TIKEDNDVAFMKTSTKNAEEDLELKNKNHIEHNISREDTEDTFLK 1870

Query:   252 -LTSSTLSTSSV-GTQNDAGHQIYVR 181
              L    LST  + G +N    ++Y+R
Sbjct:  1871 KLMEQCLSTLKLRGIENIT--KVYMR 1894

 Score = 89 (31.3 bits), Expect = 8.3, P = 1.0
 Identities = 29/105 (27%), Positives = 50/105 (47%), Frame = -1

Query:   579 DYMDHIQTIKSSQSINK--NDTICKEENNINVNVFIKEE-QNYHDIGKETKRHDDNNNNN 409
             DY ++   I  S+  N   +D   K E++I++N    E+ +N +        H++NNNNN
Sbjct:  1634 DYNNNTTNIFKSKVKNNISSDINTKNEDSISINSSNNEQVKNINSSPVSNNMHNNNNNNN 1693

Query:   408 INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDD 265
              +  + N    K NIKK +   NE         +T+  +  K   ++D
Sbjct:  1694 NDSSNINDIKVK-NIKKEDG--NEGALRGGGDSNTSALFGNKNSQKED 1738


>sp|P18015|COP_CLOPE COPY NUMBER PROTEIN (ORF4) >pir||JT0356 Cop protein -
            Clostridium perfringens plasmid pIP404 >gi|455315 (M32882) ORF 4
            [Plasmid pIP404]
            Length = 198

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.81, P = 0.56
 Identities = 30/106 (28%), Positives = 50/106 (47%), Frame = +1

Query:   253 TYFFIIFIFFLFIIFTI--------CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIIN 408
             T  F+I    L + F+          IF  + + ++  I II   Y+ F  K +  P + 
Sbjct:    16 TILFVILCLNLIVFFSYNKAVEVNQSIFLMMLLLNLSFI-IISLLYLLFLKKLVKFPALL 74

Query:   409 IIIIVIIMTFCFFTYIMIILFFFY------KHIYIYIIFFLTYGIIFI 534
              + + I+ +F     ++I L  FY      K IYI+IIF + Y I+F+
Sbjct:    75 NLFLGILFSFSSLQDLIISLNMFYQILSFSKFIYIFIIFIIIY-ILFL 121

 Score = 81 (28.5 bits), Expect = 2.4, P = 0.91
 Identities = 41/107 (38%), Positives = 59/107 (55%), Frame = +1

Query:   280 FLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIM 459
             FL I+F+   FSSL      II +  F+ I   +KFI+I II III ++ ++F F T I 
Sbjct:    77 FLGILFS---FSSL---QDLIISLNMFYQILSFSKFIYIFIIFIIIYILFLSF-FLTAIK 129

Query:   460 IILF---FFYKHIY--IYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKF 600
               L     + K I   I+II  L  GI+F      FN +   +II+ ++Y F
Sbjct:   130 KKLKNKNTYSKPINKTIFIIAALI-GIVFSKI--NFN-IPQYYIISFLMYVF 177


>gi|2258300 (AF001783) AgrC [Staphylococcus aureus]
            Length = 425

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.84, P = 0.57
 Identities = 36/131 (27%), Positives = 67/131 (51%), Frame = +1

Query:   256 YFFIIFIFF-LFIIFTICIFSSL*IF----HIFIIYIIWF-FYIFFKTKFIFIPIINIII 417
             Y +++F+   + ++F I  F S   +    +I+II I+    Y F K + I + +I I I
Sbjct:     7 YNYVLFVIVQVSLMFFISAFISGIRYKKSDYIYIIGIVLSSVYFFDKIRSISLVVITIFI 66

Query:   418 IVIIMTFCFFTYIMIILFF-FYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
             I+    F +F   +  +F      I +Y   F+ Y IIF Y +   +S++++  I +++Y
Sbjct:    67 II----FLYFKIRLYSVFLVMVTQIILYCANFV-YIIIFSYIITISHSVFIVLPIFLVVY 121

Query:   595 KFI*QGLLYNIKKSSK 642
               I   L Y + +  K
Sbjct:   122 VSISYALAYILNRILK 137

 Score = 83 (29.2 bits), Expect = 5.2, P = 0.99
 Identities = 29/104 (27%), Positives = 55/104 (52%), Frame = +1

Query:   253 TYFFIIFIFF---LFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIV 423
             T F IIF++F   L+ +F + + + + ++    +YII F YI   +  +FI ++ I ++V
Sbjct:    63 TIFIIIFLYFKIRLYSVFLVMV-TQIILYCANFVYIIIFSYIITISHSVFI-VLPIFLVV 120

Query:   424 IIMTFCFFTYIMIILFFFYKHIYIYIIF-FLTYGIIFIYAL*TFNSLY 564
              +       YI+  +       Y+ +   FLT  +I I  + TF+ L+
Sbjct:   121 YVSISYALAYILNRILKRINGTYLSLNKKFLT--VITIVIVITFSLLF 166


>gi|535260 (Z30339) STARP antigen [Plasmodium reichenowi]
           Length = 655

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.87, P = 0.58
 Identities = 32/126 (25%), Positives = 54/126 (42%), Frame = -1

Query:   576 YMDHIQTIKSSQSINKNDTICKEENNINVNVF--------IKEEQNYHDIGKETKRHDDN 421
             + D+I T ++  +     T+  + NN N+N          IK   NY+   KET    DN
Sbjct:   248 WTDNINTTQNLTTSTNTTTVSTDNNNNNINTKPTDNNNTNIKSTDNYNTGTKET----DN 303

Query:   420 NNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSS 241
              N +I   D N      +    N I  ++ + +  +KD N   +    D     +  T +
Sbjct:   304 KNTDIKATDNNNITITTDNTNTNVISTDNSKTNVISKD-NSNTHTISTDNSKTNVISTDN 362

Query:   240 TLSTSSVGTQND 205
               +T ++ T ND
Sbjct:   363 N-NTDTISTDND 373

 Score = 90 (31.7 bits), Expect = 1.5, P = 0.77
 Identities = 37/149 (24%), Positives = 56/149 (37%), Frame = -1

Query:   582 SDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYH--DIGKETKRHDDNNNNN 409
             +D  ++  T K++ + N  DT   + NN N         N    D      +  DNNN N
Sbjct:   411 TDKSNNTDT-KATDNNNNTDTKATDNNNTNTKATDSNNTNTKATDNNNTNTKATDNNNTN 469

Query:   408 INDGDENKFCFKENIKKPNDIYNEDMENSERTKDT-NCEYNKKKKDEDDEEICLTSSTLS 232
                 D N    K       +    D  N+  TK T N   N K  D ++     T +  +
Sbjct:   470 TKATDNNNTNTKATDNNNTNTKATD-NNNTNTKATDNNNTNTKATDNNNTNTKATDNN-N 527

Query:   231 TSSVGTQNDAGHQIYVRLDGSTNTIERQKIIK 136
             T++  T N+     YV  +    T    K+ K
Sbjct:   528 TNTKATDNNNNTNQYVFANNYDETTSDDKLNK 559

 Score = 83 (29.2 bits), Expect = 9.0, P = 1.0
 Identities = 41/134 (30%), Positives = 60/134 (44%), Frame = -1

Query:   558 TIKSSQSINKND-TICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDG--DEN 388
             T  S+ + N  D T   ++   N+N      QN       T    DNNNNNIN    D N
Sbjct:   229 TDNSNTNTNLTDITTTTKKWTDNINT----TQNLTTSTNTTTVSTDNNNNNINTKPTDNN 284

Query:   387 KFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQN 208
                   NIK   D YN        TK+T+ + N   K  D+  I +T+   +T+ + T N
Sbjct:   285 N----TNIKS-TDNYNTG------TKETDNK-NTDIKATDNNNITITTDNTNTNVISTDN 332

Query:   207 DAGHQIYVRLDGSTNTI 157
                + I  + + +T+TI
Sbjct:   333 SKTNVIS-KDNSNTHTI 348

 Score = 83 (29.2 bits), Expect = 9.0, P = 1.0
 Identities = 36/134 (26%), Positives = 53/134 (39%), Frame = -1

Query:   558 TIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFC 379
             T K + +IN    +    N   V+     + N ++I   TK   DNNN NI   D     
Sbjct:   245 TKKWTDNINTTQNLTTSTNTTTVST----DNNNNNIN--TKP-TDNNNTNIKSTDNYNTG 297

Query:   378 FKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAG 199
              KE   K  DI   D  N   T D N   N    D     + ++    +T ++ T N   
Sbjct:   298 TKETDNKNTDIKATDNNNITITTD-NTNTNVISTDNSKTNV-ISKDNSNTHTISTDNSKT 355

Query:   198 HQIYVRLDGSTNTI 157
             + I    + +T+TI
Sbjct:   356 NVISTD-NNNTDTI 368


>bbs|112163 (S44213) YKL529 [Saccharomyces cerevisiae, Peptide Partial, 539 aa]
            [Saccharomyces cerevisiae]
            Length = 539

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.88, P = 0.58
 Identities = 27/75 (36%), Positives = 41/75 (54%), Frame = -1

Query:   483 FIKEEQNYHDIGKETKRHDDNN-NNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKD 307
             F +E   YHD   ET   DDNN +NN+N+ DEN  C  EN     D  N+  ENS   ++
Sbjct:   451 FDRENNVYHD-SLET---DDNNTDNNVNNNDENAGC-NENSPLLEDDGNKRPENSNTPRE 505

Query:   306 -TNCEYNKKKKDEDDEE 259
              ++   NK  +++  ++
Sbjct:   506 VSDGAINKNPRNKSTKK 522


>gi|1109830 (U41534) coded for by C. elegans cDNA CEESI42F;  Similar to
            helicases of SNF2/RAD54 family. [Caenorhabditis elegans]
            Length = 866

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.93, P = 0.61
 Identities = 20/51 (39%), Positives = 30/51 (58%), Frame = -1

Query:   186 VRLDGSTNTIERQKIIKRFSKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             +R+DG T +  R  +   F  D+NI V +LS  A GVG+ L AA+ V+  +
Sbjct:   697 IRIDGKTPSHRRTALCDSFQTDDNIRVAVLSITAAGVGITLTAASVVVFAE 747


>sp|P41001|TOP2_PLAFK DNA TOPOISOMERASE II
            Length = 1398

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.96, P = 0.62
 Identities = 35/122 (28%), Positives = 58/122 (47%), Frame = -1

Query:   636 TFLDIIEEALLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYH 457
             T +D   E+LL++ +YD +       T      +N      K+  +  V++++K+  N  
Sbjct:   212 TEMDDDIESLLFKRVYDLAG------TCSVRVYLNGQRLAVKDFKSY-VDLYLKDNSN-- 262

Query:   456 DIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKK 277
             D  K  K  +DNNNNN N+ DEN     +N+     + NE  + +  TK+ N   N   +
Sbjct:   263 D-NKNNKGQNDNNNNNNNNNDENANQNNDNLDV--SLSNEPADGTP-TKNNNNNNNNNDE 318

Query:   276 DE 271
             DE
Sbjct:   319 DE 320


>pir||S67132 hypothetical protein YOR239w - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e252406 (Z75147) ORF YOR239w [Saccharomyces cerevisiae]
            Length = 279

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.96, P = 0.62
 Identities = 39/121 (32%), Positives = 59/121 (48%), Frame = -1

Query:   564 IQTIKSSQSINKNDTICKEE-NNIN--VNVFIKEEQNYHDI----GKETKRHDDNNNNNI 406
             I T K  ++  KND   +E  NN +     + + E++  DI    GKET+ + +N +   
Sbjct:   148 IATPKQKEN-EKNDESEEESANNASEPAEEYSQSEEDA-DIEQSNGKETE-NAENASQQA 204

Query:   405 NDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTS 226
             NDG  +    K N KK N   N+   N     + N + + K  + DD     TSST  TS
Sbjct:   205 NDGSTSTTTSK-NKKKKNKKKNKKKRNGNVNTNANVDDSTKTGENDDTTGDTTSST--TS 261

Query:   225 SVGTQND 205
             ++   ND
Sbjct:   262 AIQEVND 268


>sp|P32343|YKM4_YEAST HYPOTHETICAL 65.1 KD PROTEIN IN RRN3-SRP21 INTERGENIC
            REGION >pir||S37953 hypothetical protein YKL124w - yeast
            (Saccharomyces cerevisiae) >gi|486208 (Z28123) ORF YKL124w
            [Saccharomyces cerevisiae]
            Length = 579

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.96, P = 0.62
 Identities = 27/75 (36%), Positives = 41/75 (54%), Frame = -1

Query:   483 FIKEEQNYHDIGKETKRHDDNN-NNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKD 307
             F +E   YHD   ET   DDNN +NN+N+ DEN  C  EN     D  N+  ENS   ++
Sbjct:   491 FDRENNVYHD-SLET---DDNNTDNNVNNNDENAGC-NENSPLLEDDGNKRPENSNTPRE 545

Query:   306 -TNCEYNKKKKDEDDEE 259
              ++   NK  +++  ++
Sbjct:   546 VSDGAINKNPRNKSTKK 562


>bbs|137318 DNA polymerase alpha, DNAPol alpha [Plasmodium falciparum, K1,
            Peptide, 1855 aa]
            Length = 1855

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.98, Sum P(2) = 0.62
 Identities = 45/165 (27%), Positives = 73/165 (44%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVF-IKEEQNYHDIGKETKRHDDNNNNNINDGD 394
             D I   K+   + KN+ + K+E  I  N   IKE +         K ++DNNNNN N  D
Sbjct:   205 DDINEKKNKIHLMKNELVLKKEIQIKENEENIKEVKEQGSKNNNNKNNNDNNNNNNNVDD 264

Query:   393 -ENKFCFKENIKKPN--DIYNEDMENSERTKDTNCEYNKKKKD--EDD-EEICLTSSTLS 232
               N +   E    P    I NE ++  E+    N + N K++D  E+D +   L +    
Sbjct:   265 FYNDYILNEMNISPLFIKIENETLKKEEKKLKEN-DINDKEEDILENDIDSEMLKNKYEQ 323

Query:   231 TSSVGTQNDAGHQIYV-RLDGSTNTIER-QKIIKRFSKDENIFVFL 100
                    N+    +YV  +    N+I    K + +F K ++I +F+
Sbjct:   324 LIKYEENNNLFVNVYVFDICKHRNSIILFGKTLTKFKKYKSISIFI 369

 Score = 38 (13.4 bits), Expect = 0.98, Sum P(2) = 0.62
 Identities = 7/12 (58%), Positives = 8/12 (66%), Frame = -2

Query:   131 FQKMKIYLFFFC 96
             FQK   YL F+C
Sbjct:   460 FQKGSSYLSFYC 471


>pir||S41649 DNA polymerase - Plasmodium falciparum
            Length = 1855

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.98, Sum P(2) = 0.62
 Identities = 45/165 (27%), Positives = 73/165 (44%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVF-IKEEQNYHDIGKETKRHDDNNNNNINDGD 394
             D I   K+   + KN+ + K+E  I  N   IKE +         K ++DNNNNN N  D
Sbjct:   205 DDINEKKNKIHLMKNELVLKKEIQIKENEENIKEVKEQGSKNNNNKNNNDNNNNNNNVDD 264

Query:   393 -ENKFCFKENIKKPN--DIYNEDMENSERTKDTNCEYNKKKKD--EDD-EEICLTSSTLS 232
               N +   E    P    I NE ++  E+    N + N K++D  E+D +   L +    
Sbjct:   265 FYNDYILNEMNISPLFIKIENETLKKEEKKLKEN-DINDKEEDILENDIDSEMLKNKYEQ 323

Query:   231 TSSVGTQNDAGHQIYV-RLDGSTNTIER-QKIIKRFSKDENIFVFL 100
                    N+    +YV  +    N+I    K + +F K ++I +F+
Sbjct:   324 LIKYEENNNLFVNVYVFDICKHRNSIILFGKTLTKFKKYKSISIFI 369

 Score = 38 (13.4 bits), Expect = 0.98, Sum P(2) = 0.62
 Identities = 7/12 (58%), Positives = 8/12 (66%), Frame = -2

Query:   131 FQKMKIYLFFFC 96
             FQK   YL F+C
Sbjct:   460 FQKGSSYLSFYC 471


>gi|563136 (U11682) unassigned reading frame [Trypanoplasma borelli]
           Length = 68

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.99, P = 0.63
 Identities = 23/59 (38%), Positives = 29/59 (49%), Frame = +1

Query:   250 KTYFFIIFIFFLFIIFTI-CIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             KT F + F F+  IIF I C+ S   + +IFI YII          F FI  I  I  +I
Sbjct:    10 KTIFNLYFYFYFTIIFFIFCLNSYFLMCNIFI-YIILNTIALLTKVFTFINYILFITYII 68

 Score = 65 (22.9 bits), Expect = 1.6, P = 0.81
 Identities = 18/55 (32%), Positives = 27/55 (49%), Frame = +1

Query:   307 IFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILF 471
             IF+    F+  II+ I+    +F    IFI II   I ++   F F  YI+ I +
Sbjct:    12 IFNLYFYFYFTIIFFIFCLNSYFLMCNIFIYIILNTIALLTKVFTFINYILFITY 66

 Score = 64 (22.5 bits), Expect = 2.1, P = 0.88
 Identities = 20/55 (36%), Positives = 29/55 (52%), Frame = +1

Query:   325 IFHI-FIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCF----FTYIMIILFFFY 480
             IF++ F  Y    F+IF    + F+ + NI I +I+ T       FT+I  ILF  Y
Sbjct:    12 IFNLYFYFYFTIIFFIFCLNSY-FL-MCNIFIYIILNTIALLTKVFTFINYILFITY 66

 Score = 59 (20.8 bits), Expect = 7.6, P = 1.0
 Identities = 21/61 (34%), Positives = 26/61 (42%), Frame = +1

Query:   415 IIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*T--FNSLYMIHIITII 588
             II  I    F+ Y  II F F  + Y  +     Y I+   AL T  F  +  I  IT I
Sbjct:     8 IIKTIFNLYFYFYFTIIFFIFCLNSYFLMCNIFIYIILNTIALLTKVFTFINYILFITYI 67

Query:   589 I 591
             I
Sbjct:    68 I 68


>sp|P04017|VE5A_HPV11 PROBABLE E5A PROTEIN >pir||W5WL11 E5A protein - human
            papillomavirus type 11 >gi|496198 (M14119) 3871 is position of
            first start codon in ORFE5A; putative [Human papillomavirus type
            11]
            Length = 91

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.99, P = 0.63
 Identities = 20/69 (28%), Positives = 38/69 (55%), Frame = +1

Query:   289 IIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT--FCFFTYIMI 462
             I F +CI S      I +I +I  F ++  T  + + ++  +++ +++T    FF   + 
Sbjct:    22 IAFAVCILS------IVLIILISDFVVY--TSVLVLTLLLYLLLWLLLTTPLQFFLLTLC 73

Query:   463 ILFF--FYKHIYI 495
             + +F  FY HIYI
Sbjct:    74 VCYFPAFYIHIYI 86


>sp|P20970|VE5A_HPV6C PROBABLE E5A PROTEIN >gi|333132 (M26656) E5a protein
            [Human papillomavirus]
            Length = 91

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.99, P = 0.63
 Identities = 20/69 (28%), Positives = 38/69 (55%), Frame = +1

Query:   289 IIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT--FCFFTYIMI 462
             I F +CI S      I +I +I  F ++  T  + + ++  +++ +++T    FF   + 
Sbjct:    22 IAFAVCILS------IVLIILISDFLVY--TSVLVLTLLLYLLLWLLLTTPLQFFLLTLC 73

Query:   463 ILFF--FYKHIYI 495
             + +F  FY HIYI
Sbjct:    74 VCYFPAFYIHIYI 86


>pir||A05236 hypothetical protein B-114 - Trypanosoma brucei mitochondrion
            (SGC6)
            Length = 114

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.99, P = 0.63
 Identities = 27/113 (23%), Positives = 52/113 (46%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             + F   + FLF +  I +F  L ++++   Y I F+ I     ++F  ++      I+  
Sbjct:    10 FLFNTNVRFLFYMINIRMFRFLYVYNVIDKYGILFYSILRILLYVFWYVVRAFFDYILNI 69

Query:   436 FCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIY 594
              C   +I  I++FF   + + II      +I I+    FN +++I    I I+
Sbjct:    70 CCVHEFIHPIIWFFNSLLRMRII-----RVILIF----FNFIFLIPFFCIKIW 113

 Score = 72 (25.3 bits), Expect = 4.4, P = 0.99
 Identities = 18/62 (29%), Positives = 31/62 (50%), Frame = +1

Query:   256 YFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMT 435
             +++++  FF +I+   C+       H FI  IIWFF    + + I + +I    I +I  
Sbjct:    55 FWYVVRAFFDYILNICCV-------HEFIHPIIWFFNSLLRMRIIRVILIFFNFIFLIPF 107

Query:   436 FC 441
             FC
Sbjct:   108 FC 109


>sp|P40021|YEM3_YEAST HYPOTHETICAL 119.3 KD PROTEIN IN PIP1-GLN3 INTERGENIC
            REGION >pir||S50536 hypothetical protein YER033c - yeast
            (Saccharomyces cerevisiae) >gi|603266 (U18796) Yer033cp
            [Saccharomyces cerevisiae]
            Length = 1076

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 9.5, P = 1.0
 Identities = 22/101 (21%), Positives = 43/101 (42%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKF 382
             QT+  S  I   D +    + +N N    E  N   +     R ++    ++N+  +   
Sbjct:   349 QTLSLSPKIRHGD-LQSSPSKVNKNDSQNETLNKKKVRISLNRKEEEKVYSLNNNSDEYS 407

Query:   381 CFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
               ++   K ND  +E  EN +   D + +Y+    D+DD++
Sbjct:   408 VNEKETHKANDCNDESSENGDGDNDHDDDYDDDDDDDDDDD 448

 Score = 84 (29.6 bits), Expect = 1.1, Sum P(2) = 0.65
 Identities = 18/89 (20%), Positives = 47/89 (52%), Frame = -1

Query:   594 IYDDSDYMDHIQTIKSSQSINKNDTICK-----EENNINVNVFIKEEQNYHDIGKETKRH 430
             +Y+D ++ D +  I+  +S N+ + IC      EE ++  N  +K+  +  ++  + +  
Sbjct:   483 LYEDENFDDDMNCIEDDESGNEGNEICGLSTRFEETSLKSNK-VKKFNDLFNLSDDDEEE 541

Query:   429 DDNNNNNINDGDENKFCFKENIKKPNDIYN 340
             D  +N+N  D +E+   +++ ++   + +N
Sbjct:   542 DGKDNSNNGDENESDNLYQKRLENGKETFN 571

 Score = 52 (18.3 bits), Expect = 1.1, Sum P(2) = 0.65
 Identities = 14/54 (25%), Positives = 24/54 (44%), Frame = -1

Query:   375 KENIKKPNDIYNEDMENSERTKDTNCEYNKKK---KDEDDEEICLTSSTLSTSS 223
             K  +K  +DI+N D   S+   D+    N       ++ + ++ L SS   T S
Sbjct:   698 KPTVKSFSDIFNVDDSASDAESDSGTGGNNSNGLVSNDSERQVSLQSSLYETKS 751


>sp|Q57898|Y456_METJA HYPOTHETICAL PROTEIN MJ0456 >pir||H64356 hypothetical
            protein MJ0456 - Methanococcus jannaschii >gi|1499250 (U67496) M.
            jannaschii predicted coding region MJ0456 [Methanococcus
            jannaschii]
            Length = 352

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 1.1, P = 0.65
 Identities = 34/116 (29%), Positives = 62/116 (53%), Frame = +1

Query:   253 TYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             T+ F++FI    ++  + I + + +FHI    + W        K IF     ++II I+ 
Sbjct:     5 TFIFLMFISIGILLLLLNIINPMEVFHI----VEW--------KTIFSLFYLMVIINIMR 52

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFN-SLYMIHIITIIIYKF 600
                F  YI + +    K I+I +IF LT   +F+ +L T + SL++I  +T+II+++
Sbjct:    53 DTKFLDYISLKILKKSKRIFIALIF-LT---LFLSSLITNDVSLFVIIPLTLIIHRY 105

 Score = 83 (29.2 bits), Expect = 4.0, P = 0.98
 Identities = 34/120 (28%), Positives = 59/120 (49%), Frame = +1

Query:   268 IFIFFLFIIFTICIFSSL*IFHIF-IIYIIWFF----Y-------IFFKTKFIFIPIINI 411
             +F+F  + I T+    ++  F IF I+ I+ F     Y       I FK ++IF  +  I
Sbjct:   139 LFLFHFYNIGTLEFIINMIPFEIFGILAILPFLEFKKYDTKINIDIKFKKEWIFYILSFI 198

Query:   412 IIIVIIMTFCFFTYIM--IILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITI 585
             ++++ +  +  F YI+  I+    YK + +  +F LT+  IF++       L  I II I
Sbjct:   199 LVLLCVFGYLNFIYILPLILAILMYKRVKVDYLFLLTF--IFLFV--DIEGLKRIGIINI 254

Query:   586 IIYK 597
                K
Sbjct:   255 FSIK 258


>gi|2367390 (U82512) random slug cDNA21 protein [Dictyostelium discoideum]
            Length = 515

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 1.1, P = 0.66
 Identities = 25/109 (22%), Positives = 56/109 (51%), Frame = -1

Query:   588 DDSDY-MDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNN 412
             DDS+  + +    ++S S+N + T  + +N++++N+F     N  +       +++NNNN
Sbjct:    19 DDSEVEVQYHPQKRASFSLNISPT--QLQNDLSLNIF-----NVSNSNNNNNSNNNNNNN 71

Query:   411 NINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDE 262
             N N+ + NK     N+   + + +    N+   K++N     +++ E+ E
Sbjct:    72 NNNNNNNNKINNNSNLILNSSVDSTTSSNNNNNKNSNDNQQPQQQPEEIE 121


>pir||I30010 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 502

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.1, Sum P(2) = 0.67
 Identities = 28/88 (31%), Positives = 44/88 (50%), Frame = +1

Query:   259 FFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWF-FYIF-FKTKFIFIPIIN--IIIIVI 426
             FFI+   FL      C +  L +F  F+I   W+ FY   F  K  FI  +   ++++V 
Sbjct:   138 FFILSYDFLT---AYCGWELLGLFSFFLISYFWYRFYALKFGFKAFFISKVGDVLLLLVF 194

Query:   427 IMTFCFFTYIMIILFF--FYKHIYIYIIFFL 513
              +TF    Y +I  +F  F    YI+I+F +
Sbjct:   195 AITFLMNGYCVITFYFLTFLCVDYIFIVFIV 225

 Score = 84 (29.6 bits), Expect = 5.0, P = 0.99
 Identities = 24/89 (26%), Positives = 46/89 (51%), Frame = +1

Query:   253 TYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWF-FYIFFKTKFIFIPIINIIIIVII 429
             T FF I  F    +F I  F ++ I++ F+++ + F F  F     +F+ + +    ++ 
Sbjct:   415 TSFFFILEFLCVCLFFI--FFTV-IYNYFLLFFLCFVFKCFCLVDTLFL-LFDFECCLVY 470

Query:   430 MTFCFFTYIMIILFFFYKHIYIYIIFFLTY 519
              TFC +    ++LFF    +Y++I  F +Y
Sbjct:   471 CTFCLYM-CFVLLFFVLDFLYVFI--FSSY 497

 Score = 42 (14.8 bits), Expect = 1.1, Sum P(2) = 0.67
 Identities = 10/23 (43%), Positives = 14/23 (60%), Frame = +2

Query:   497 ILFSSLHMVSFLFMLCELLIVCI 565
             +L   L + SF F+L E L VC+
Sbjct:   407 LLLCLLMLTSFFFIL-EFLCVCL 428


>gi|683670 (Z48432) unknown [Saccharomyces cerevisiae]
           Length = 264

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.1, P = 0.68
 Identities = 19/47 (40%), Positives = 30/47 (63%), Frame = +1

Query:   343 IYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYK 483
             +Y +  F+I F T  IF  I+   I+VI + F FF + ++I+FFF+K
Sbjct:   125 VYKVSPFFIIFATASIFTFILTSTIVVIPLIFHFF-FPLLIMFFFFK 170


>pir||B21124 Bkm-like sex-determining region hypothetical protein CS314 - fruit
            fly (Drosophila melanogaster) (fragment)
            Length = 105

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 1.3, P = 0.73
 Identities = 24/75 (32%), Positives = 36/75 (48%), Frame = +1

Query:   334 IFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFF---YKHIYIYI- 501
             I++  I W  Y+      IFI I   I + I ++     Y+ I L  +   Y+ IYIY+ 
Sbjct:    22 IYLTSIYWLIYLSIFIS-IFISIYLSIYLSIYLSIYLSIYLSIHLSIYLSTYQSIYIYLY 80

Query:   502 ----IFFLTYGIIFIY 537
                 I+  TY  I+IY
Sbjct:    81 IYISIYISTYLSIYIY 96


>sp|P32900|YHU9_YEAST HYPOTHETICAL 81.8 KD PROTEIN IN MRPL6-SPO12 INTERGENIC
            REGION >pir||S46765 hypothetical protein YHR149c - yeast
            (Saccharomyces cerevisiae) >gi|500661 (U10397) Yhr149cp
            [Saccharomyces cerevisiae]
            Length = 734

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 1.3, P = 0.73
 Identities = 34/154 (22%), Positives = 62/154 (40%), Frame = -1

Query:   576 YMDHIQTIKSSQSINK-NDTICK-EENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNIN 403
             Y+D  Q  + S   N   D   + +E+ +       E +N      +T  H DN +N   
Sbjct:   178 YVDPFQLPQESNDSNSLRDFAMRVQEDGLGGYKVAAESRN----ASQTSLHPDNFSNCTP 233

Query:   402 DGDENKFCFKENIKKPND-IYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTS 226
                 ++F   E+ +     I+N  +     T+  N ++    +D D   +   +  L+ S
Sbjct:   234 IRASSRFQESESFRSHGSPIHNNQLSRGSATEGANKQFTFPNEDNDSSSVSEEAEVLNES 293

Query:   225 SVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKDEN 115
             +    NDA       LD S+     + +  RF KD++
Sbjct:   294 NESASNDA---FEFELDNSSEKTHERNL--RFGKDDD 325


>gi|476024 (L32150) carbamoyl phosphate synthetase II [Plasmodium falciparum]
           Length = 2391

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 1.3, P = 0.73
 Identities = 48/165 (29%), Positives = 77/165 (46%), Frame = -1

Query:   555 IKSSQSINKNDTICKEEN----NINVNVFIKEEQNYHDIGKETKRHDDNNN--NNIND-- 400
             I S+Q+ N N + C  EN    N++VNV   + +   DI   T   +  N+  NN N   
Sbjct:  1395 ILSAQNSNNNFS-CNNENMNKANVDVNVLENDTKKREDINTTTVFMEGQNSVINNKNKEN 1453

Query:   399 -----GDENKFCFKENIKKPNDIYNEDMENSE-RTKDTN-------CEYNKKKKDEDDEE 259
                  GDE       N+KK N+ YN  + N + R KD +       C+  KK K +D   
Sbjct:  1454 SSLLKGDEEDIVMV-NLKKENN-YNSVINNVDCRKKDMDGKNINDECKTYKKNKYKD--- 1508

Query:   258 ICLTSSTLSTSSVGTQNDAGHQIYV-RLDGSTNTIERQKIIKRF-SKDENI 112
             + L ++ +   S GT +     +Y+   + S   I   K +  + SK+++I
Sbjct:  1509 MGLNNNIVDELSNGTSHSTNDHLYLDNFNTSDEEIGNNKNMDMYLSKEKSI 1559

 Score = 92 (32.4 bits), Expect = 3.7, P = 0.98
 Identities = 35/109 (32%), Positives = 54/109 (49%), Frame = -1

Query:   531 KNDTICKEENNINVN---VFIKEEQNYHDI--GKETKRH-DDNNNNNINDGD-ENKFCFK 373
             K   IC   N  N N   V +K    Y+++   K+T+ H ++NNNNN+N G+ ENK C  
Sbjct:  1255 KRKKICTLNNKRNANKKKVHVKNHL-YNEVVDDKDTQLHKENNNNNNMNSGNVENK-C-- 1310

Query:   372 ENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQN 208
               + K +  YN    N   T + N E N       ++ I +T +  + S    +N
Sbjct:  1311 -KLNKESYGYNNS-SNCINTNNINIENNICHDISINKNIKVTINNSNNSISNNEN 1363

 Score = 89 (31.3 bits), Expect = 8.1, P = 1.0
 Identities = 24/81 (29%), Positives = 39/81 (48%), Frame = -1

Query:   534 NKNDTICKEEN-NINVNVFIKEEQNYHDIGKETKR--HDDNNNNNINDGDENKFCFKENI 364
             N N++I   EN   N+N   +   ++H  GKE K    DD N  +  + + N  C  EN+
Sbjct:  1353 NSNNSISNNENVETNLNCVSERAGSHHIYGKEEKSIGSDDTNILSAQNSNNNFSCNNENM 1412

Query:   363 KKPNDIYNEDMENSERTKDTN 301
              K N   N    ++++ +D N
Sbjct:  1413 NKANVDVNVLENDTKKREDIN 1433

 Score = 89 (31.3 bits), Expect = 8.1, P = 1.0
 Identities = 34/143 (23%), Positives = 61/143 (42%), Frame = -1

Query:   627 DIIEEALLYE---FIYDDSDYMDHIQTIKSSQSINKNDT------ICKE-------ENNI 496
             ++I   LL +    I    +Y+  +     S S +KND+      IC+        E N 
Sbjct:   315 NVINHTLLRDKMNLITSSEEYLKDLHNCNFSNSSDKNDSFFKLYGICEYDKYLIDLEENA 374

Query:   495 NVNVFIKEEQNYHDIGKETKRHDDNN--NNNINDGDENKFCFKENIKKPNDIYNEDMENS 322
             + +    +E  Y+D+ K T    +N    NN N+ ++N    K N     D   +D +N+
Sbjct:   375 SFHYNNVDEYGYYDVNKNTNILSNNKIEQNNNNENNKNN---KNNNNNEVDYIKKDEDNN 431

Query:   321 ERTKDTNCEYNKKKKDEDDEEICLTS 244
               +K    +YN   ++ +  E  L +
Sbjct:   432 VNSKVFYSQYNNNAQNNEHTEFNLNN 457


>pir||S36955 cytochrome-c oxidase (EC 1.9.3.1) chain III - Herpetomonas
            muscarum muscarum mitochondrion (SGC6)
            Length = 288

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.3, P = 0.73
 Identities = 30/113 (26%), Positives = 55/113 (48%), Frame = +1

Query:   253 TYFFIIFIFFLFII----FTICI---FSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINI 411
             ++F ++F + +F+     F  C+   F  L + + F+ Y  WFF   F        +IN 
Sbjct:   103 SFFTVVFGYVIFLCCEFAFVFCLPMLFCCLLVDYGFVFY--WFFMDLFNL------LINT 154

Query:   412 IIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
              ++ +   FC F Y  +   FF     +  IF L  GI+F + L  +N L+   ++ + +
Sbjct:   155 FLLFVSGLFCNFFYFCVWFRFF-----VVCIFVLWCGILFGF-LFLWNQLWEFALLFVTV 208


>gi|1041785 (U36927) rhoptry protein [Plasmodium yoelii]
            Length = 2401

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 1.3, P = 0.73
 Identities = 50/187 (26%), Positives = 87/187 (46%), Frame = -1

Query:   591 YDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNN 412
             YD   + +H++TI  ++   +  +I   E  I  + F+ +   Y+D  K  K   ++ +N
Sbjct:   442 YDQ--FKEHMKTIPPNEMKYQKPSI---EIKIMKDEFLSKVNKYNDFDKVYKEKVESEHN 496

Query:   411 NINDGDENKFCFK---ENIKKPNDIYNEDMENSERTKDT-NCEY---NKKKKDEDDEEIC 253
                +   NK   +   E IKK  + +N+       TK +   EY   N  KK +D  ++C
Sbjct:   497 KFTELT-NKIKTEVSDEEIKKYENKFNDSKSLINETKKSIEEEYQNINTLKKVDDYIKVC 555

Query:   252 LTSSTLSTSSVGTQNDAGHQIYVRLDGSTNTIERQKIIKRFSKD--ENIFVFL---LSTK 88
             L ++ L T+    Q      +  +L+ +  TI+    I +   D  ENI       L TK
Sbjct:   556 LNTNELITNCHNKQTT----LKDKLNQNIKTIKETNSIDKIYTDKFENILTDKKTELETK 611

Query:    87 AGGVGLNLIAANHVILM 37
               G+ LN   +N+  L+
Sbjct:   612 FTGLSLNNHESNNKELL 628


>sp|P15577|NU2M_PARTE NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 2 >pir||S07734 NADH
            dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - Paramecium
            tetraurelia mitochondrion (SGC6) >gi|515876 (X15917) ND2 protein
            (AA 1-193) (unusual start codon) [Paramecium aurelia] >gi|1019630
            (M26930) NADH dehydrogenase subunit 2 [Paramecium aurelia]
            Length = 193

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.74
 Identities = 31/106 (29%), Positives = 49/106 (46%), Frame = +1

Query:   247 SKTYFF--IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIII 420
             S+ Y+F  I F  F  +IF + +     +   F+ ++I FF++FFKT   FI    +I +
Sbjct:    70 SQIYYFNNIFFFKFFVLIFFLNLAGIPPLLGFFLKFLI-FFFLFFKTNLAFI----LIFL 124

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYIY--IIFFLTYGIIFIYAL*TFNSLY 564
                M   FF    +  F   K   +     FF+   + F+Y    FN  Y
Sbjct:   125 GFNMATLFFYLSTVKSFVNRKQASVLNSFNFFIRAELSFLYF---FNFFY 171

 Score = 80 (28.2 bits), Expect = 3.0, P = 0.95
 Identities = 26/90 (28%), Positives = 44/90 (48%), Frame = +1

Query:   268 IFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             +F FFLF +  + +  S       +  I +F  IFF   F+ I  +N+  I  ++ F  F
Sbjct:    53 LFFFFLFNV-KVALLKS-------VSQIYYFNNIFFFKFFVLIFFLNLAGIPPLLGF--F 102

Query:   448 TYIMIILFFFYKHIYIYIIFFLTYGI--IFIY 537
                +I  F F+K    +I+ FL + +  +F Y
Sbjct:   103 LKFLIFFFLFFKTNLAFILIFLGFNMATLFFY 134


>pir||JS0233 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - Paramecium
            tetraurelia mitochondrion (SGC6)
            Length = 193

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.74
 Identities = 31/106 (29%), Positives = 49/106 (46%), Frame = +1

Query:   247 SKTYFF--IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIII 420
             S+ Y+F  I F  F  +IF + +     +   F+ ++I FF++FFKT   FI    +I +
Sbjct:    70 SQIYYFNNIFFFKFFVLIFFLNLAGIPPLLGFFLKFLI-FFFLFFKTNLAFI----LIFL 124

Query:   421 VIIMTFCFFTYIMIILFFFYKHIYIY--IIFFLTYGIIFIYAL*TFNSLY 564
                M   FF    +  F   K   +     FF+   + F+Y    FN  Y
Sbjct:   125 GFNMATLFFYLSTVKSFVNRKQASVLNSFNFFIRAELSFLYF---FNFFY 171

 Score = 80 (28.2 bits), Expect = 3.0, P = 0.95
 Identities = 26/90 (28%), Positives = 44/90 (48%), Frame = +1

Query:   268 IFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFF 447
             +F FFLF +  + +  S       +  I +F  IFF   F+ I  +N+  I  ++ F  F
Sbjct:    53 LFFFFLFNV-KVALLKS-------VSQIYYFNNIFFFKFFVLIFFLNLAGIPPLLGF--F 102

Query:   448 TYIMIILFFFYKHIYIYIIFFLTYGI--IFIY 537
                +I  F F+K    +I+ FL + +  +F Y
Sbjct:   103 LKFLIFFFLFFKTNLAFILIFLGFNMATLFFY 134


>pir||S53834 NADH dehydrogenase chain 4 - Acanthamoeba castellanii
            mitochondrion (SGC6) >gi|562038 (U12386) NADH dehydrogenase,
            subunit 4 [Acanthamoeba castellanii]
            Length = 497

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.3, P = 0.74
 Identities = 33/122 (27%), Positives = 61/122 (50%), Frame = +1

Query:   250 KTYFFIIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFF--YIFFKTKFIFIPIINIIIIV 423
             KT  F  F  F+ IIF   +  ++ +   F IY   F+  ++F       I + NI ++ 
Sbjct:    39 KTSLFFSFFQFILIIFFWILSDNISVLAEFDIYNFQFYKQWLFLYNFHYVIGMDNISLLF 98

Query:   424 IIMTFCFFTYIMIILFFF---YKH-IYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIII 591
             +++TF F T I I++ +    Y++  +I  + F+T+ +  I+ +      Y I   +I+I
Sbjct:    99 LLLTF-FLTPICILISWNSIKYRYNSFIICLIFITFILFNIFCVLDLVFFY-IFFESILI 156

Query:   592 YKFI 603
               FI
Sbjct:   157 PMFI 160


>gi|437639 (L04159) [Plasmodium falciparum 3' end.], gene product [Plasmodium
           falciparum]
           Length = 503

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.4, P = 0.74
 Identities = 34/134 (25%), Positives = 64/134 (47%), Frame = -1

Query:   576 YMDHIQTIKSSQSINKNDTICKE-ENNINVNVFIK-EEQNYHDIGKET----KRHDDN-- 421
             ++ +I ++K    +NKND + K+ E  +  N+    + Q Y ++ +E     K +++N  
Sbjct:   290 HLQNILSLKIDSLLNKNDEVIKDNETQLKTNILNSLKNQLYLNLKRELNEIIKEYEENQK 349

Query:   420 ----NNNNINDGDENKFCFKENIK--KPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
                 +N  +ND  E K     +IK  K  DIY   + ++E    T      K+K ++ E 
Sbjct:   350 KILHSNQLVNDSLEQKTNRLVDIKPTKHGDIYTNKLSDNE----TEMLITSKEKKDETES 405

Query:   258 ICLTSSTLSTSSVGTQND 205
                + +  + SS  T +D
Sbjct:   406 TKRSGTDHTNSSESTTDD 423


>gi|1658333 (U40232) exported serine/threonine protein kinase [Plasmodium
            falciparum]
            Length = 2510

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 1.4, P = 0.75
 Identities = 48/155 (30%), Positives = 75/155 (48%), Frame = -1

Query:   630 LDIIEE-ALLY-EFIYDDSDYM-----DHI---QTIKSSQSINKN-DTICKEENNINVNV 484
             L+++E+  + Y ++I D +D +     D I   + IK +  ++K  DT   E  N N N 
Sbjct:  1946 LNVLEDDEMFYIKYIMDYNDIVSLQWGDEIIQNERIKHNVHMHKKIDT--NESKNKNNNN 2003

Query:   483 FIKEEQNYHDIGKETKRHDDNNNNNIN-----DGDE-NKFCFKENIKKPNDI--YNEDM- 331
              I  +  Y+   K  K H DNNNNN N     + DE NK   K ++K  N    +N DM 
Sbjct:  2004 EINRDNAYNIYNKHKKNHADNNNNNNNIIISTNTDETNKEDKKGHVKSCNKKTPHNSDMC 2063

Query:   330 -ENSERTKDT-NCEYNKKK-----KDEDDEEICLTSS 241
               N   + +T    +NK K       +DDE++ + +S
Sbjct:  2064 PNNIRSSSNTVGMVFNKNKIYLNSLKKDDEKVHVGNS 2100


>pir||S23691 hypothetical protein 8 - Plasmodium falciparum
            Length = 256

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 1.4, P = 0.75
 Identities = 35/116 (30%), Positives = 54/116 (46%), Frame = -1

Query:   603 YEFIYDDSDYMDHIQTIKSSQSINKND-TICKEENNINVNVFIKEEQNYHDIGKETKRHD 427
             Y  I  + D   ++ +     SINK D T+   ENN N N+ I    + +   K    H+
Sbjct:   129 YNHINHNMDSSKNMISPNDRSSINKGDITMNNNENNNN-NMGISRSSS-NMFTKHNSFHN 186

Query:   426 DNNNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEI 256
              NNNN++N    N F     IKK N+ Y  +   S   K+ N   NK + ++++  I
Sbjct:   187 -NNNNDLNQ--INNF----GIKK-NEYYG-NFSTSRNAKNVNNLINKIEDNKNNNNI 234


>gnl|PID|e274726 (Y07786) Rfc-like protein [Vibrio cholerae]
            Length = 354

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 1.4, P = 0.76
 Identities = 21/81 (25%), Positives = 38/81 (46%), Frame = +1

Query:   250 KTYFFI-IFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             KT+FF+ IF FF   +     FS   +   F ++ I F +IF K K +F   +   + ++
Sbjct:    33 KTFFFVFIFSFFYLALVRNVFFSIWIVREFFFLFFISFLWIFLKNKNVFEYCLIYFLFIV 92

Query:   427 IMTFCFFTYIMIILFFFYKHI 489
              +     + I   + +FY  +
Sbjct:    93 NVLHVLQSIIGYKIVYFYNFL 113

 Score = 84 (29.6 bits), Expect = 3.1, P = 0.95
 Identities = 25/83 (30%), Positives = 39/83 (46%), Frame = +1

Query:   250 KTYFFI-IFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVI 426
             KT+FF+ IF FF   +     FS   +   F ++ I F +IF K K +F           
Sbjct:    33 KTFFFVFIFSFFYLALVRNVFFSIWIVREFFFLFFISFLWIFLKNKNVFE--------YC 84

Query:   427 IMTFCFFTYIMIIL--FFFYKHIYIY 498
             ++ F F   ++ +L     YK +Y Y
Sbjct:    85 LIYFLFIVNVLHVLQSIIGYKIVYFY 110


>gi|2258370 (AF007261) haem lyase [Reclinomonas americana]
            Length = 637

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 1.4, P = 0.76
 Identities = 34/106 (32%), Positives = 57/106 (53%), Frame = +1

Query:   328 FHIFIIYIIWF---FYIFFKTKFIFIP-IINIIIIVIIMTFCFFTYIMIILFFFYKHIYI 495
             F+I I+   ++    Y FFK      P   N +II I++ F  F +++  L+F ++ I I
Sbjct:   361 FYIIILIGTFYPTIHYFFFKQSITIGPSFYNQMIIPILVPF--FIFMISSLYFHWESIKI 418

Query:   496 YIIFFLTYGIIFIYAL*T--FNSLYMIHIITI-IIYKFI*QGLLYNIKK 633
               IFF T  ++FI+   T  F+ L+  +     I+Y FI   L+++I K
Sbjct:   419 KKIFFSTKELLFIFCFSTAIFSFLFFENYQRFYILYLFI-PFLVWSILK 466

 Score = 89 (31.3 bits), Expect = 1.8, P = 0.84
 Identities = 34/93 (36%), Positives = 47/93 (50%), Frame = +1

Query:   328 FHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFF-YKHIYIYII 504
             F IF+I  ++F +   K K IF     ++ I     FCF T I   LFF  Y+  YI  +
Sbjct:   401 FFIFMISSLYFHWESIKIKKIFFSTKELLFI-----FCFSTAIFSFLFFENYQRFYILYL 455

Query:   505 F--FLTYGII-FIYAL*TF---NSLYMI--HI-ITIII 591
             F  FL + I+   Y+   F   NS  M+  H  +TI I
Sbjct:   456 FIPFLVWSILKHFYSFFIFKKYNSFSMLISHFGVTIFI 493


>gi|769835 (U09185) unknown [Buchnera aphidicola]
           Length = 304

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.4, P = 0.76
 Identities = 27/122 (22%), Positives = 58/122 (47%), Frame = +1

Query:   256 YFFIIFIFFLFI-IFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIM 432
             YF + F+  L+   +     +S+ IF I  I +++  +IFF  K  F   I +++ +I +
Sbjct:    77 YFSLPFLLILYGGRYVNSTIASV-IFAIMPIIVLFLSFIFFNKKLYFFQFIGLVLAIIFL 135

Query:   433 TFCFFTYIMIILFFFYKHIYIYIIFFLTYGIIFIYAL*TFNSLYMIHIITIIIYKFI*QG 612
             +   F  I +      K +   ++   ++ II++Y+   +++   I I+T      +  G
Sbjct:   136 SIILFKEIELGDEKTIKGVIALLLAMTSHAIIYLYSKEKYSN---ISILTFNALPSLLSG 192

Query:   613 LLY 621
             L +
Sbjct:   193 LFF 195


>pir||S43286 MURF4 protein - Trypanosoma cruzi (fragment)
            Length = 64

  Plus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 1.6, P = 0.81
 Identities = 18/69 (26%), Positives = 32/69 (46%), Frame = +1

Query:   265 IIFIFFLFIIFTICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCF 444
             + FIFF F+ F + I     +F IF+      FY F     +F  I+ + I   ++    
Sbjct:     1 VFFIFFCFLDFLVFI-----LF-IFVFCFCLLFYGFLYLLDLFAAILQLFIFCNMILQLI 54

Query:   445 FTYIMIILF 471
               +++ +LF
Sbjct:    55 MDFLLFLLF 63

 Score = 64 (22.5 bits), Expect = 2.1, P = 0.88
 Identities = 20/63 (31%), Positives = 35/63 (55%), Frame = +1

Query:   259 FFIIFIFFLFIIFT--ICIFSSL*IFHIFIIYIIWFFYIFFKTKFIFIPIINIIII--VI 426
             FFI F F  F++F   I +F    +F+ F+ Y++  F    +  FIF  +I  +I+  ++
Sbjct:     2 FFIFFCFLDFLVFILFIFVFCFCLLFYGFL-YLLDLFAAILQL-FIFCNMILQLIMDFLL 59

Query:   427 IMTFC 441
              + FC
Sbjct:    60 FLLFC 64


>gi|309695 (M77713) major merozoite surface antigen [Plasmodium falciparum]
           >gi|309699 (M77715) major merozoite surface antigen [Plasmodium
           falciparum] >gi|309704 (M77718) major merozoite surface antigen
           [Plasmodium falciparum] >gi|309706 (M77719) major merozoite surface
           antigen [Plasmodium falciparum] >gi|309717 (M77725) major merozoite
           surface antigen [Plasmodium falciparum]
           Length = 213

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.7, P = 0.81
 Identities = 37/143 (25%), Positives = 73/143 (51%), Frame = -1

Query:   663 KSIIFSQFTTFLDIIEEAL--LYEFIYDDSDYMDHIQTI--KSSQSINKNDTICKEENN- 499
             K ++F  +   LD I++ +  + ++I  +   +++I  +  +S ++I+KN    KEE   
Sbjct:    65 KKLVFG-YRKPLDNIKDNVGKMEDYIKKNKKTIENINELIEESKKTIDKNKNATKEEEKK 123

Query:   498 ------INVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKFCFKENIKKPNDIYNE 337
                    +++++ K+ +  H++    ++  D    N     EN    KE + K N+I N 
Sbjct:   124 KLYQAQYDLSIYNKQLEEAHNLISVLEKRIDTLKKN-----EN---IKELLDKINEIKNP 175

Query:   336 DMENSERTKDTNCEYNKKKKDEDDE--EICLT 247
                NS  T +T  + NKK ++ + E  EI  T
Sbjct:   176 PPANSGNTPNTLLDKNKKIEEHEKEIKEIAKT 207


>gi|1022332 (X83707) protein kinase [Plasmodium falciparum]
            Length = 909

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 1.7, P = 0.81
 Identities = 29/112 (25%), Positives = 59/112 (52%), Frame = -1

Query:   609 LLYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRH 430
             +LY      ++  ++ + +++   +N  D  C   +NI  N+  K ++  H I  + + +
Sbjct:   440 ILYNSHNKSTNEQNYCEEVRNHDHVN--DP-CYNISNIKNNIHDKNKKENHTIDDDIQGN 496

Query:   429 DDNNNNNINDG-DENKFCFKENIKKPNDIYNEDMENSERTK-----DTNCEYNKKKKD 274
             D  N +  N+G D+ + C K N KK  D++ ++M+  ++ K       + +YNK  KD
Sbjct:   497 D--NYSLKNEGQDDLQVC-KNNDKKKKDLFVQEMQLCDKNKYEGSTSPSNDYNKYDKD 551


>gi|886923 (X87941) ORF 115 [Saccharomyces cerevisiae]
           Length = 115

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.7, P = 0.81
 Identities = 14/67 (20%), Positives = 34/67 (50%), Frame = +1

Query:   325 IFHIFIIYIIWFFYIFFKTKFIF-IPIINI-IIIVIIMTFCFFTYIMIILFFFYKHIYIY 498
             +F++F  + +W  ++FF   F+F + II+   ++ +   FC ++  +    F + +   +
Sbjct:     3 VFNVFFFFNLWLLFVFFPLAFLFNVYIISFDFMLCLSKAFCIYSCSLRFARFCFHNFDRF 62

Query:   499 IIFFLTY 519
             +I    Y
Sbjct:    63 VILNRLY 69


>sp|Q09772|YA83_SCHPO HYPOTHETICAL 89.2 KD HELICASE SPAC22F3.03C IN CHROMOSOME
            I >pir||S62418 hypothetical protein SPAC22F3.03c - fission yeast
            (Schizosaccharomyces pombe) >gi|1008431 (Z54285) unknown
            [Schizosaccharomyces pombe]
            Length = 780

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 1.8, P = 0.84
 Identities = 23/57 (40%), Positives = 32/57 (56%), Frame = -1

Query:   198 HQIYVRLDGSTNTIERQKIIKRF--SKDENIFVFLLSTKAGGVGLNLIAANHVILMD 34
             H  + +L GST   ER  I+  F  S  +   V LLS+KAGG GLNL  +  +I+ +
Sbjct:   541 HVRFCKLLGSTPFSERDLIVHNFNTSSFKEFSVLLLSSKAGGCGLNLTGSTRLIIYE 597


>sp|P04931|ARP_PLAFA ASPARAGINE-RICH PROTEIN (AG319) (ARP) >pir||A23770
            asparagine-rich protein - Plasmodium falciparum >gi|160092 (M24328)
            asparagine-rich protein [Plasmodium falciparum]
            Length = 537

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 1.9, P = 0.85
 Identities = 27/111 (24%), Positives = 52/111 (46%), Frame = -1

Query:   591 YDDSDYMDHIQTIKS---SQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDN 421
             YDD+    +  T  +   S+++  N+      NN+N  V      N    G   K ++++
Sbjct:   371 YDDNTVHVNNNTPSTDFFSRAVGYNNNYLNNNNNMNSAV-----NNNSSNGNNMK-NENS 424

Query:   420 NNNNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEE 259
              N N+ D +++      N    N+I   +  N+  T + N EYN +  +ED+++
Sbjct:   425 ENKNVADNNDS---LNNNKNNNNNINMNESINNNNTLNNNNEYNNQNNNEDEDD 475

 Score = 86 (30.3 bits), Expect = 3.2, P = 0.96
 Identities = 34/111 (30%), Positives = 56/111 (50%), Frame = -1

Query:   555 IKSSQSINKN-----DTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGD- 394
             +K+  S NKN     D++   +NN N N+ + E  N ++       +++ NNN   D D 
Sbjct:   419 MKNENSENKNVADNNDSLNNNKNNNN-NINMNESINNNNTLNNNNEYNNQNNNEDEDDDD 477

Query:   393 -----ENKFCFKENI-KKPNDIYNE---DMEN-SERTKD-TNCEYNKKKKDE 271
                  E+K+    +I KK N I N+   D+ + S++  D  N + NK KKD+
Sbjct:   478 WGELGEDKYIDINSIMKKKNVILNQLEADLNDLSKKGNDGKNKKKNKMKKDD 529

 Score = 86 (30.3 bits), Expect = 3.2, P = 0.96
 Identities = 29/112 (25%), Positives = 52/112 (46%), Frame = -1

Query:   528 NDTICKEENNINVNVFIKEEQNYHDIGKETKRHD------DNNNNNINDGDENKFCFKEN 367
             ND + K ENN N+N +  ++   H +   T   D        NNN +N+ +        N
Sbjct:   356 NDNM-KRENN-NMNNYGYDDNTVH-VNNNTPSTDFFSRAVGYNNNYLNNNNNMNSAVNNN 412

Query:   366 IKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLSTSSVGTQNDAGHQ 193
                 N++ NE+ EN +   D N   N  K + ++  I +  S  + +++   N+  +Q
Sbjct:   413 SSNGNNMKNENSEN-KNVADNNDSLNNNKNNNNN--INMNESINNNNTLNNNNEYNNQ 467

 Score = 82 (28.9 bits), Expect = 9.1, P = 1.0
 Identities = 26/103 (25%), Positives = 48/103 (46%), Frame = -1

Query:   591 YDDSDYMDHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETK-RHDDNNN 415
             Y + + +   Q    + +IN+++      NN N  VF   + N  +       + + NNN
Sbjct:   172 YMNKNNLKFTQNNNDNMNINEDNNNNNNNNNNNNGVFSNYQNNNMNRNNSINIKRNLNNN 231

Query:   414 NNINDGDENKFCFKE-NIKKPNDIY-NEDMENSERTKDTNCEYN 289
             NNIN+ + NK   ++ N    N+ Y N + +N + + + N   N
Sbjct:   232 NNINN-NMNKMGSQDKNQNSNNNFYMNYNYQNRKNSMNNNMNNN 274


>sp|P13824|ARP2_PLAFA CLUSTERED-ASPARAGINE-RICH PROTEIN >pir||A23535
            clustered-asparagine-rich protein - Plasmodium falciparum
            (fragment) >gi|552179 (M13021) antigen [Plasmodium falciparum]
            Length = 451

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 2.0, P = 0.86
 Identities = 44/175 (25%), Positives = 80/175 (45%), Frame = -1

Query:   561 QTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDENKF 382
             Q + ++  +N+N+ +    NN N N     +  Y D G+ +  H +NNNNNIN+ + N  
Sbjct:   221 QQMNNNPMLNQNNFMLNNNNNYNNNAKNVNDM-YRD-GEMSPNHLNNNNNNINNNNNNN- 277

Query:   381 CFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTLS-TSSVGTQND 205
                 N    N ++ ++  NS   +      N  +  E+ + + L        +++   N+
Sbjct:   278 --NNNNNNNNVMFRQN--NSHLAQMYQANDNSLEDVENVDGLSLWEMYKDKNNNIFYYNN 333

Query:   204 -AGHQIYVRLDGSTNTIERQKIIKRFSKDENIFV-FLLSTKAGGVGLNLIAAN-HVILM 37
                H   + L   TN      I+K+ +K + + V +L ST     G  LI +N  V+L+
Sbjct:   334 LTKHANGINLFTQTN-YSSITIMKKQNKMDLVEVTYLFSTYLVN-GQTLIYSNISVVLV 390


>pir||S14469 asparagine-rich protein (clone 17C1) - Plasmodium falciparum
            (fragment) >gi|1335714 (X17484) Plasmodium falciparum mRNA for
            asparagine-rich antigen (clone 17C1) [Plasmodium falciparum]
            Length = 234

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 2.0, P = 0.87
 Identities = 22/90 (24%), Positives = 38/90 (42%), Frame = -1

Query:   570 DHIQTIKSSQSINKNDTICKEENNINVNVFIKEEQNYHDIGKETKRHDDNNNNNINDGDE 391
             D ++    +Q  NK   +    NN N +   +   N ++I      +++NN+NN N+   
Sbjct:    46 DKMKNFHVNQKQNKFKKMINRNNNNNFSNIRQGNNNMNNIMNNYNGNNNNNSNNNNNSSN 105

Query:   390 NKFCFKENIKKPNDIYNEDMENSERTKDTN 301
             N      N    N++YN    N+    D N
Sbjct:   106 NNHMSNNN-NNNNNMYNHMNNNNPFFNDNN 134


>bbs|170479 (S79359) arabinogalactan-protein, AGP [Nicotiana alata,
            cell-suspension culture filtrate, Peptide, 461 aa] [Nicotiana
            alata]
            Length = 461

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 2.0, P = 0.87
 Identities = 25/92 (27%), Positives = 40/92 (43%), Frame = -1

Query:   546 SQSINKNDTICKEE-NNINVNVFIKEEQNYHDIGKETKRHDDNNNN-NINDGDENKFCFK 373
             SQS N N+    E  NN N NVF  E  N +   K+   +  + N  N N+G    +   
Sbjct:   246 SQSYNNNNNFYSENYNNNNNNVF-SENSNNNGYSKKINNNGYSQNYMNNNNGFSESYNNN 304

Query:   372 ENIKKPNDIYNEDMENSERTKDTNCEYNKKKKD 274
              N    N++++E+  N+      +  YN    +
Sbjct:   305 NNNNNNNNVFSENYNNNNNNNVFSENYNNNNNN 337

 Score = 85 (29.9 bits), Expect = 3.4, P = 0.97
 Identities = 30/100 (30%), Positives = 45/100 (45%), Frame = -1

Query:   546 SQSINKNDTICKEE-NNINVNVFIKEEQNYHDIGKE------TKRHDDNNN------NNI 406
             SQS N N+    E  NN N NVF  E  N +   K+      ++ + +NNN      NN 
Sbjct:   246 SQSYNNNNNFYSENYNNNNNNVF-SENSNNNGYSKKINNNGYSQNYMNNNNGFSESYNNN 304

Query:   405 NDGDENKFCFKENIKKPND--IYNEDMENSERTKDTNCEYN 289
             N+ + N   F EN    N+  +++E+  N+         YN
Sbjct:   305 NNNNNNNNVFSENYNNNNNNNVFSENYNNNNNNNAFYENYN 345


>pir||S49313 protein kinase - slime mold (Dictyostelium discoideum)
            >pir||S52076 protein kinase - slime mold (Dictyostelium discoideum)
            >gi|551446 (Z37981) protein kinase [Dictyostelium discoideum]
            Length = 1094

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 2.1, P = 0.87
 Identities = 29/144 (20%), Positives = 64/144 (44%), Frame = -1

Query:   606 LYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEEN-NINVNVFI-KEEQNYHDIGKETKR 433
             +Y+   DD D  D   +     S N N  +  E N N N +    +E+Q   +  ++ + 
Sbjct:   329 IYDDDDDDDDDDDDNDSFPRPYSDNSNSNVTLESNSNYNSSTINGQEQQEQQEQQQQQQV 388

Query:   432 HDDNNNNNINDGDENKFCFKENIKKPNDIYNEDM-----ENSERTKDTNCEYNKKKKDED 268
              ++ +   I   D+N   +  + +K  + + +++     +N E + D N  Y +++++E+
Sbjct:   389 KEERDEGEIEQDDDNIEVYDSDYQKKLEEHQKELLERQNQNQEGSTDENEVYEQEEEEEE 448

Query:   267 DEEICLTSSTLSTSSVGTQNDAGH 196
             ++E     ST +   +    D  H
Sbjct:   449 EDEEEQVISTPAKKRISFGQDTFH 472

 Score = 90 (31.7 bits), Expect = 2.7, P = 0.93
 Identities = 32/152 (21%), Positives = 68/152 (44%), Frame = -1

Query:   606 LYEFIYDDSDYMDHIQTIKSSQSINKNDTICKEEN-NINVNVFI-KEEQNYHDIGKETKR 433
             +Y+   DD D  D   +     S N N  +  E N N N +    +E+Q   +  ++ + 
Sbjct:   329 IYDDDDDDDDDDDDNDSFPRPYSDNSNSNVTLESNSNYNSSTINGQEQQEQQEQQQQQQV 388

Query:   432 HDDNNNNNINDGDENKFCFKENIKKPNDIYNEDM-----ENSERTKDTN--CEYNKKKKD 274
              ++ +   I   D+N   +  + +K  + + +++     +N E + D N   E  +++++
Sbjct:   389 KEERDEGEIEQDDDNIEVYDSDYQKKLEEHQKELLERQNQNQEGSTDENEVYEQEEEEEE 448

Query:   273 EDDEEICLTSSTLSTSSVGTQNDAGHQIYVRLD 175
             ED+EE  +++      S G      ++ Y R D
Sbjct:   449 EDEEEQVISTPAKKRISFGQDTFHTYEAY-RTD 480


>sp|P11673|YCX1_OENBE HYPOTHETICAL 8.5 KD PROTEIN (ORF B72) >pir||S05485
            hypothetical protein b72 - evening primrose chloroplast >gi|11912
            (X12859) ORF b72 (AA 1 - 72) [Oenothera berteriana]
            Length = 72

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.1, P = 0.88
 Identities = 14/44 (31%), Positives = 23/44 (52%), Frame = +2

Query:   287 LLYSQFVSLVLSEFSISSLYISFGFFIFSLKQNLFSSPSLILLL 418
             LLY+ F  L+L+   + S +  F F ++ L  N   SP  + L+
Sbjct:     3 LLYTHFYHLILNTRRVDSSFFVFSFHLYFLNDNKGMSPLCLSLV 46


>gi|1142588 (U05313) CR3 [Trypanosoma brucei]
            Length = 70

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.1, P = 0.88
 Identities = 15/56 (26%), Positives = 31/56 (55%), Frame = +1

Query:   334 IFIIYIIWFFYIFFKTKFIFIPIINIIIIVI-----IMTFCF-FTY-IMIILFFFY 480
             +F   ++ FFY  F   F F+ + ++ + ++     ++ FCF F   +++ LFFF+
Sbjct:     1 MFDCLVLLFFYCLFVHFFCFLFVCDLFLCLLFSFCFLLDFCFLFNMGLLLCLFFFF 56

 Score = 63 (22.2 bits), Expect = 2.7, P = 0.93
 Identities = 14/59 (23%), Positives = 30/59 (50%), Frame = +1

Query:   334 IFIIYIIWFFYIFFKTKFIFIPIINIIIIVIIMTFCFFTYIMIILFFFYKHIYIYIIFF 510
             +F   ++ FFY  F   F F+ + ++ +  ++ +FCF   ++   F F   + + + FF
Sbjct:     1 MFDCLVLLFFYCLFVHFFCFLFVCDLFLC-LLFSFCF---LLDFCFLFNMGLLLCLFFF 55


>gi|1840435 (U50282) SH protein [Mumps virus]
            Length = 57

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.1, P = 0.88
 Identities = 9/26 (34%), Positives = 19/26 (73%), Frame = +1

Query:   442 FFTYIMIILFFFYKHIYIYIIFFLTY 519
             + T++++IL +  K +Y++II  +TY
Sbjct:     9 YLTFLLLILLYLVKTLYVWIILTITY 34


>gnl|PID|e353197 (Z99707) cysteine proteinase [Arabidopsis thaliana]
            Length = 332

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 2.1, P = 0.88
 Identities = 35/138 (25%), Positives = 63/138 (45%), Frame = -1

Query:   423 NNNNN--INDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICL 250
             NNNNN  IND D+    FK+N++   D++NED +N+        ++     DE   ++ L
Sbjct:    16 NNNNNGIINDQDKRFNIFKDNLRFI-DLHNEDNKNATYKLGLT-KFTDLTNDEY-RKLYL 72

Query:   249 TSSTLSTSSVGTQNDAGHQIYVRLDGST--NTIE-RQKIIKRFSKDENIF--VFLLSTKA 85
              + T     +    +   +    ++G     T++ RQK      KD+      +  ST A
Sbjct:    73 GARTEPARRIAKAKNVNQKYSAAVNGKEVPETVDWRQKGAVNPIKDQGTCGSCWAFSTTA 132

Query:    84 GGVGLNLIAANHVILMDQVKI 22
                G+N I    +I + + ++
Sbjct:   133 AVEGINKIVTGELISLSEQEL 153


>sp|P54674|P3K2_DICDI PHOSPHATIDYLINOSITOL 3-KINASE 2 (PI3-KINASE)
            (PTDINS-3-KINASE) (PI3K) >gi|733522 (U23477)
            phosphatidylinositol-4,5-diphosphate 3-kinase [Dictyostelium
            discoideum]
            Length = 1858

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 2.2, P = 0.89
 Identities = 29/129 (22%), Positives = 54/129 (41%), Frame = -1

Query:   588 DDSDYMDHIQTIKSSQSINKNDTICKEENN-INVNVFIKEEQNYH-DIGKETKRHDDNNN 415
             D  DY + + +I S+   +   +I +++   I   + IKE    + D  KE K    NNN
Sbjct:   958 DFDDYDEDLDSINSNSFDDLKQSIQQQQQQQIQTVINIKETNKENKDSNKENKDSSSNNN 1017

Query:   414 NNINDGDENKFCFKENIKKPNDIYNEDMENSERTKDTNCEYNKKKKDEDDEEICLTSSTL 235
             NN N+ + N      N    N+  N +   +    ++N   ++   D +       + + 
Sbjct:  1018 NNNNNNNNNNNNNNNNNNNNNNNNNGNNNGNNSNNNSNSNISRGSIDSEGNGSGSGNGSE 1077

Query:   234 STSSVGTQN 208
               + +G QN
Sbjct:  1078 QPTLIGVQN 1086


WARNING:  HSPs involving 90 database sequences were not reported due to the
          limiting value of parameter B = 250.


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.97
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.373   0.179   0.716
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.356   0.157   0.495
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.374   0.176   0.633
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.314   0.133   0.369    same    same    same
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.375   0.170   0.604
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.408   0.192   0.883
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      220       220      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   +2      0      220       220      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   +1      0      221       221      10. 63 3  12 22    0.11 35
                                                  32    0.12 38
   -1      0      221       221      10. 63 3  12 23    0.12 35
                                                  32    0.12 38
   -2      0      220       220      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   -3      0      220       220      10. 63 3  12 22    0.10 35
                                                  32    0.12 38


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  340
  No. of states in DFA:  587 (58 KB)
  Total size of DFA:  223 KB (256 KB)
  Time to generate neighborhood:  0.02u 0.01s 0.03t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  163.92u 0.52s 164.44t  Elapsed: 00:00:43
  Total cpu time:  164.48u 0.67s 165.15t  Elapsed: 00:00:44
  Start:  Fri Feb  6 20:27:58 1998   End:  Fri Feb  6 20:28:42 1998

WARNINGS ISSUED:  1

Date: 14:50:51 on Sun 17 Dec 117.