blastx_gbnr_files/1206485_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1206485
        (392 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|1946329           (U69154) prohibitin [Nicotiana ta... +3    94  0.0019    1
A gnl|PID|d1031562     (AP000006) 266aa long hypothetica... +3    92  0.012     1
A gi|2655363           (AF034831) stomatin like protein ... +3    82  0.36      1
A gi|1946331           (U69155) prohibitin [Arabidopsis ... +3    82  0.49      1
A gi|2649154           (AE001006) membrane protein [Arch... +3    79  0.77      1
A pir||S35239          thymidylate synthase (EC 2.1.1.45... +3    77  0.95      1
A sp|P54081|TYSA_BACAM THYMIDYLATE SYNTHASE A (TS A) (TS... +3    77  0.97      1
A sp|P11044|TYSB_BACSU THYMIDYLATE SYNTHASE B (TS B) (TS... +3    76  0.98      1
A sp|P35232|PHB_HUMAN  PROHIBITIN >pir||I52690 prohibiti... +3    76  0.99      1
A gi|181184            (M81635) stomatin peptide [Homo s... +3    75  0.999     1
A sp|P27105|BAN7_HUMAN ERYTHROCYTE BAND 7 INTEGRAL MEMBR... +3    75  0.999     1
A gi|1103842           (U33931) band 7.2b stomatin [Homo... +3    75  0.999     1
A gi|2983432           (AE000713) erythrocyte band 7 hom... +3    74  0.9992    1
A sp|P37085|DRPH_ORCLI PIGMENT-DISPERSING HORMONE PRECUR... +2    56  0.9992    1



>gi|1946329 (U69154) prohibitin [Nicotiana tabacum]
            Length = 279

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.0019, P = 0.0019
 Identities = 28/100 (28%), Positives = 44/100 (44%), Frame = +3

Query:    90 TAGPGCHCILPWTSKAGTLSMRLYEHNIHIRSKTKDNVFVNIRLTVHVQVIPGRENSAFY 269
             T G G H ++PW  K     +R   H     S TKD   V++ L V  +    R  + F 
Sbjct:    54 TVGEGTHFLVPWLQKPFIFDIRTRPHTFSSVSGTKDLQMVHLTLRVLSRPEVARLPAIFK 113

Query:   270 SV--EAPLKVIQSYVENCVETKIPLYNLDALFIERGXISS 383
             ++  E   KV+ S     ++  +  +N D L  ER  +S+
Sbjct:   114 TLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPQVSA 153


>gnl|PID|d1031562 (AP000006) 266aa long hypothetical erythrocyte band7 integral
            membrane protein [Pyrococcus horikoshii]
            Length = 266

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.012, P = 0.012
 Identities = 29/114 (25%), Positives = 55/114 (48%), Frame = +3

Query:    39 VEQSDVALLETCGKYVGTAGPGCHCILPWTSKAGTLSMRLYEHNIHIRSK-TKDNVFVNI 215
             V++ + A++   G+ VG  GPG   I+P   KA  + +R    ++ ++   TKDNV V +
Sbjct:    28 VKEYERAVIFRLGRVVGARGPGLFFIIPIFEKAVIVDLRTQVLDVPVQETITKDNVPVRV 87

Query:   216 RLTVHVQVIPGRENSAFYSVEAPLKVIQSYVENCVETKIPLYNLDALFIERGXIS 380
                V+ +V+   +  A   V+  +       +  + + I   +LD L  ER  ++
Sbjct:    88 NAVVYFRVVDPVK--AVTQVKNYIMATSQISQTTLRSVIGQAHLDELLSERDKLN 140


>gi|2655363 (AF034831) stomatin like protein [Rhizobium etli]
            Length = 222

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.44, P = 0.36
 Identities = 21/106 (19%), Positives = 51/106 (48%), Frame = +3

Query:    69 TCGKYVGTAGPGCHCILPWTSKAGTLSMRLYEHNIHIRSK-TKDNVFVNIRLTVHVQVIP 245
             T G++ G  GPG   ++P+  +   + +R    ++  +   + DNV V +   ++ +VI 
Sbjct:     7 TLGRFTGVKGPGLILLIPYVQQMIRVDLRTRVLDVPSQDVISHDNVSVRVSAVIYFRVID 66

Query:   246 GRENSAFYSVEAPLKVIQSYVENCVETKIPLYNLDALFIERGXISSN 386
               +++    VE  +       +  + + +  ++LD +  ER  ++S+
Sbjct:    67 PEKSTI--QVEDFMMATSQLAQTTLRSVLGKHDLDEMLAERDRLNSD 111


>gi|1946331 (U69155) prohibitin [Arabidopsis thaliana]
            Length = 277

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.67, P = 0.49
 Identities = 27/100 (27%), Positives = 42/100 (42%), Frame = +3

Query:    90 TAGPGCHCILPWTSKAGTLSMRLYEHNIHIRSKTKDNVFVNIRLTVHVQVIPGRENSAFY 269
             T G G H ++P   +     +R   H     S TKD   VN+ L V  +    R    F 
Sbjct:    54 TVGEGTHFLIPILQRPHIFDIRTKPHTFSSISGTKDLQMVNLTLRVLSRPEVSRLPYIFQ 113

Query:   270 SV--EAPLKVIQSYVENCVETKIPLYNLDALFIERGXISS 383
             ++  E   KV+ S     ++  +  +N D L  ER  +S+
Sbjct:   114 TLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSA 153


>gi|2649154 (AE001006) membrane protein [Archaeoglobus fulgidus]
            Length = 249

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 1.5, P = 0.77
 Identities = 21/97 (21%), Positives = 48/97 (49%), Frame = +3

Query:    39 VEQSDVALLETCGKYVGTAGPGCHCILPWTSKAGTLSMRLYEHNIHIRSK-TKDNVFVNI 215
             V++ +  ++   G+ VG  GPG   I+P       + +R   +++  +   TKDNV V +
Sbjct:    23 VKEYERGVIFRLGRLVGARGPGLFFIIPILENMVVVDLRTVTYDVPSQEVVTKDNVTVKV 82

Query:   216 RLTVHVQVI-PGRENSAFYSVE-APLKVIQSYVENCV 320
                V+ +V+ P +  +  +  + A  ++ Q+ + + +
Sbjct:    83 NAVVYYRVVDPAKAVTEVFDYQYATAQLAQTTLRSII 119


>pir||S35239 thymidylate synthase (EC 2.1.1.45) B - Bacillus subtilis (ATCC
            6633) >gi|311940 (X69661) thymidylate synthase B [Bacillus
            subtilis] >prf||1916395A thymidylate synthase B [Bacillus subtilis]
            Length = 264

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 3.1, P = 0.95
 Identities = 17/71 (23%), Positives = 32/71 (45%), Frame = +3

Query:    99 PGCHCILPWTSKAGTLSMRLYEHNIHIRSKTKDNVFVNIRLTVHVQVIPGRENSAFYSVE 278
             P CHC+  +    G LS +LY+ +  +      N+     LT+ +  + G E   F    
Sbjct:   144 PPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIASYALLTMMIAHVTGLEPGEFIHTF 203

Query:   279 APLKVIQSYVE 311
               + + Q+++E
Sbjct:   204 GDVHIYQNHIE 214


>sp|P54081|TYSA_BACAM THYMIDYLATE SYNTHASE A (TS A) (TSASE A) >gnl|PID|e190199
            (Z50164) thymidylate synthetase [Bacillus amyloliquefaciens]
            Length = 282

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 3.4, P = 0.97
 Identities = 18/71 (25%), Positives = 32/71 (45%), Frame = +3

Query:    99 PGCHCILPWTSKAGTLSMRLYEHNIHIRSKTKDNVFVNIRLTVHVQVIPGRENSAFYSVE 278
             P CHC+  +    G LS +LY+ +  +      N+     LT+ +  + G E   F    
Sbjct:   162 PPCHCLFQFYVADGKLSCQLYQRSADVFLGVPFNIASYALLTMMIAHVTGLEPGEFVHTF 221

Query:   279 APLKVIQSYVE 311
               + + Q++VE
Sbjct:   222 GDVHIYQNHVE 232


>sp|P11044|TYSB_BACSU THYMIDYLATE SYNTHASE B (TS B) (TSASE B) >gi|143741
            (M20012) thymidylate synthase B (thyB) [Bacillus subtilis]
            >gi|1256640 (L77246) thymidylate synthase [Bacillus subtilis]
            >gnl|PID|e1183629 (Z99115) thymidylate synthase B [Bacillus
            subtilis]
            Length = 264

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 4.1, P = 0.98
 Identities = 17/71 (23%), Positives = 32/71 (45%), Frame = +3

Query:    99 PGCHCILPWTSKAGTLSMRLYEHNIHIRSKTKDNVFVNIRLTVHVQVIPGRENSAFYSVE 278
             P CHC+  +    G LS +LY+ +  +      N+     LT+ +  + G E   F    
Sbjct:   144 PPCHCLFQFYVSDGKLSCQLYQRSADVFLGVPFNIASYALLTMIIAHVTGLEPGEFIHTF 203

Query:   279 APLKVIQSYVE 311
               + + Q+++E
Sbjct:   204 GDVHIYQNHIE 214


>sp|P35232|PHB_HUMAN PROHIBITIN >pir||I52690 prohibitin - human >bbs|85658
            (S85655) prohibitin [human, Peptide, 272 aa] [Homo sapiens]
            Length = 272

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 4.3, P = 0.99
 Identities = 21/97 (21%), Positives = 43/97 (44%), Frame = +3

Query:    96 GPGCHCILPWTSKAGTLSMRLYEHNIHIRSKTKDNVFVNIRLTVHVQVIPGRENSAFYSV 275
             G G H ++PW  K      R    N+ + + +KD   VNI L +  + +  +    F S+
Sbjct:    51 GEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSI 110

Query:   276 --EAPLKVIQSYVENCVETKIPLYNLDALFIERGXIS 380
               +   +V+ S     +++ +  ++   L  +R  +S
Sbjct:   111 GEDYDERVLPSITTEILKSVVARFDAGELITQRELVS 147


>gi|181184 (M81635) stomatin peptide [Homo sapiens]
           Length = 288

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 6.6, P = 1.0
 Identities = 30/122 (24%), Positives = 60/122 (49%), Frame = +3

Query:    24 LCYTCVEQSDVALLETCGKYV--GTAGPGCHCILPWTSKAGTLSMRLYEHNIHIRS-KTK 194
             +C   +++ + A++   G+ +  G  GPG   ILP T     + MR    +I  +   TK
Sbjct:    52 MCIKIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTK 111

Query:   195 DNVFVNIRLTVHVQVIPGRENSA-FYSVEAPLKVI-QSYVENCVETKIPLYNLDALFIER 368
             D+V +++   V+ +V       A   + ++  +++ Q+ + N + TK    NL  +  +R
Sbjct:   112 DSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTK----NLSQILSDR 167

Query:   369 GXISSN 386
               I+ N
Sbjct:   168 EEIAHN 173


>sp|P27105|BAN7_HUMAN ERYTHROCYTE BAND 7 INTEGRAL MEMBRANE PROTEIN (STOMATIN)
            (PROTEIN 7.2B) >pir||S17659 membrane protein 7, erythrocyte - human
            >gi|31069 (X60067) erythrocyte band 7 integral membrane protein
            [Homo sapiens] >gi|1161562 (X85116) stomatin [Homo sapiens]
            >prf||2204264A band 7 integral membrane protein [Homo sapiens]
            Length = 288

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 6.6, P = 1.0
 Identities = 30/122 (24%), Positives = 60/122 (49%), Frame = +3

Query:    24 LCYTCVEQSDVALLETCGKYV--GTAGPGCHCILPWTSKAGTLSMRLYEHNIHIRS-KTK 194
             +C   +++ + A++   G+ +  G  GPG   ILP T     + MR    +I  +   TK
Sbjct:    52 MCIKIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTK 111

Query:   195 DNVFVNIRLTVHVQVIPGRENSA-FYSVEAPLKVI-QSYVENCVETKIPLYNLDALFIER 368
             D+V +++   V+ +V       A   + ++  +++ Q+ + N + TK    NL  +  +R
Sbjct:   112 DSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTK----NLSQILSDR 167

Query:   369 GXISSN 386
               I+ N
Sbjct:   168 EEIAHN 173


>gi|1103842 (U33931) band 7.2b stomatin [Homo sapiens] >prf||2201444A membrane
            protein band 7.2b [Homo sapiens]
            Length = 296

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 6.9, P = 1.0
 Identities = 30/122 (24%), Positives = 60/122 (49%), Frame = +3

Query:    24 LCYTCVEQSDVALLETCGKYV--GTAGPGCHCILPWTSKAGTLSMRLYEHNIHIRS-KTK 194
             +C   +++ + A++   G+ +  G  GPG   ILP T     + MR    +I  +   TK
Sbjct:    60 MCIKIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTK 119

Query:   195 DNVFVNIRLTVHVQVIPGRENSA-FYSVEAPLKVI-QSYVENCVETKIPLYNLDALFIER 368
             D+V +++   V+ +V       A   + ++  +++ Q+ + N + TK    NL  +  +R
Sbjct:   120 DSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTK----NLSQILSDR 175

Query:   369 GXISSN 386
               I+ N
Sbjct:   176 EEIAHN 181


>gi|2983432 (AE000713) erythrocyte band 7 homolog [Aquifex aeolicus]
            Length = 253

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 7.1, P = 1.0
 Identities = 17/69 (24%), Positives = 36/69 (52%), Frame = +3

Query:    39 VEQSDVALLETCGKYVGTAGPGCHCILPWTSKAGTLSMRLYEHNIHIRSK-TKDNVFVNI 215
             + + + A++   G+ +G  GPG   ++P   +   +S+R    ++  +   TKDNV V +
Sbjct:    26 IPEYERAVVFRLGRVIGAKGPGLIIVIPIIDRIVRVSLRTVTLDVPTQDVITKDNVTVQV 85

Query:   216 RLTVHVQVI 242
                V+ +V+
Sbjct:    86 DAVVYFRVV 94


>sp|P37085|DRPH_ORCLI PIGMENT-DISPERSING HORMONE PRECURSOR (PDH) (LIGHT
            ADAPTING DISTAL RETINAL PIGMENT HORMONE) (DRPH) >pir||S32498
            pigment-dispersing hormone - Orconectes limosus >bbs|130896
            (S59496) pigment-dispersing hormone preprohormone, PDH precursor
            [Orconectes limosus=crayfish, eyestalk, medulla terminalis, medulla
            interna, Peptide, 76 aa] [Orconectes limosus] >prf||1912192A
            pigment-dispersing hormone [Orconectes limosus]
            Length = 76

  Plus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 7.2, P = 1.0
 Identities = 12/26 (46%), Positives = 15/26 (57%), Frame = +2

Query:   245 WPGELGLLLR*GPAKGHSELCGELRG 322
             WPG LG +   GP K +SEL   + G
Sbjct:    41 WPGSLGTMAG-GPHKRNSELINSILG 65


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=6.00
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.339   0.148   0.486  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.339   0.154   0.552  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.336   0.138   0.492  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.337   0.150   0.460  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.341   0.143   0.481  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.336   0.142   0.524  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      130       129       10.  70 3 1000 22  0.11    33
                                                     29  0.12    35
   +2      0      130       129       10.  70 3 1000 22  0.11    33
                                                     29  0.12    35
   +1      0      130       129       10.  70 3 1000 22  0.11    33
                                                     29  0.12    35
   -1      0      130       129       10.  70 3 1000 22  0.11    33
                                                     29  0.12    35
   -2      0      130       129       10.  70 3 1000 22  0.11    33
                                                     29  0.12    35
   -3      0      130       129       10.  70 3 1000 22  0.11    33
                                                     29  0.12    35


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  14
  No. of states in DFA:  341 (34 KB)
  Total size of DFA:  43 KB (64 KB)
  Time to generate neighborhood:  0.01u 0.00s 0.01t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  30.19u 1.16s 31.35t  Elapsed: 00:00:06
  Total cpu time:  30.24u 2.25s 32.49t  Elapsed: 00:00:07
  Start:  Thu Sep 24 15:33:19 1998   End:  Thu Sep 24 15:33:26 1998

Date: 16:30:19 on Sun 17 Dec 117.