blastx_gbnr_files/1688849_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1688849
        (276 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A pir||S69656          hypothetical protein YDR489w - ye... +3    88  0.0094    1
A sp|P54150|PMSR_ARATH PEPTIDE METHIONINE SULFOXIDE REDU... +3    65  0.92      1
A gi|2344888           (AC002388) hypothetical protein [... +3    65  0.92      1
A gi|2529666           (AC002535) unknown protein [Arabi... +1    55  0.997     1
A gnl|PID|d1011300     (D64004) hypothetical protein [Sy... +3    63  0.998     1
A pir||C48472          capsid protein VP-2 - porcine par... +1    53  0.99990   1



>pir||S69656 hypothetical protein YDR489w - yeast (Saccharomyces cerevisiae)
            >gi|927735 (U33050) Ydr489wp; CAI: 0.16 [Saccharomyces cerevisiae]
            Length = 294

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.0094, P = 0.0094
 Identities = 24/76 (31%), Positives = 43/76 (56%), Frame = +3

Query:    54 LVQATENERCAPDILPYPEAIVDGVAAQIAAQNEQIRLLSVEX-KQQTAEKD----PGAS 218
             L+++ +NERC+P++LPYP  ++  +  +I+ Q++ I  +S+     Q A       P  S
Sbjct:    63 LMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNASNANPPMPNES 122

Query:   219 LLPFKPSDIMALEVQRAQF 275
              LP      M  E++R +F
Sbjct:   123 KLPLL---CMETELERLKF 138


>sp|P54150|PMSR_ARATH PEPTIDE METHIONINE SULFOXIDE REDUCTASE (PEPTIDE MET(O)
            REDUCTASE) >pir||S71275 methionine sulfoxide reductase -
            Arabidopsis thaliana >gnl|PID|e237308 (X97326) methionine sulfoxide
            reductase [Arabidopsis thaliana]
            Length = 258

  Plus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 2.5, P = 0.92
 Identities = 23/85 (27%), Positives = 41/85 (48%), Frame = +3

Query:    21 SSAALSELLXSLVQATENERCAPDILPYPEAIVDGVAAQIAAQNEQIRLLSVEXKQQTAE 200
             ++A+LS+ L SL +A  +   A  I P+P+     ++   +  N     L    + Q A+
Sbjct:    12 AAASLSKPLNSLSKAALSFSRAKPICPFPQTSRRPISVYKSPMNNLFNRLGFGSRPQ-AQ 70

Query:   201 KDPGASLLPFKPSDIMALEVQR-AQF 275
              DP ++ +   P D +    Q+ AQF
Sbjct:    71 ADPSSAAIAQGPDDDVPSSGQQFAQF 96


>gi|2344888 (AC002388) hypothetical protein [Arabidopsis thaliana]
            Length = 263

  Plus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 2.6, P = 0.92
 Identities = 20/71 (28%), Positives = 36/71 (50%), Frame = +3

Query:    21 SSAALSELLXSLVQATENERCAPDILPYPEAIVDGVAAQIAAQNEQIRLLSVEXKQQTAE 200
             +S+ +++ L +LV ATE+ RC  D L YP  +   +   +  Q   + L  +E + ++  
Sbjct:   160 TSSQMTQTLYNLVAATEDLRCLKDEL-YPTVLRTNLGKDLCGQ---LALSELESEIKSFR 215

Query:   201 KDPGASLLPFK 233
              D    L+ FK
Sbjct:   216 GDLDDVLVKFK 226


>gi|2529666 (AC002535) unknown protein [Arabidopsis thaliana]
            Length = 57

  Plus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 5.7, P = 1.0
 Identities = 16/37 (43%), Positives = 19/37 (51%), Frame = +1

Query:    28 PLSVSFSXPLFRRRRM-NAAHRTSCLILKPLWTAWQL 135
             PL    S  L R RR+ NAAHR       P+ T+ QL
Sbjct:    19 PLDFRLSENLSRDRRIVNAAHRDILRFFSPVRTSVQL 55


>gnl|PID|d1011300 (D64004) hypothetical protein [Synechocystis sp.]
            Length = 173

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 6.3, P = 1.0
 Identities = 23/65 (35%), Positives = 33/65 (50%), Frame = +3

Query:    30 ALSELLXSLVQATENERC----APDILPYPEAIVDGVAAQIAAQNEQIRLLSVEXKQQTA 197
             +LS+LL   V+A          +PD+ P PEA V    A +A    Q+   S++   Q A
Sbjct:     5 SLSDLLKQEVKAQSQPELDAGISPDLEPTPEASVPEPTADLAELQAQLN--SIKAALQ-A 61

Query:   198 EKDPGASL 221
             EK+ G  L
Sbjct:    62 EKNQGEKL 69


>pir||C48472 capsid protein VP-2 - porcine parvovirus
            Length = 31

  Plus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 9.2, P = 1.0
 Identities = 12/26 (46%), Positives = 15/26 (57%), Frame = +1

Query:     1 KSARGTNPPPLSVSFSXPLFRRRRMN 78
             K ARGTN   + + +S  L R RR N
Sbjct:     6 KRARGTNSTRIQIPWSRKLTRPRRTN 31


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.91
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.313   0.128   0.342    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.365   0.158   0.562  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.344   0.146   0.528  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.354   0.153   0.549  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.330   0.145   0.452  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.348   0.143   0.462  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0       91        89       10.  62 3 1000 23  0.093   32
                                                     28  0.11    33
   +2      0       91        89       10.  62 3 1000 22  0.091   32
                                                     28  0.11    33
   +1      0       92        90       10.  62 3 1000 22  0.092   32
                                                     28  0.11    33
   -1      0       92        90       10.  62 3 1000 22  0.092   32
                                                     28  0.11    33
   -2      0       91        89       10.  62 3 1000 22  0.091   32
                                                     28  0.11    33
   -3      0       91        89       10.  62 3 1000 22  0.091   32
                                                     28  0.11    33


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  6
  No. of states in DFA:  275 (27 KB)
  Total size of DFA:  34 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  22.32u 1.10s 23.42t  Elapsed: 00:00:05
  Total cpu time:  22.36u 1.66s 24.02t  Elapsed: 00:00:05
  Start:  Thu Sep 24 18:29:17 1998   End:  Thu Sep 24 18:29:22 1998

Date: 16:31:48 on Sun 17 Dec 117.