blastx_gbnr_files/1658038_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1658038
        (550 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A sp|P38295|YB27_YEAST HYPOTHETICAL 51.3 KD PROTEIN IN S... -3    95  0.050     2
A sp|Q02891|YP95_YEAST HYPOTHETICAL 51.7 KD PROTEIN IN S... -3    91  0.13      2
A sp|Q24093|A23D_DROME ANON-23DA PROTEIN >gi|924937 (U29... -3    85  0.83      1
A sp|P73879|Y264_SYNY3 HYPOTHETICAL 41.0 KD PROTEIN SLR0... -3    81  0.991     1



>sp|P38295|YB27_YEAST HYPOTHETICAL 51.3 KD PROTEIN IN SMY2-RPS101 INTERGENIC
            REGION >pir||S46048 hypothetical protein YBR177c - yeast
            (Saccharomyces cerevisiae) >gi|536527 (Z36046) ORF YBR177c
            [Saccharomyces cerevisiae]
            Length = 451

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.051, Sum P(2) = 0.050
 Identities = 22/79 (27%), Positives = 35/79 (44%), Frame = -3

Query:   428 SPTQWXSNPEEYYAAVNTLTFXRHCTIXILCVIARDDPVIGEPPRKEMRELVTANSXVAF 249
             +P     N  EYY A +++       +  L + +RDDPV+G P +     +V  N  + +
Sbjct:   359 APALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVG-PDQPY--SIVEKNPRILY 415

Query:   248 LEXPYGGHLGYIGSPVEEW 192
                  GGHL Y+      W
Sbjct:   416 CRTDLGGHLAYLDKDNNSW 434

 Score = 38 (13.4 bits), Expect = 0.051, Sum P(2) = 0.050
 Identities = 9/21 (42%), Positives = 11/21 (52%), Frame = -1

Query:   469 KRRRTVXEFDAHITAPHNGXP 407
             K  ++  EFD   TAP  G P
Sbjct:   345 KSFKSTREFDEVYTAPALGFP 365


>sp|Q02891|YP95_YEAST HYPOTHETICAL 51.7 KD PROTEIN IN SEC62-MSY1 INTERGENIC
            REGION >pir||S61971 hypothetical protein YPL095c - yeast
            (Saccharomyces cerevisiae) >gi|1151231 (U43281) Lpg13p
            [Saccharomyces cerevisiae]
            Length = 456

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.14, Sum P(2) = 0.13
 Identities = 24/68 (35%), Positives = 32/68 (47%), Frame = -3

Query:   395 YYAAVNTLTFXRHCTIXILCVIARDDPVIGEP--PRKEMRELVTANSXVAFLEXPYGGHL 222
             YY   +++    +  I  L + A DDPV GE   P K+ RE    N  V   E   GGHL
Sbjct:   374 YYRKASSINRLPNIKIPTLIINATDDPVTGENVIPYKQARE----NPCVLLCETDLGGHL 429

Query:   221 GYIGSPVEEW 192
              Y+ +    W
Sbjct:   430 AYLDNESNSW 439

 Score = 39 (13.7 bits), Expect = 0.14, Sum P(2) = 0.13
 Identities = 8/16 (50%), Positives = 9/16 (56%), Frame = -1

Query:   454 VXEFDAHITAPHNGXP 407
             + EFD   TAP  G P
Sbjct:   354 ILEFDNLFTAPSMGLP 369


>sp|Q24093|A23D_DROME ANON-23DA PROTEIN >gi|924937 (U29170) ANON-23D
            [Drosophila melanogaster]
            Length = 398

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 1.8, P = 0.83
 Identities = 18/62 (29%), Positives = 33/62 (53%), Frame = -3

Query:   401 EEYYAAVNTLTFXRHCTIXILCVIARDDPVIGEPPRKEMRELVTANSXVAFLEXPYGGHL 222
             +E Y   ++L +       ++ + A+DDP+I E     ++E  T     A++E  +GGHL
Sbjct:   301 QELYKWSSSLFYFDTIKKPMIFINAKDDPLIPEDLLHPIKEYATTRQNTAYVEVAHGGHL 360

Query:   221 GY 216
             G+
Sbjct:   361 GF 362


>sp|P73879|Y264_SYNY3 HYPOTHETICAL 41.0 KD PROTEIN SLR0264 >gnl|PID|d1018675
            (D90910) hypothetical protein [Synechocystis sp.]
            Length = 369

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 4.7, P = 0.99
 Identities = 22/75 (29%), Positives = 33/75 (44%), Frame = -3

Query:   401 EEYYAAVNTLTFXRHCTIXILCVIARDDPVIGEPPRKEMRELVTANSXVAFLEXPYGGHL 222
             E+YY   + L          L + A DDP+      +E+  L    + V     P GGH+
Sbjct:   276 EDYYEVSSALPLLSKIVKPTLLLYAADDPMFHPAIVEELPGLQNQLTGVDLQITPKGGHV 335

Query:   221 GYIGS-PVEEWRGDP 180
             GYI + P ++   DP
Sbjct:   336 GYIANGPCQQASNDP 350


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.92
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.343   0.149   0.502  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.352   0.161   0.620  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.350   0.153   0.526  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.346   0.151   0.532  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.352   0.157   0.588  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.335   0.149   0.499  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      182       169       10.  72 3 1000 22  0.11    34
                                                     31  0.11    37
   +2      0      183       168       10.  72 3 1000 22  0.11    34
                                                     31  0.11    37
   +1      0      183       168       10.  72 3 1000 22  0.11    34
                                                     31  0.11    37
   -1      0      183       170       10.  72 3 1000 22  0.11    34
                                                     31  0.11    37
   -2      0      183       167       10.  72 3 1000 22  0.11    34
                                                     30  0.11    37
   -3      0      182       171       10.  73 3 1000 22  0.11    34
                                                     31  0.11    37


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  4
  No. of states in DFA:  400 (40 KB)
  Total size of DFA:  52 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  30.51u 1.10s 31.61t  Elapsed: 00:00:07
  Total cpu time:  30.54u 1.54s 32.08t  Elapsed: 00:00:07
  Start:  Thu Sep 24 12:29:38 1998   End:  Thu Sep 24 12:29:45 1998

Date: 14:52:2 on Sun 17 Dec 117.