blastx_gbnr_files/1688751_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1688751
        (269 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|986998      (M33483) ingi ORF; putative [Trypanosom... -3    74  7.3e-05   2
A pir||S28721    hypothetical protein 1 - Trypanosoma br... -3    84  0.011     2
A gnl|PID|e37082 (X05710) ORF 1 [Trypanosoma brucei subg... -3    84  0.011     2
A gi|1002494     (U25967) Arix1 [Rattus norvegicus]         +3    64  0.98      1
A gi|2108234     (U97358) 29K protein [Treponema pallidu... -2    61  0.9993    1
A gi|330005      (L08816) poly-proline hinge [Hepatitis ... +3    53  0.99991   1



>gi|986998 (M33483) ingi ORF; putative [Trypanosoma brucei]
           Length = 61

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 7.3e-05, Sum P(2) = 7.3e-05
 Identities = 18/36 (50%), Positives = 20/36 (55%), Frame = -3

Query:   261 MPATXPWCQGQLLRIXGGSPQSAMRPSITGLLLVQG 154
             MPAT  WCQ  + RI GGS + A   S  G LL  G
Sbjct:     1 MPATSSWCQSPVPRIIGGSQEPAAFLS-WGTLLCSG 35

 Score = 38 (13.4 bits), Expect = 7.3e-05, Sum P(2) = 7.3e-05
 Identities = 9/18 (50%), Positives = 9/18 (50%), Frame = -1

Query:   161 CRADGINQRTGQPRXAGT 108
             C   GI Q   Q R AGT
Sbjct:    33 CSGYGIIQHRDQQRLAGT 50


>pir||S28721 hypothetical protein 1 - Trypanosoma brucei
            Length = 1650

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.011, Sum P(2) = 0.011
 Identities = 20/37 (54%), Positives = 22/37 (59%), Frame = -3

Query:   264 AMPATXPWCQGQLLRIXGGSPQSAMRPSITGLLLVQG 154
             AMPAT  WCQG + RI GGS + A   S  G LL  G
Sbjct:     5 AMPATSTWCQGPVPRIIGGSQEPAAFLS-WGTLLCSG 40

 Score = 38 (13.4 bits), Expect = 0.011, Sum P(2) = 0.011
 Identities = 9/18 (50%), Positives = 9/18 (50%), Frame = -1

Query:   161 CRADGINQRTGQPRXAGT 108
             C   GI Q   Q R AGT
Sbjct:    38 CSGYGIIQHRDQQRLAGT 55

 Score = 37 (13.0 bits), Expect = 0.014, Sum P(2) = 0.014
 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = -2

Query:   154 LTASTSARASRVLLG--HG 104
             L AS   +ASR++ G  HG
Sbjct:   862 LLASAQHKASRIIAGIPHG 880


>gnl|PID|e37082 (X05710) ORF 1 [Trypanosoma brucei subgroup]
            Length = 1650

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.011, Sum P(2) = 0.011
 Identities = 20/37 (54%), Positives = 22/37 (59%), Frame = -3

Query:   264 AMPATXPWCQGQLLRIXGGSPQSAMRPSITGLLLVQG 154
             AMPAT  WCQG + RI GGS + A   S  G LL  G
Sbjct:     5 AMPATSTWCQGPVPRIIGGSQEPAAFLS-WGTLLCSG 40

 Score = 38 (13.4 bits), Expect = 0.011, Sum P(2) = 0.011
 Identities = 9/18 (50%), Positives = 9/18 (50%), Frame = -1

Query:   161 CRADGINQRTGQPRXAGT 108
             C   GI Q   Q R AGT
Sbjct:    38 CSGYGIIQHRDQQRLAGT 55

 Score = 37 (13.0 bits), Expect = 0.014, Sum P(2) = 0.014
 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = -2

Query:   154 LTASTSARASRVLLG--HG 104
             L AS   +ASR++ G  HG
Sbjct:   862 LLASAQHKASRIIAGIPHG 880


>gi|1002494 (U25967) Arix1 [Rattus norvegicus]
            Length = 281

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 3.7, P = 0.98
 Identities = 27/85 (31%), Positives = 32/85 (37%), Frame = +3

Query:     3 AXGXSLSLLSCSSKKIDCRHLVR*HXPPXLMVLQPCPSXTRLARALVDAVSPAPTTI--- 173
             A G       CSS+  D +     H P     L P P    LA  L+   SP P  +   
Sbjct:   160 ATGAKKGEARCSSEDDDSKESTCSHTPDSTASLPPPPPAPSLASPLLSP-SPLPAALGSG 218

Query:   174 --P*WTDASLTAGFPRXYGAIGPGTTA 248
               P     +L AG     G  GPGT A
Sbjct:   219 PGPQPLKGALWAGVAGGGGG-GPGTGA 244


>gi|2108234 (U97358) 29K protein [Treponema pallidum] >gi|2196996 (U93844)
            lipoprotein homolog [Treponema pallidum] >gi|3323134 (AE001253)
            lipoprotein (tpn32) [Treponema pallidum]
            Length = 268

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 7.3, P = 1.0
 Identities = 20/56 (35%), Positives = 25/56 (44%), Frame = -2

Query:   232 PIAPYXRGKPAVSDASVHHGIVVGAGLTASTSARASRVLLGHGCNTMRXGGXCYRT 65
             P+A Y R    VSD     G V+     +S  ARA R+L   G   MR G   + T
Sbjct:   111 PLALYSRTYRHVSDFPA--GAVIAIPNDSSNEARALRLLEAAGFIRMRAGSGLFAT 164


>gi|330005 (L08816) poly-proline hinge [Hepatitis E virus]
           Length = 67

  Plus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 9.3, P = 1.0
 Identities = 20/50 (40%), Positives = 21/50 (42%), Frame = +3

Query:   111 PSXTRLARALVDAVSPAPTTIP*WTDASLTAGFPRXYGAIGPGTTARWPA 260
             PS    A  L  A +P P   P   D S T   P   G   PG TAR PA
Sbjct:    14 PSIPSRAATLTPA-APLPPPAP---DPSPTPSAPAR-GEPAPGATARAPA 58


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.95
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.333   0.142   0.488  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.340   0.148   0.544  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.337   0.145   0.536  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.338   0.147   0.554  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.318   0.135   0.412  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.338   0.146   0.508  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0       89        82       10.  59 3 1000 22  0.11    31
                                                     28  0.12    32
   +2      0       89        83       10.  59 3 1000 22  0.11    31
                                                     28  0.12    32
   +1      0       89        82       10.  59 3 1000 22  0.11    31
                                                     28  0.12    32
   -1      0       89        81       10.  58 3 1000 22  0.11    31
                                                     28  0.12    32
   -2      0       89        83       10.  59 3 1000 22  0.11    31
                                                     28  0.12    32
   -3      0       89        83       10.  59 3 1000 22  0.11    31
                                                     28  0.12    32


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  6
  No. of states in DFA:  269 (27 KB)
  Total size of DFA:  33 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  19.66u 1.32s 20.98t  Elapsed: 00:00:05
  Total cpu time:  19.68u 1.85s 21.53t  Elapsed: 00:00:05
  Start:  Thu Sep 24 18:46:09 1998   End:  Thu Sep 24 18:46:14 1998

Date: 17:15:18 on Mon 18 Dec 117.