blastx_gbnr_files/1765758_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1765758
        (283 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|3367522           (AC004392) EST gb|T04691 comes fr... -3   124  2.8e-06   1
A sp|Q05497|YD38_YEAST HYPOTHETICAL 77.8 KD PROTEIN IN M... -3   121  9.2e-06   1
A gi|3337367           (AC004481) hypothetical protein [... -3   118  1.1e-05   1
A gnl|PID|e1251803     (AL021890) putative protein [Arab... -3   118  1.3e-05   1
A gnl|PID|e1310072     (AL031018) putative protein [Arab... -3   116  2.0e-05   1
A gnl|PID|e1251802     (AL021890) putative protein [Arab... -3   113  0.00012   1
A gnl|PID|e244915      (X97826) orf04 [Arabidopsis thali... -3   105  0.00026   1
A gnl|PID|e248502      (X98130) unknown [Arabidopsis tha... -3   105  0.00031   1
A gnl|PID|e1248687     (AL021635) predicted protein [Ara... -3   101  0.00081   1
A gi|2252840           (AF013293) contains regions of si... -3    96  0.0048    1
A sp|Q10085|YAO6_SCHPO HYPOTHETICAL 49.1 KD PROTEIN C11D... -3    82  0.078     1
A gnl|PID|e1264516     (AL022121) hypothetical protein R... -3    57  0.97      1
A gi|488336            (M77278) ORF [Cloning vector]        +3    54  0.9993    1



>gi|3367522 (AC004392) EST gb|T04691 comes from this gene. [Arabidopsis
            thaliana]
            Length = 501

  Minus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 2.8e-06, P = 2.8e-06
 Identities = 33/91 (36%), Positives = 51/91 (56%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             T IF GH +G   L+  S G   FN+    ++ G+ SA++T+  QA G + R  ++G  L
Sbjct:    72 TRIFAGH-VGSFELAAASLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAH-RYEMLGVYL 129

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMVYVFGE 9
             QR+ +V ++  + MS  FL S PI+    GE
Sbjct:   130 QRSTVVLILTCLPMSFLFLFSNPILT-ALGE 159


>sp|Q05497|YD38_YEAST HYPOTHETICAL 77.8 KD PROTEIN IN MRPS28-HXT7 INTERGENIC
            REGION >pir||S70103 probable membrane protein YDR338c - yeast
            (Saccharomyces cerevisiae) >gi|1230665 (U51032) Ydr338cp
            [Saccharomyces cerevisiae]
            Length = 695

  Minus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 9.2e-06, P = 9.2e-06
 Identities = 28/87 (32%), Positives = 53/87 (60%), Frame = -3

Query:   269 VGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETLQRAL 90
             VGH LG++ L+  S   +  N+T ++I  G+ +++DT+  QA+G   R   +G  LQR +
Sbjct:   257 VGH-LGKNELAAVSLASMTSNIT-LAIFEGIATSLDTLCPQAYGSG-RFYSVGVHLQRCI 313

Query:    89 IVNMVLWIIMSVAFLNSKPIMVYVFGE 9
               ++V++I  +V +  S+P++ Y+  E
Sbjct:   314 AFSLVIYIPFAVMWWYSEPLLSYIIPE 340


>gi|3337367 (AC004481) hypothetical protein [Arabidopsis thaliana]
            Length = 466

  Minus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 29/91 (31%), Positives = 54/91 (59%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             +++FVGH LG   LS  S      +VT  + + G  SA+DT+  Q++G      ++G  +
Sbjct:    52 SVMFVGH-LGSLPLSAASIATSFASVTGFTFLMGTASAMDTVCGQSYGAK-MYGMLGIQM 109

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMVYVFGE 9
             QRA++V  +L + +S+ + N++  +V+ FG+
Sbjct:   110 QRAMLVLTLLSVPLSIVWANTEHFLVF-FGQ 139


>gnl|PID|e1251803 (AL021890) putative protein [Arabidopsis thaliana]
            Length = 508

  Minus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 31/89 (34%), Positives = 55/89 (61%), Frame = -3

Query:   275 IFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETLQR 96
             IF GH LG++ L+  S G   F++    ++ G+ SA++T+  QA+G + R  ++G  LQR
Sbjct:    84 IFAGH-LGKNELAAASIGNSCFSLV-YGLMLGMGSAVETLCGQAYGAH-RYEMLGIYLQR 140

Query:    95 ALIVNMVLWIIMSVAFLNSKPIMVYVFGE 9
             A IV  ++ + M++ +  S PI++ + GE
Sbjct:   141 ATIVLALVGLPMTLLYTFSYPILI-LLGE 168


>gnl|PID|e1310072 (AL031018) putative protein [Arabidopsis thaliana]
            Length = 502

  Minus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 2.0e-05, P = 2.0e-05
 Identities = 29/91 (31%), Positives = 53/91 (58%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             +M+F+G       LS  S  +   N+T  S++SGL+  ++ I  QAFG   R  ++G  L
Sbjct:    57 SMLFLGRLNDLSALSGGSLALGFANITGYSLLSGLSIGMEPICVQAFGAK-RFKLLGLAL 115

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMVYVFGE 9
             QR  ++ ++  + +S+ +LN K I+++ FG+
Sbjct:   116 QRTTLLLLLCSLPISILWLNIKKILLF-FGQ 145


>gnl|PID|e1251802 (AL021890) putative protein [Arabidopsis thaliana]
            Length = 1094

  Minus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.00012, P = 0.00012
 Identities = 31/89 (34%), Positives = 53/89 (59%), Frame = -3

Query:   275 IFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETLQR 96
             IF GH LG   L+  S G   F++   +++ G+ SA++T+  QA+G + R  ++G  LQR
Sbjct:     7 IFAGH-LGSTQLAAASIGNSSFSLV-YALMLGMGSAVETLCGQAYGAH-RYEMLGIYLQR 63

Query:    95 ALIVNMVLWIIMSVAFLNSKPIMVYVFGE 9
             A IV  ++   M++ +  S PI++ + GE
Sbjct:    64 ATIVLALVGFPMTILYTFSYPILL-LLGE 91


>gnl|PID|e244915 (X97826) orf04 [Arabidopsis thaliana]
            Length = 446

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.00026, P = 0.00026
 Identities = 26/88 (29%), Positives = 49/88 (55%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             T +F GH +    L+  S    V    +  I+ G+ SA++T+  QAFG   + S++G  L
Sbjct:    70 TQVFAGH-ISTIALAAVSVENSVVAGFSFGIMLGMGSALETLCGQAFGAG-KLSMLGVYL 127

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMVYV 18
             QR+ ++  V  +I+S+ ++ + PI+  +
Sbjct:   128 QRSWVILNVTALILSLLYIFAAPILASI 155


>gnl|PID|e248502 (X98130) unknown [Arabidopsis thaliana]
            Length = 500

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.00031, P = 0.00031
 Identities = 26/88 (29%), Positives = 49/88 (55%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             T +F GH +    L+  S    V    +  I+ G+ SA++T+  QAFG   + S++G  L
Sbjct:    70 TQVFAGH-ISTIALAAVSVENSVVAGFSFGIMLGMGSALETLCGQAFGAG-KLSMLGVYL 127

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMVYV 18
             QR+ ++  V  +I+S+ ++ + PI+  +
Sbjct:   128 QRSWVILNVTALILSLLYIFAAPILASI 155


>gnl|PID|e1248687 (AL021635) predicted protein [Arabidopsis thaliana]
            Length = 491

  Minus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.00081, P = 0.00081
 Identities = 28/91 (30%), Positives = 52/91 (57%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             T +F+G   GE  L+  S G    NVT  S++ G+++A++ I  QAFG      ++ +TL
Sbjct:    55 TSVFLGR-QGELNLAGGSLGFSFANVTGFSVLYGISAAMEPICGQAFGAK-NFKLLHKTL 112

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMVYVFGE 9
               A+++ +++ + +S  +LN   I+   FG+
Sbjct:   113 FMAVLLLLLISVPISFLWLNVHKILTG-FGQ 142


>gi|2252840 (AF013293) contains regions of similarity to Haemophilus influenzae
            permease (SP:P38767) [Arabidopsis thaliana]
            Length = 746

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.0048, P = 0.0048
 Identities = 22/86 (25%), Positives = 49/86 (56%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             T IFVGH +G+  LS  +  + V +  +   + G+ SA++T+  QAFG   +  ++G  +
Sbjct:   113 TSIFVGH-IGDLELSAVAIALSVVSNFSFGFLLGMASALETLCGQAFGAG-QMDMLGVYM 170

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMV 24
             QR+ ++ +   + +   ++ + P+++
Sbjct:   171 QRSWLILLGTSVCLLPLYIYATPLLI 196


>sp|Q10085|YAO6_SCHPO HYPOTHETICAL 49.1 KD PROTEIN C11D3.06 IN CHROMOSOME I
            >gi|1107895 (Z68166) unknown [Schizosaccharomyces pombe]
            Length = 455

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.081, P = 0.078
 Identities = 24/88 (27%), Positives = 43/88 (48%), Frame = -3

Query:   281 TMIFVGHCLGEDGLSQYSAGILVFNVTAMSIVSGLNSAIDTISSQAFGRNPRSSVIGETL 102
             ++I  G  LG   LS  +   +    T   I  G  +A DT+ S  +G   +   +G  L
Sbjct:    32 SVIVTGR-LGPSELSVAAFAYMFAMSTGWLIALGGTTAFDTLGSNLWGAGKKQE-LGILL 89

Query:   101 QRALIVNMVLWIIMSVAFLNSKPIMVYV 18
             Q   IV  +L++ + + +  SKPI++++
Sbjct:    90 QTGFIVLSILYLPICLVWWYSKPILIFL 117


>gnl|PID|e1264516 (AL022121) hypothetical protein Rv3656c [Mycobacterium
            tuberculosis]
            Length = 68

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.5, P = 0.97
 Identities = 17/48 (35%), Positives = 31/48 (64%), Frame = -3

Query:   221 ILVFNVTAMSI-VSGLNS---AIDTISSQAFGRNPRSSVIGETLQRAL 90
             +LV  +TA+++  SG+++   AI TI++ AFG    + V G+++  AL
Sbjct:     9 VLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSAL 56


>gi|488336 (M77278) ORF [Cloning vector]
           Length = 61

  Plus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 7.3, P = 1.0
 Identities = 10/22 (45%), Positives = 15/22 (68%), Frame = +3

Query:   108 FANHRRSWIPSKSLRTYRIYSR 173
             F N  RSW+  ++ R+YRI +R
Sbjct:    30 FNNQIRSWVVQQNSRSYRIRAR 51


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.98
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.322   0.134   0.425  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.381   0.167   0.732  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.334   0.143   0.435  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.365   0.168   0.682  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.349   0.157   0.712  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.325   0.137   0.389  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0       93        93       10.  63 3 1000 22  0.096   32
                                                     28  0.12    33
   +2      0       94        94       10.  64 3 1000 22  0.098   32
                                                     28  0.12    33
   +1      0       94        94       10.  64 3 1000 22  0.098   32
                                                     28  0.12    33
   -1      0       94        94       10.  64 3 1000 22  0.098   32
                                                     28  0.12    33
   -2      0       94        94       10.  64 3 1000 22  0.098   32
                                                     28  0.12    33
   -3      0       93        93       10.  63 3 1000 22  0.096   32
                                                     28  0.12    33


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  13
  No. of states in DFA:  297 (30 KB)
  Total size of DFA:  36 KB (64 KB)
  Time to generate neighborhood:  0.01u 0.00s 0.01t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  20.87u 1.08s 21.95t  Elapsed: 00:00:05
  Total cpu time:  20.92u 2.06s 22.98t  Elapsed: 00:00:06
  Start:  Thu Sep 24 18:07:12 1998   End:  Thu Sep 24 18:07:18 1998

Date: 14:57:6 on Sun 17 Dec 117.