blastx_gbnr_files/1327770_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1327770
        (339 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A sp|P34661|YOY3_CAEEL HYPOTHETICAL 9.8 KD PROTEIN ZK652... +3   355  9.3e-32   1
A gi|1235522           (Z70222) ORF is homologous to hyp... +3   327  8.6e-29   1
A pdb|1XDT|R           Chain R, Complex Of Diphtheria To... -3    58  0.94      1
A gi|3168959           (AF068714) No definition line fou... +2    60  0.9995    1
A gi|3168958           (AF068714) No definition line fou... +2    67  0.99992   1



>sp|P34661|YOY3_CAEEL HYPOTHETICAL 9.8 KD PROTEIN ZK652.3 IN CHROMOSOME III
            >pir||S44903 ZK652.3 protein - Caenorhabditis elegans >gi|289769
            (L14429) putative [Caenorhabditis elegans]
            Length = 94

  Plus Strand HSPs:

 Score = 355 (125.0 bits), Expect = 9.3e-32, P = 9.3e-32
 Identities = 67/82 (81%), Positives = 75/82 (91%), Frame = +3

Query:    24 SKISFKITLTSDPNLPFKVLKVPENAPFTAVLKFAAEEFSVPAATSAIITDDGIGINPQQ 203
             SK++FKITLTSDP LPFKVL VPE+ PFTAVLKFAAEEF VPAATSAIIT+DG+G+NP Q
Sbjct:    12 SKVTFKITLTSDPKLPFKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGVGVNPAQ 71

Query:   204 TAGEVFLKHGSDLRLIPRDRVG 269
              AG +FLKHGS+LRLIPRDRVG
Sbjct:    72 PAGNIFLKHGSELRLIPRDRVG 93


>gi|1235522 (Z70222) ORF is homologous to hypothetical 9.8 kD protein ZK652.3
            of Caenorhabditis elegans, sp>P34661 [Homo sapiens]
            Length = 80

  Plus Strand HSPs:

 Score = 327 (115.1 bits), Expect = 8.6e-29, P = 8.6e-29
 Identities = 64/77 (83%), Positives = 70/77 (90%), Frame = +3

Query:    21 MSKISFKITLTSDPNLPFKVLKVPENAPFTAVLKFAAEEFSVPAATSAIITDDGIGINPQ 200
             MSK+SFKITLT DP LP+KVL VPE+ PFTAVLKFAAEEF VPAATSAIIT+DGIGINP 
Sbjct:     1 MSKVSFKITLTWDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPA 60

Query:   201 QTAGEVFLKHGSDLRLI 251
             QTAG VFLKHGS+LR+I
Sbjct:    61 QTAGNVFLKHGSELRII 77


>pdb|1XDT|R Chain R, Complex Of Diphtheria Toxin And Heparin-Binding Epidermal
            Growth Factor Complex (ToxinGROWTH FACTOR), DIPHTHERIA TOXIN,
            RECEPTOR, Heparin-Binding Epidermal Growth Factor, Epidermal Growth
            Factor Mol_id: 1; Molecule: Dipht...
            Length = 79

  Minus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 2.8, P = 0.94
 Identities = 10/23 (43%), Positives = 15/23 (65%), Frame = -3

Query:   289 KEEYHRPPTRSLGINRKSDPCLR 221
             KEE+ +   +  G+ +K DPCLR
Sbjct:    20 KEEHGKRKKKGKGLGKKRDPCLR 42


>gi|3168959 (AF068714) No definition line found [Caenorhabditis elegans]
            Length = 87

  Plus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 7.6, P = 1.0
 Identities = 11/26 (42%), Positives = 12/26 (46%), Frame = +2

Query:   257 GSCWWPVIF-----FFPCLLWSFCMS 319
             G+CWW   F     FFP   W  C S
Sbjct:    39 GNCWWIAFFIGFFLFFPICYWLCCQS 64


>gi|3168958 (AF068714) No definition line found [Caenorhabditis elegans]
            Length = 140

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 9.4, P = 1.0
 Identities = 11/19 (57%), Positives = 13/19 (68%), Frame = +2

Query:   257 GSCWWPVIFFFPCLL-WSFC 313
             G+CWW V+F   CLL W  C
Sbjct:    39 GACWW-VVFIIGCLLFWPIC 57


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.96
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.329   0.144   0.440  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.365   0.159   0.684  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.359   0.161   0.507  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.377   0.174   0.613  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.363   0.157   0.590  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.344   0.151   0.483  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      112       112       10.  67 3 1000 22  0.12    32
                                                     29  0.096   35
   +2      0      112       112       10.  67 3 1000 22  0.12    32
                                                     29  0.096   35
   +1      0      113       113       10.  68 3 1000 22  0.12    32
                                                     29  0.097   35
   -1      0      113       113       10.  68 3 1000 22  0.12    32
                                                     29  0.097   35
   -2      0      112       112       10.  67 3 1000 22  0.12    32
                                                     29  0.096   35
   -3      0      112       112       10.  67 3 1000 22  0.12    32
                                                     29  0.096   35


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  5
  No. of states in DFA:  326 (32 KB)
  Total size of DFA:  40 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  25.02u 1.23s 26.25t  Elapsed: 00:00:06
  Total cpu time:  25.05u 1.64s 26.69t  Elapsed: 00:00:06
  Start:  Sat Sep 26 03:01:38 1998   End:  Sat Sep 26 03:01:44 1998

Date: 17:9:28 on Mon 18 Dec 117.