blastx_gbnr_files/1805756_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1805756
        (399 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|2315983           (U82087) calmodulin-like domain p... +3    96  0.0035    1
A gnl|PID|e313754      (Y12560) two EF-hand calcium-bind... +3    80  0.013     1
A gnl|PID|e1310770     (Y17713) pollen allergen Aln g 2 ... +3    79  0.016     1
A sp|P02597|CALS_CHICK CALMODULIN, STRIATED MUSCLE >pir|... +3    88  0.019     1
A pir||S54819          BETV4 protein - European white bi... +3    77  0.026     1
A gi|3337403           (AF015810) calcium-binding pollen... +3    77  0.026     1
A gi|2352427           (AF004161) peroxisomal Ca-depende... +3    93  0.028     1
A gnl|PID|e330443      (Z82282) T07G12.1 [Caenorhabditis... +3    89  0.028     1
A pir||S65150          pollen allergen Bra n II (clone 4... +3    76  0.034     1
A pir||S65152          pollen allergen Bra r II (clone 9... +3    76  0.034     1
A gnl|PID|e353289      (AJ001919) calmodulin [Branchiost... +3    75  0.043     1
A gi|2654179           (AF034988) calmodulin [Sus scrofa]   +3    75  0.043     1
A sp|P05933|CALM_SCHPO CALMODULIN >pir||MCZP calmodulin ... +3    86  0.043     1
A pir||S65143          pollen allergen group II (clone 4... +3    73  0.068     1
A sp|P11120|CALM_PLECO CALMODULIN >pir||MCMRP calmodulin... +3    84  0.085     1
A pdb|1TRC|A           Bos taurus                           +3    72  0.088     1
A pdb|1CMG|            Nmr Solution Structure Of Calcium... +3    72  0.088     1
A pir||S65145          pollen allergen group II (clone 4... +3    71  0.11      1
A gnl|PID|e1285534     (AJ223302) calmodulin-like protei... +3    71  0.11      1
A pdb|4TNC|            Troponin C                           +3    84  0.12      1
A pdb|1TRC|B           Bos taurus                           +3    70  0.15      1
A sp|P02589|TPCS_RANES TROPONIN C, SKELETAL MUSCLE >pir|... +3    82  0.21      1
A gi|2213610           (AC000103) F21J9.4 [Arabidopsis t... +3    83  0.23      1
A sp|P15094|CALM_ACHKL CALMODULIN >pir||MCUMAK calmoduli... +3    81  0.23      1
A pir||A56785          calmodulin - pig (fragment)          +3    68  0.24      1
A gnl|PID|d1001665     (D10363) calmodulin [Oryzias lati... +3    79  0.28      1
A sp|P10246|TPCS_MELGA TROPONIN C, SKELETAL MUSCLE >pir|... +3    81  0.29      1
A sp|P27482|CALL_HUMAN CALMODULIN-RELATED PROTEIN NB-1 (... +3    80  0.30      1
A gi|3415119           (AF081672) calmodulin [Gallus gal... +3    80  0.30      1
A gi|167676            (M13009) calmodulin [Dictyosteliu... +3    79  0.31      1
A pir||I50535          calmodulin - electric eel (fragme... +3    67  0.31      1
A gi|1785953           (U38787) calmodulin [Naegleria fo... +3    67  0.31      1
A pir||S65144          pollen allergen group II (clone 4... +3    67  0.31      1
A pir||S02690          calmodulin A - sea urchin (Arbaci... +3    79  0.32      1
A pdb|1CDM|A           Bos taurus                           +3    79  0.35      1
A gi|972430            (F14583) calmodulin [Sus scrofa]     +3    76  0.37      1
A pdb|1CDL|A           Homo sapiens >pdb|1CDL|B Homo sap... +3    79  0.37      1
A pdb|1TOP|            Troponin C >pdb|1NCY|  Troponin-C... +3    80  0.37      1
A pdb|5TNC|            Troponin-C                           +3    80  0.37      1
A pir||MCBO            calmodulin - bovine >pir||MCON ca... +3    79  0.38      1
A pir||MCRB            calmodulin - rabbit >pdb|3CLN|  C... +3    79  0.38      1
A sp|P21251|CALM_STIJA CALMODULIN >pir||MCSFCU calmoduli... +3    79  0.38      1
A sp|P02588|TPCS_CHICK TROPONIN C, SKELETAL MUSCLE >pir|... +3    80  0.38      1
A sp|P18061|CALM_TRYCR CALMODULIN >pir||MCUTC calmodulin... +3    79  0.38      1
A sp|P02593|CALM_HUMAN CALMODULIN >pir||MCHU calmodulin ... +3    79  0.38      1
A pir||I49567          calmodulin - mouse >gi|469422 (M1... +3    79  0.38      1
A sp|P02594|CALM_ELEEL CALMODULIN >pir||MCEE calmodulin ... +3    79  0.38      1
A gi|169406            (M96933) calmodulin [Pneumocystis... +3    66  0.39      1
A sp|P05934|CALM_STRPU CALMODULIN                           +3    66  0.39      1
A pir||MCDO            calmodulin - slime mold (Dictyost... +3    79  0.40      1
A sp|P02599|CALM_DICDI CALMODULIN >gi|290034 (M64089) ca... +3    79  0.40      1
A gi|825635            (X52606) calmodulin [Homo sapiens]   +3    79  0.40      1
A pir||B34669          calmodulin-related protein 3, tou... +3    65  0.47      1
A sp|P04465|CALM_TRYBB CALMODULIN >pir||MCUTG calmodulin... +3    78  0.50      1
A sp|P29290|TPCA_HOMAM TROPONIN C, ISOFORM 2A >pir||S184... +3    78  0.51      1
A pdb|1DEG|            Calmodulin Mutant With Glu 84 Del... +3    77  0.55      1
A pir||A45940          calmodulin - sea urchin (Strongyl... +3    64  0.58      1
A pdb|1AK8|            Nmr Solution Structure Of Cerium-... +3    64  0.58      1
A pdb|1TNX|            Ef-Hand Mol_id: 1; Molecule: Trop... +3    78  0.60      1
A gi|212778            (M19027) troponin C [Gallus gallus]  +3    78  0.61      1
A sp|P27165|CALM_PHYIN CALMODULIN >gi|169306 (M83535) ca... +3    76  0.72      1
A pir||S53019          calmodulin - Macrocystis pyrifera... +3    76  0.72      1
A gi|161577            (K01649) Spec 1a protein [Strongy... +3    62  0.77      1
A gi|1785958           (U38788) calmodulin [Acrasis rosea]  +3    62  0.77      1
A sp|Q07167|SM16_SCHMA 16 KD CALCIUM-BINDING PROTEIN (EG... +3    75  0.80      1
A gnl|PID|e1249533     (AJ001092) calmodulin-like protei... +3    74  0.82      1
A pir||MCLQ            calmodulin - migratory locust >pd... +3    75  0.83      1
A sp|P11118|CALM_EUGGR CALMODULIN >pir||MCEG calmodulin ... +3    75  0.83      1
A sp|P11121|CALM_PYUSP CALMODULIN >pir||MCAZS calmodulin... +3    75  0.83      1
A sp|P07181|CALM_DROME CALMODULIN >pir||MCFF calmodulin ... +3    75  0.84      1
A gnl|PID|e321197      (Y13578) calmodulin [Ciona intest... +3    75  0.84      1
A gi|2291247           (AF016429) similar to EF-hand cal... +3    75  0.84      1
A gi|310563            (L19359) calmodulin [Glycine max]... +3    75  0.85      1
A pdb|1CTA|A           Gallus gallus >pdb|1CTA|B Gallus ... +3    61  0.86      1
A pir||KLPGI           calcium-binding protein, intestin... +3    61  0.86      1
A sp|P53440|CALF_NAEGR CALMODULIN, FLAGELLAR (CAM-1) >gi... +3    75  0.87      1
A sp|P05419|CALN_CHICK NEO-CALMODULIN (NEOCAM) >pir||A29... +3    73  0.89      1
A gi|208092            (M11334) synthetic calmodulin [Ar... +3    74  0.92      1
A pdb|1AHR|            Calmodulin Mutant With A Two Resi... +3    73  0.96      1
A gi|3243222           (AF069912) calmodulin [Xiphias gl... +3    59  0.97      1
A gnl|PID|e1264035     (AJ001093) calmodulin-like protei... +3    76  0.97      1
A gi|162030            (K02944) calmodulin A [Trypanosom... +3    73  0.97      1
A gnl|PID|d1027201     (AB009466) 155aa long hypothetica... +3    73  0.98      1
A sp|P13833|MLR_DICDI  MYOSIN REGULATORY LIGHT CHAIN (RM... +3    73  0.99      1
A gnl|PID|d1014427     (D88976) troponin C [Branchiostom... +3    73  0.99      1
A sp|P41041|CALM_PNECA CALMODULIN >pir||JN0722 calmoduli... +3    72  0.992     1
A sp|P05932|CALL_ARBPU CALMODULIN BETA >pir||S02691 calm... +3    71  0.993     1
A gi|2267084           (AF007889) calmodulin [Symbiodini... +3    71  0.993     1
A pir||JC1310          calmodulin-related calcium-bindin... +3    57  0.997     1
A sp|P25070|TCH2_ARATH CALMODULIN-RELATED PROTEIN 2, TOU... +3    72  0.997     1
A gnl|PID|e327459      (Z97336) calmodulin [Arabidopsis ... +3    71  0.999     1
A gnl|PID|e223522      (Z69663) F48F7.1 [Caenorhabditis ... -1    56  0.9995    1
A gi|3153655           (AF056851) genome polyprotein [He... -1    56  0.9995    1
A gi|406661            (Z26706) Calcium-binding protein ... +3    65  0.9996    1
A gnl|PID|d1014428     (D88977) troponin C [Branchiostom... +3    71  0.9997    1
A gnl|PID|e237261      (Z71757) calmodulin-domain protei... +3    77  0.9997    1
A gnl|PID|e238792      (X97612) CaMF-1 [Fagus sylvatica]    +3    70  0.9998    1
A sp|P29289|TPC1_HOMAM TROPONIN C, ISOFORM 1 >pir||S1839... +3    70  0.9999    1
A gi|170076            (L01433) calmodulin [Glycine max]... +3    70  0.9999    1
A gi|587454            (X80231) calmodulin [Sauroleishma... +3    69  0.99995   1



>gi|2315983 (U82087) calmodulin-like domain protein kinase [Tortula ruralis]
            Length = 578

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.0035, P = 0.0035
 Identities = 29/100 (29%), Positives = 48/100 (48%), Frame = +3

Query:    96 RQVFFAGHIGGTIGIMTGLFLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRA 275
             RQ+  A  + G+  I  G FL    L L     ++   A F  LDK  +GYL + EL  A
Sbjct:   455 RQLMDAADVDGSGAIDYGEFLAA-TLHLNKVERDENMFAAFSYLDKDNSGYLTVDELQHA 513

Query:   276 LTDMGLPASAVENAMEKYERNS--QLDFKQFQKIRNDARRG 392
             L +  +   +VE  + + ++N+  Q+D+ +F  +      G
Sbjct:   514 LAEFNMGDVSVEELLREVDQNNDGQIDYTEFVTMMRKGNMG 554


>gnl|PID|e313754 (Y12560) two EF-hand calcium-binding birch pollen allergen
            [Betula pendula]
            Length = 85

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.013, P = 0.013
 Identities = 21/69 (30%), Positives = 38/69 (55%), Frame = +3

Query:   183 DSGEEKADHA-LFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQLDFK 356
             D  ++KA+   +F+R D +G+G +   ELG AL  +G +    V++ M + + +    F 
Sbjct:     4 DHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGD-GFI 62

Query:   357 QFQKIRNDAR 386
              FQ+  + AR
Sbjct:    63 SFQEFTDFAR 72


>gnl|PID|e1310770 (Y17713) pollen allergen Aln g 2 [Alnus glutinosa]
            Length = 85

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.016, P = 0.016
 Identities = 21/69 (30%), Positives = 38/69 (55%), Frame = +3

Query:   183 DSGEEKADHA-LFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQLDFK 356
             D  +++A+H  +F+  D +G+G +   ELG AL  +G +    V++ M + + +    F 
Sbjct:     4 DHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGD-GFI 62

Query:   357 QFQKIRNDAR 386
              FQ+  N AR
Sbjct:    63 SFQEFTNFAR 72


>sp|P02597|CALS_CHICK CALMODULIN, STRIATED MUSCLE >pir||MCCHM calmodulin,
            striated muscle - chicken >gi|211542 (K02907) calmodulin-like
            protein [Gallus gallus]
            Length = 149

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.019, P = 0.019
 Identities = 21/80 (26%), Positives = 43/80 (53%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + DS  E+     F+  DK GNGY+   EL   +T++G  L    V+  +++
Sbjct:    69 FLSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIKE 128

Query:   327 YERNS--QLDFKQFQKIRND 380
              + N+  Q+++++F ++  +
Sbjct:   129 ADCNNDGQVNYEEFVRMMTE 148


>pir||S54819 BETV4 protein - European white birch >gi|809536 (X87153) BETV4
            protein [Betula pendula]
            Length = 85

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.027, P = 0.026
 Identities = 21/73 (28%), Positives = 39/73 (53%), Frame = +3

Query:   183 DSGEEKADHA-LFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQ--LD 350
             D  ++KA+   +F+R D +G+G +   ELG AL  +G +    V++ M + + +    + 
Sbjct:     4 DHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFIS 63

Query:   351 FKQFQKIRNDARRG 392
             F++F      A RG
Sbjct:    64 FQEFTDFGR-ANRG 76


>gi|3337403 (AF015810) calcium-binding pollen allergen [Olea europaea]
            Length = 84

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.027, P = 0.026
 Identities = 20/75 (26%), Positives = 38/75 (50%), Frame = +3

Query:   177 LIDSGEEKADHA-LFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQ-- 344
             + D  +E A+H  +F+R D +G+G +   ELG  L  +G +    ++  M + + +    
Sbjct:     1 MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF 60

Query:   345 LDFKQFQKIRNDARRG 392
             + F++F      A RG
Sbjct:    61 ISFEEFTVFAR-ANRG 75


>gi|2352427 (AF004161) peroxisomal Ca-dependent solute carrier [Oryctolagus
            cuniculus]
            Length = 475

  Plus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.028, P = 0.028
 Identities = 21/60 (35%), Positives = 37/60 (61%), Frame = +3

Query:   213 LFQRLDKHGNGYLELKELGRALTDMGLPASAVENAMEKY------ERNSQLDFKQFQKIR 374
             LFQ LD++G+G ++++EL   L  +G+P    ++A EK        ++ +LDF++F K  
Sbjct:    27 LFQALDRNGDGVVDIRELQEGLKSLGIPLG--QDAEEKIFTTGDVNKDGKLDFEEFMKYL 84

Query:   375 ND 380
              D
Sbjct:    85 KD 86


>gnl|PID|e330443 (Z82282) T07G12.1 [Caenorhabditis elegans]
            Length = 182

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.029, P = 0.028
 Identities = 23/71 (32%), Positives = 39/71 (54%), Frame = +3

Query:   192 EEKADHA-LFQRLDKHGNGYLELKELGRALTDMGLPASAVE--NAMEKYE--RNSQLDFK 356
             EE  + A  F+  DK GN  + +KELG A+  +GL  +  E  N + +Y+   N ++DF 
Sbjct:    20 EELQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFG 79

Query:   357 QFQKIRNDARR 389
             +F K+  +  +
Sbjct:    80 EFCKMMKEMNK 90


>pir||S65150 pollen allergen Bra n II (clone 41 and others) - rape (fragment)
            >gnl|PID|d1010278 (D63152) Calcium-Binding Protein [Brassica napus]
            Length = 82

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.034, P = 0.034
 Identities = 19/69 (27%), Positives = 39/69 (56%), Frame = +3

Query:   195 EKADH-ALFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQ--LDFKQF 362
             EKA+H  +F++ D +G+G +   ELG AL ++G +    ++  M + + +    + +++F
Sbjct:     5 EKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEF 64

Query:   363 QKIRNDARRG 392
                 + A RG
Sbjct:    65 SDFAS-ANRG 73


>pir||S65152 pollen allergen Bra r II (clone 921) - turnip >gnl|PID|d1010280
            (D63154) Calcium-Binding Protein [Brassica rapa]
            Length = 83

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.034, P = 0.034
 Identities = 19/69 (27%), Positives = 39/69 (56%), Frame = +3

Query:   195 EKADH-ALFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQ--LDFKQF 362
             EKA+H  +F++ D +G+G +   ELG AL ++G +    ++  M + + +    + +++F
Sbjct:     6 EKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEF 65

Query:   363 QKIRNDARRG 392
                 + A RG
Sbjct:    66 SDFAS-ANRG 74


>gnl|PID|e353289 (AJ001919) calmodulin [Branchiostoma lanceolatum]
            Length = 89

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.043, P = 0.043
 Identities = 19/74 (25%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:     9 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 68

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:    69 ADIDGDGQVNYEEF 82


>gi|2654179 (AF034988) calmodulin [Sus scrofa]
            Length = 86

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.043, P = 0.043
 Identities = 16/46 (34%), Positives = 24/46 (52%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G
Sbjct:    32 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLG 77


>sp|P05933|CALM_SCHPO CALMODULIN >pir||MCZP calmodulin - fission yeast
            (Schizosaccharomyces pombe) >gi|173357 (M16475) calmodulin
            [Schizosaccharomyces pombe] >gnl|PID|e316105 (Z95395) Cam1p
            [Schizosaccharomyces pombe]
            Length = 150

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.044, P = 0.043
 Identities = 28/103 (27%), Positives = 51/103 (49%), Frame = +3

Query:    63 TPVLTERQMKGRQVFFAGHIGGTIGIMTGLFLGMFPLLLIDSGEEKADHALFQRLDKHGN 242
             +P   E Q    +V   G+  GTI      FL M    + D+  E+     F+  DK GN
Sbjct:    44 SPTAAELQDMINEVDADGN--GTIDFTE--FLTMMARKMKDTDNEEEVREAFKVFDKDGN 99

Query:   243 GYLELKELGRALTDMG--LPASAVENAMEKYERNSQ--LDFKQFQKI 371
             GY+ ++EL   LT +G  L    V + + + + +    +++++F ++
Sbjct:   100 GYITVEELTHVLTSLGERLSQEEVADMIREADTDGDGVINYEEFSRV 146


>pir||S65143 pollen allergen group II (clone 4) - turnip (fragment)
            Length = 80

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.071, P = 0.068
 Identities = 18/69 (26%), Positives = 39/69 (56%), Frame = +3

Query:   195 EKADH-ALFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQ--LDFKQF 362
             E+A+H  +F++ D +G+G +   ELG AL ++G +    ++  M + + +    + +++F
Sbjct:     3 ERAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEF 62

Query:   363 QKIRNDARRG 392
                 + A RG
Sbjct:    63 SDFAS-ANRG 71


>sp|P11120|CALM_PLECO CALMODULIN >pir||MCMRP calmodulin - cornucopia mushroom
            Length = 148

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.089, P = 0.085
 Identities = 21/77 (27%), Positives = 41/77 (53%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L  + V+  + +
Sbjct:    68 FLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGEKLTDNEVDEMIRE 127

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   128 ADIDGDGQINYEEFVKM 144


>pdb|1TRC|A Bos taurus
            Length = 71

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.092, P = 0.088
 Identities = 17/64 (26%), Positives = 34/64 (53%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK--YERNSQLD 350
             D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +   + + Q++
Sbjct:     1 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 60

Query:   351 FKQF 362
             +++F
Sbjct:    61 YEEF 64


>pdb|1CMG|  Nmr Solution Structure Of Calcium-Loaded Calmodulin
            Carboxy-Terminal Domain Mol_id: 1; Molecule: Calmodulin
            (Vertebrate); Chain: Null; Domain: Calcium C-Terminal Domain
            (Residues 76 - 148); Synonym: Calmodulin Calcium Tr2c-Domain;...
            >pdb|1CMF|  Nmr Solution Structure Of Apo Calmodulin
            Carboxy-Terminal Domain Mol_id: 1; Molecule: Calmodulin
            (Vertebrate); Chain: Null; Domain: Apo C-Terminal Domain (Residues
            76 - 148); Synonym: Calmodulin Apo Tr2c-Domain; Engineered: Yes
            Length = 73

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.092, P = 0.088
 Identities = 17/64 (26%), Positives = 34/64 (53%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK--YERNSQLD 350
             D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +   + + Q++
Sbjct:     3 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 62

Query:   351 FKQF 362
             +++F
Sbjct:    63 YEEF 66


>pir||S65145 pollen allergen group II (clone 44) - rape
            Length = 83

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.12, P = 0.11
 Identities = 19/69 (27%), Positives = 37/69 (53%), Frame = +3

Query:   195 EKADH-ALFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQ--LDFKQF 362
             EKA+H   F++ D +G+G +   ELG AL ++G +    ++  M + + +    + +++F
Sbjct:     6 EKAEHDRFFKKFDANGDGTISSTELGDALKNLGSVTHDDIKRMMAEIDTDGDGFISYQEF 65

Query:   363 QKIRNDARRG 392
                   A RG
Sbjct:    66 SDFAK-ANRG 74


>gnl|PID|e1285534 (AJ223302) calmodulin-like protein [Branchiostoma
            lanceolatum]
            Length = 69

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.12, P = 0.11
 Identities = 15/56 (26%), Positives = 29/56 (51%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALTDMGLPASAVENAMEKYERNSQLD 350
             D+ +E+     F+  DK GNGY+   EL   +T++G      +  +++  R + +D
Sbjct:     6 DNNQEEELREAFKVFDKDGNGYISAAELRHVMTNLG--EKLTDEEVDEMIREADVD 59


>pdb|4TNC|  Troponin C
            Length = 162

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.13, P = 0.12
 Identities = 21/64 (32%), Positives = 40/64 (62%), Frame = +3

Query:   186 SGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEKYERNS--QLDF 353
             S EE AD   F+  DK+ +G+++++ELG  L   G  +    +E+ M+  ++N+  ++DF
Sbjct:    94 SEEELAD--CFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDLMKDSDKNNDGRIDF 151

Query:   354 KQFQKI 371
              +F K+
Sbjct:   152 DEFLKM 157


>pdb|1TRC|B Bos taurus
            Length = 68

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.16, P = 0.15
 Identities = 19/62 (30%), Positives = 35/62 (56%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK--YERNSQLD 350
             DS EE  +   F+  DK GNGY+   EL   +T++G  L    V+  + +   + + Q++
Sbjct:     1 DSEEEIRE--AFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVN 58

Query:   351 FKQF 362
             +++F
Sbjct:    59 YEEF 62


>sp|P02589|TPCS_RANES TROPONIN C, SKELETAL MUSCLE >pir||TPFGCS troponin C,
            skeletal muscle - edible frog
            Length = 162

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.24, P = 0.21
 Identities = 22/80 (27%), Positives = 43/80 (53%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLELKELGRALTDMG--LPASAVENA 317
             FL M    + +  + K++  L   F+  DK+ +GY++ +ELG  L   G  +    +E  
Sbjct:    78 FLVMMVRQMKEDAQGKSEEELAECFRIFDKNADGYIDSEELGEILRSSGESITDEEIEEL 137

Query:   318 MEKYERNS--QLDFKQFQKI 371
             M+  ++N+  ++DF +F K+
Sbjct:   138 MKDGDKNNDGKIDFDEFLKM 157


>gi|2213610 (AC000103) F21J9.4 [Arabidopsis thaliana]
            Length = 186

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.26, P = 0.23
 Identities = 17/58 (29%), Positives = 36/58 (62%), Frame = +3

Query:   210 ALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEKYERNSQ--LDFKQFQKI 371
             A+F++ D +G+G +  KELG  +T +G  +P   +E A+ + +R     ++F++F ++
Sbjct:    40 AVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEIDRKGDGYINFEEFVEL 97


>sp|P15094|CALM_ACHKL CALMODULIN >pir||MCUMAK calmodulin - Achlya klebsiana
            >gi|166304 (J05116) calmodulin [Achlya klebsiana]
            Length = 149

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.26, P = 0.23
 Identities = 21/77 (27%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     FQ  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEILEAFQGFDKDGNGFISAAELRHMMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   129 ADIDGDGQINYEEFVKM 145


>pir||A56785 calmodulin - pig (fragment)
            Length = 51

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.28, P = 0.24
 Identities = 13/36 (36%), Positives = 20/36 (55%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             D+  E+     F+  DK GNGY+   EL   +T++G
Sbjct:     3 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLG 38


>gnl|PID|d1001665 (D10363) calmodulin [Oryzias latipes] >gnl|PID|d1001666
            (D10364) calmodulin [Oryzias latipes] >gnl|PID|d1001667 (D10365)
            calmodulin [Oryzias latipes] >gnl|PID|d1001668 (D10366) calmodulin
            [Oryzias latipes]
            Length = 136

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.33, P = 0.28
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    62 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 121

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   122 ADIDGDGQVNYEEF 135


>sp|P10246|TPCS_MELGA TROPONIN C, SKELETAL MUSCLE >pir||A40803 troponin C,
            skeletal muscle - turkey >bbs|51382 troponin C [turkeys, muscle,
            Peptide Partial, 162 aa]
            Length = 162

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.35, P = 0.29
 Identities = 21/80 (26%), Positives = 45/80 (56%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLELKELGRALTDMG--LPASAVENA 317
             FL M    + +  + K++  L   F+  DK+ +G+++++ELG  L   G  +    +E+ 
Sbjct:    78 FLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVTEEEIEDL 137

Query:   318 MEKYERNS--QLDFKQFQKI 371
             M+  ++N+  ++DF +F K+
Sbjct:   138 MKDSDKNNDGRIDFDEFLKM 157


>sp|P27482|CALL_HUMAN CALMODULIN-RELATED PROTEIN NB-1 (CALMODULIN-LIKE PROTEIN)
            (CLP) >pir||MCHUNB calmodulin-related protein NB-1 - human
            >gi|29650 (X13461) hGH6 calmodulin-like protein [Homo sapiens]
            >gi|189081 (M58026) NB-1 [Homo sapiens]
            Length = 149

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.35, P = 0.30
 Identities = 20/77 (25%), Positives = 39/77 (50%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FLGM    + D+  E+     F+  DK GNG++   EL   +T +G  L    V+  +  
Sbjct:    69 FLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRA 128

Query:   327 YERNS--QLDFKQFQKI 371
              + +   Q+++++F ++
Sbjct:   129 ADTDGDGQVNYEEFVRV 145


>gi|3415119 (AF081672) calmodulin [Gallus gallus]
            Length = 149

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.35, P = 0.30
 Identities = 19/66 (28%), Positives = 32/66 (48%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMGLPASAVENAMEKYE 332
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G      +  +++  
Sbjct:    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLG--EKLTDEQVDEMI 126

Query:   333 RNSQLD 350
             R S +D
Sbjct:   127 RESDID 132


>gi|167676 (M13009) calmodulin [Dictyostelium discoideum]
           Length = 139

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.37, P = 0.31
 Identities = 21/77 (27%), Positives = 38/77 (49%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T +G  L    V+  + +
Sbjct:    58 FLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIRE 117

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++ +F K+
Sbjct:   118 ADLDGDGQVNYDEFVKM 134


>pir||I50535 calmodulin - electric eel (fragment) >gi|213133 (M17495)
            calmodulin [Electrophorus electricus]
            Length = 21

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.38, P = 0.31
 Identities = 11/21 (52%), Positives = 15/21 (71%), Frame = +3

Query:   228 DKHGNGYLELKELGRALTDMG 290
             DK GNGY+   ELG  +T++G
Sbjct:     1 DKEGNGYISAAELGHVITNLG 21


>gi|1785953 (U38787) calmodulin [Naegleria fowleri]
            Length = 63

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.38, P = 0.31
 Identities = 17/55 (30%), Positives = 27/55 (49%), Frame = +3

Query:   126 GTIGIMTGLFLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             GTI      FL M    + D+  E+     F+  DK GNG++  +EL   + ++G
Sbjct:     6 GTIDFTE--FLTMMAKKMKDTDNEEEIKEAFKVFDKDGNGFISAQELRHVMCNLG 58


>pir||S65144 pollen allergen group II (clone 42) - rape
            Length = 83

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.38, P = 0.31
 Identities = 18/69 (26%), Positives = 36/69 (52%), Frame = +3

Query:   195 EKADH-ALFQRLDKHGNGYLELKELGRALTDMG-LPASAVENAMEKYERNSQ--LDFKQF 362
             EK +H   F++ D +G+G +   ELG AL ++G +    ++  M + + +    + +++F
Sbjct:     6 EKTEHDRFFKKFDANGDGTISSTELGDALKNLGSVTHDDIKRMMAEIDTDGDGFISYQEF 65

Query:   363 QKIRNDARRG 392
                   A RG
Sbjct:    66 SDFAK-ANRG 74


>pir||S02690 calmodulin A - sea urchin (Arbacia punctulata) (fragment)
            Length = 141

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.39, P = 0.32
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   128 ADIDGDGQVNYEEF 141


>pdb|1CDM|A Bos taurus
            Length = 144

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.42, P = 0.35
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    65 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 124

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   125 ADIDGDGQVNYEEF 138


>gi|972430 (F14583) calmodulin [Sus scrofa]
           Length = 120

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.46, P = 0.37
 Identities = 16/46 (34%), Positives = 24/46 (52%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G
Sbjct:    69 FLXMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLG 114


>pdb|1CDL|A Homo sapiens >pdb|1CDL|B Homo sapiens >pdb|1CDL|C Homo sapiens
            >pdb|1CDL|D Homo sapiens
            Length = 147

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.46, P = 0.37
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   128 ADIDGDGQVNYEEF 141


>pdb|1TOP|  Troponin C >pdb|1NCY|  Troponin-C, Complex With Manganese Muscle
            Protein, Calcium-Binding Protein Mol_id: 1; Molecule: Troponin C;
            Chain: Null >pdb|1NCX|  Troponin C Muscle Protein, Calcium-Binding
            Protein, Duplication Mol_id: 1; Molecule: Troponin C; Chain: Null
            >pdb|1NCZ|  Troponin C Muscle Protein, Calcium-Binding Protein,
            Duplication Mol_id: 1; Molecule: Troponin C; Chain: Null
            Length = 162

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.47, P = 0.37
 Identities = 21/80 (26%), Positives = 45/80 (56%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLELKELGRALTDMG--LPASAVENA 317
             FL M    + +  + K++  L   F+  DK+ +G+++++ELG  L   G  +    +E+ 
Sbjct:    78 FLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDL 137

Query:   318 MEKYERNS--QLDFKQFQKI 371
             M+  ++N+  ++DF +F K+
Sbjct:   138 MKDSDKNNDGRIDFDEFLKM 157


>pdb|5TNC|  Troponin-C
            Length = 162

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.47, P = 0.37
 Identities = 21/80 (26%), Positives = 45/80 (56%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLELKELGRALTDMG--LPASAVENA 317
             FL M    + +  + K++  L   F+  DK+ +G+++++ELG  L   G  +    +E+ 
Sbjct:    78 FLVMMVRQMKEDAKGKSEEELEDCFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDL 137

Query:   318 MEKYERNS--QLDFKQFQKI 371
             M+  ++N+  ++DF +F K+
Sbjct:   138 MKDSDKNNDGRIDFDEFLKM 157


>pir||MCBO calmodulin - bovine >pir||MCON calmodulin - salmon >pdb|1CLL|
           Calmodulin (Vertebrate) >pdb|1CTR|  Calmodulin Complexed With
           Trifluoperazine (1:1 Complex) >pdb|1CFD|  Calcium-Free Calmodulin
           Mol_id: 1; Molecule: Calmodulin; Chain: Null >pdb|1CFC|
           Calcium-Free Calmodulin Mol_id: 1; Molecule: Calmodulin; Chain: Null
           >pdb|1LIN|  Calmodulin Complexed With Trifluoperazine (1:4 Complex)
           Mol_id: 1; Molecule: Calmodulin; Chain: Null; Heterogen:
           Trifluoperazine (Tfp) >pdb|1CM1|A Chain A, Motions Of Calmodulin -
           Single-Conformer Refinement Complex (Calcium-BindingTRANSFERASE),
           EF-Hand Calcium-Binding Protein Mol_id: 1; Molecule: Calmodulin;
           Chain: A; Mol_id: 2; Molecule: Calmodulin-Dependent Protein
           Kinase... >pdb|1CM4|A Chain A, Motions Of Calmodulin -
           Four-Conformer Refinement Complex (Calcium-BindingTRANSFERASE),
           EF-Hand Calcium-Binding Protein Mol_id: 1; Molecule: Calmodulin;
           Chain: A, C, E, G; Mol_id: 2; Molecule: Calmodulin-Dependent
           Protein... >pdb|1CM4|C Chain C, Motions Of Calmodulin -
           Four-Conformer Refinement Complex (Calcium-BindingTRANSFERASE),
           EF-Hand Calcium-Binding Protein Mol_id: 1; Molecule: Calmodulin;
           Chain: A, C, E, G; Mol_id: 2; Molecule: Calmodulin-Dependent
           Protein... >pdb|1CM4|E Chain E, Motions Of Calmodulin -
           Four-Conformer Refinement Complex (Calcium-BindingTRANSFERASE),
           EF-Hand Calcium-Binding Protein Mol_id: 1; Molecule: Calmodulin;
           Chain: A, C, E, G; Mol_id: 2; Molecule: Calmodulin-Dependent
           Protein... >pdb|1CM4|G Chain G, Motions Of Calmodulin -
           Four-Conformer Refinement Complex (Calcium-BindingTRANSFERASE),
           EF-Hand Calcium-Binding Protein Mol_id: 1; Molecule: Calmodulin;
           Chain: A, C, E, G; Mol_id: 2; Molecule: Calmodulin-Dependent
           Protein...
           Length = 148

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.47, P = 0.38
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   128 ADIDGDGQVNYEEF 141


>pir||MCRB calmodulin - rabbit >pdb|3CLN|  Calmodulin >pdb|1DMO|  Calmodulin,
           Nmr, 30 Structures Calcium-Induced Conformational Change,
           Calcium-Binding Protein Mol_id: 1; Molecule: Calmodulin; Chain:
           Null; Engineered: Yes
           Length = 148

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.47, P = 0.38
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   128 ANIDGDGQVNYEEF 141


>sp|P21251|CALM_STIJA CALMODULIN >pir||MCSFCU calmodulin - sea cucumber
            (Stichopus japonicus)
            Length = 148

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.47, P = 0.38
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   128 ADIDGDGQVNYEEF 141


>sp|P02588|TPCS_CHICK TROPONIN C, SKELETAL MUSCLE >pir||TPCHCS troponin C,
            skeletal muscle - chicken
            Length = 163

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.48, P = 0.38
 Identities = 21/80 (26%), Positives = 45/80 (56%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLELKELGRALTDMG--LPASAVENA 317
             FL M    + +  + K++  L   F+  DK+ +G+++++ELG  L   G  +    +E+ 
Sbjct:    79 FLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDL 138

Query:   318 MEKYERNS--QLDFKQFQKI 371
             M+  ++N+  ++DF +F K+
Sbjct:   139 MKDSDKNNDGRIDFDEFLKM 158


>sp|P18061|CALM_TRYCR CALMODULIN >pir||MCUTC calmodulin - Trypanosoma cruzi
            >gi|10604 (X52096) calmodulin (AA 1-149) [Trypanosoma cruzi]
            Length = 149

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.48, P = 0.38
 Identities = 20/77 (25%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + DS  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   129 ADVDGDGQINYEEFVKM 145


>sp|P02593|CALM_HUMAN CALMODULIN >pir||MCHU calmodulin - human >pir||MCRT
            calmodulin - rat >pir||MCCH calmodulin - chicken >pir||JC1305
            calmodulin - Japanese medaka >pir||S37707 calmodulin - mouse
            >pir||I51402 calmodulin - African clawed frog >pir||I51202
            calmodulin - unclassified vertebrate >gi|50274 (X61432) calmodulin
            [Mus musculus] >gi|55867 (X14265) calmodulin III [Rattus
            norvegicus] >gi|57041 (X13933) calmodulin [Rattus rattus] >gi|57835
            (X13817) calmodulin [Rattus norvegicus] >gi|179810 (M27319)
            calmodulin [Homo sapiens] >gi|179884 (M19311) calmodulin [Homo
            sapiens] >gi|179888 (J04046) calmodulin [Homo sapiens] >gi|192365
            (M27844) calmodulin synthesis [Mus musculus] >gi|203256 (M19312)
            calmodulin [Rattus norvegicus] >gi|203258 (M17069) calmodulin
            [Rattus norvegicus] >gi|203260 (M16659) calmodulin [Rattus
            norvegicus] >gi|207977 (J04729) calmodulin [Artificial gene]
            >gi|211386 (M36167) calmodulin [Gallus gallus] >gi|211398 (L00101)
            calmodulin [Gallus gallus] >gi|214017 (K01944) calmodulin (cDNA
            clone 11G2) [Xenopus laevis] >gi|214019 (K01945) calmodulin (cDNA
            clone 71) [Xenopus laevis] >gi|469420 (M19380) calmodulin [Mus
            musculus] >gi|531827 (U12022) calmodulin [Homo sapiens]
            >gnl|PID|d1008897 (D45887) calmodulin [Homo sapiens] >gi|818020
            (X13833) calmodulin II [Rattus norvegicus] >gnl|PID|d1012563
            (D83350) calmodulin [Anas platyrhynchos] >gnl|PID|e10120 (X13931)
            calmodulin [Rattus rattus] >gi|2055425 (U94728) calmodulin [Homo
            sapiens]
            Length = 149

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.48, P = 0.38
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   129 ADIDGDGQVNYEEF 142


>pir||I49567 calmodulin - mouse >gi|469422 (M19381) calmodulin [Mus musculus]
            Length = 149

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.48, P = 0.38
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   129 ADIDGDGQVNYEEF 142


>sp|P02594|CALM_ELEEL CALMODULIN >pir||MCEE calmodulin - electric eel
            >gi|213130 (M36168) calmodulin [Electrophorus electricus]
            Length = 149

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.48, P = 0.38
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMAKKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   129 ADIDGDGQVNYEEF 142


>gi|169406 (M96933) calmodulin [Pneumocystis carinii]
           Length = 75

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 0.49, P = 0.39
 Identities = 15/46 (32%), Positives = 22/46 (47%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             FL M    + D   E+     F+  DK GNG +   EL   +T++G
Sbjct:    29 FLAMMARKMKDVDSEEEIREAFKVFDKDGNGIISAAELRHVMTNLG 74


>sp|P05934|CALM_STRPU CALMODULIN
            Length = 80

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 0.49, P = 0.39
 Identities = 18/62 (29%), Positives = 35/62 (56%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK--YERNSQLD 350
             DS EE  +   F+  DK GNG++   EL   +T++G  L    V+  + +   + + Q++
Sbjct:    12 DSEEEIRE--AFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 69

Query:   351 FKQF 362
             +++F
Sbjct:    70 YEEF 73


>pir||MCDO calmodulin - slime mold (Dictyostelium discoideum)
           Length = 151

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.51, P = 0.40
 Identities = 21/77 (27%), Positives = 38/77 (49%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T +G  L    V+  + +
Sbjct:    70 FLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIRE 129

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++ +F K+
Sbjct:   130 ADLDGDGQVNYDEFVKM 146


>sp|P02599|CALM_DICDI CALMODULIN >gi|290034 (M64089) calmodulin [Dictyostelium
            discoideum]
            Length = 152

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.52, P = 0.40
 Identities = 21/77 (27%), Positives = 38/77 (49%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T +G  L    V+  + +
Sbjct:    71 FLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIRE 130

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++ +F K+
Sbjct:   131 ADLDGDGQVNYDEFVKM 147


>gi|825635 (X52606) calmodulin [Homo sapiens]
           Length = 152

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.52, P = 0.40
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    72 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 131

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   132 ADIDGDGQVNYEEF 145


>pir||B34669 calmodulin-related protein 3, touch-induced - Arabidopsis thaliana
            (fragment)
            Length = 72

  Plus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.64, P = 0.47
 Identities = 16/53 (30%), Positives = 30/53 (56%), Frame = +3

Query:   216 FQRLDKHGNGYLELKELGRALTDMGL-PASA-VENAMEKYERNSQ--LDFKQF 362
             F+  DK+G+G +  KELG  +  +G  P  A +++ M + + +    +DF +F
Sbjct:    15 FRLFDKNGDGSITKKELGTVMRSLGQNPTKADLQDMMNEVDLDGDGTIDFPEF 67


>sp|P04465|CALM_TRYBB CALMODULIN >pir||MCUTG calmodulin - Trypanosoma brucei
            gambiense >pir||A48111 calmodulin C - Trypanosoma brucei >gi|10386
            (X56511) calmodulin [Trypanosoma (Trypanozoon) brucei]
            Length = 149

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.70, P = 0.50
 Identities = 20/77 (25%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + DS  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   129 ADVDGDGQINYEEFVKM 145


>sp|P29290|TPCA_HOMAM TROPONIN C, ISOFORM 2A >pir||S18434 troponin C isoform 2a
            - American lobster
            Length = 150

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.72, P = 0.51
 Identities = 26/82 (31%), Positives = 42/82 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLE---LKELGRALTDMGLPASAVEN 314
             F+ +    LI+  EE     L   F+  DK GNGY+    LKE+ R L D  L    +++
Sbjct:    68 FVELAAKFLIEEDEEALKTELREAFRVYDKEGNGYITTDVLKEILREL-DNRLTEEDLDS 126

Query:   315 AMEKYERNSQ--LDFKQFQKIRN 377
              +E+ + +    LDF +F ++ N
Sbjct:   127 IIEEVDEDGSGTLDFNEFMEMMN 149


>pdb|1DEG|  Calmodulin Mutant With Glu 84 Deleted (Del E84)
            Length = 142

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.80, P = 0.55
 Identities = 21/73 (28%), Positives = 39/73 (53%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+   A F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:    64 FLTMMARKMKDTDSEEIREA-FRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 122

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   123 ANIDGDGQVNYEEF 136


>pir||A45940 calmodulin - sea urchin (Strongylocentrotus purpuratus) (fragment)
            Length = 80

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 0.86, P = 0.58
 Identities = 16/56 (28%), Positives = 29/56 (51%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALTDMGLPASAVENAMEKYERNSQLD 350
             DS EE  +   F+  DK GNG++   EL   +T++G      +  +++  R + +D
Sbjct:    12 DSEEEIRE--AFRVFDKDGNGFISAAELRHVMTNLG--EKLTDEEVDEMIREADID 63


>pdb|1AK8|  Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino-Terminal
            Domain (Ce2-Tr1c), 23 Structures Cerium-Loaded, Calcium-Binding
            Protein Mol_id: 1; Molecule: Calmodulin; Chain: Null; Fragment:
            N-Terminal Domain, Tr1c; Synonym: Ca...
            Length = 76

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 0.86, P = 0.58
 Identities = 16/53 (30%), Positives = 28/53 (52%), Frame = +3

Query:   216 FQRLDKHGNGYLELKELGRALTDMGL-PASA-VENAMEKYER--NSQLDFKQF 362
             F   DK G+G +  KELG  +  +G  P  A +++ + + +   N  +DF +F
Sbjct:    17 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69


>pdb|1TNX|  Ef-Hand Mol_id: 1; Molecule: Troponin C; Chain: Null; Engineered:
            Yes; Mutation: T130i >pdb|1TNW|  Ef-Hand Mol_id: 1; Molecule:
            Troponin C; Chain: Null; Engineered: Yes; Mutation: T130i
            Length = 162

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.91, P = 0.60
 Identities = 21/80 (26%), Positives = 45/80 (56%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLELKELGRALTDMG--LPASAVENA 317
             FL M    + +  + K++  L   F+  DK+ +G+++++ELG  L   G  +    +E+ 
Sbjct:    78 FLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDL 137

Query:   318 MEKYERNS--QLDFKQFQKI 371
             M+  ++N+  ++DF +F K+
Sbjct:   138 MKDSDKNNDGRIDFDEFLKM 157


>gi|212778 (M19027) troponin C [Gallus gallus]
           Length = 163

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.93, P = 0.61
 Identities = 21/80 (26%), Positives = 45/80 (56%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLELKELGRALTDMG--LPASAVENA 317
             FL M    + +  + K++  L   F+  DK+ +G+++++ELG  L   G  +    +E+ 
Sbjct:    79 FLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDL 138

Query:   318 MEKYERNS--QLDFKQFQKI 371
             M+  ++N+  ++DF +F K+
Sbjct:   139 MKDSDKNNDGRIDFDEFLKM 158


>sp|P27165|CALM_PHYIN CALMODULIN >gi|169306 (M83535) calmodulin [Phytophthora
            infestans]
            Length = 149

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 1.3, P = 0.72
 Identities = 20/77 (25%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEILEAFKVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   129 ADIDGDGQINYEEFVKM 145


>pir||S53019 calmodulin - Macrocystis pyrifera >gi|728609 (X85091) calmodulin
            [Macrocystis pyrifera]
            Length = 149

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 1.3, P = 0.72
 Identities = 20/77 (25%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEIIEAFKVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   129 ADIDGDGQINYEEFVKM 145


>gi|161577 (K01649) Spec 1a protein [Strongylocentrotus purpuratus]
           Length = 86

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 1.5, P = 0.77
 Identities = 19/64 (29%), Positives = 33/64 (51%), Frame = +3

Query:   198 KADH--ALFQRLDKHGNGYLELKELGRALTDMGLPASA--VENAMEKYERNS--QLDFKQ 359
             K +H    F  +DK GNG L  +EL  AL+    P     ++  ++K + N   ++D ++
Sbjct:    19 KEEHYTKAFDDMDKDGNGSLSPQELREALSASKPPMKRKKIKAIIQKADANKDGKIDREE 78

Query:   360 FQKI 371
             F K+
Sbjct:    79 FMKL 82


>gi|1785958 (U38788) calmodulin [Acrasis rosea]
            Length = 63

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 1.5, P = 0.77
 Identities = 14/46 (30%), Positives = 23/46 (50%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             FL +    + D+  E+     F+  DK GNG +   EL   +T++G
Sbjct:    13 FLTLMARKMKDTDTEEEIRDAFKVFDKDGNGLISAAELRHVMTNLG 58


>sp|Q07167|SM16_SCHMA 16 KD CALCIUM-BINDING PROTEIN (EGG ANTIGEN SME16)
            >gi|294856 (M80260) calcium-binding protein [Schistosoma mansoni]
            Length = 143

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.6, P = 0.80
 Identities = 17/54 (31%), Positives = 33/54 (61%), Frame = +3

Query:   213 LFQRLDKHGNGYLELKELGRAL--TDMGLPASAVENAMEKYERNS--QLDFKQF 362
             +FQ +DK G+G + +KEL   L  + M +  +++ N M + ++N   +LD+ +F
Sbjct:    81 VFQSIDKDGSGKVSIKELDEFLKTSGMDIDQNSLRNWMTQNDKNKDGELDYDEF 134

 Score = 71 (25.0 bits), Expect = 5.6, P = 1.0
 Identities = 14/50 (28%), Positives = 29/50 (58%), Frame = +3

Query:   192 EEKADHALFQRLDKHGNGYLELKELGRALTDMGLPASAVENAMEKYERNS 341
             EEK    +F  +DK  NG+L  +E+ + L ++G+  +  +  +++ + NS
Sbjct:     3 EEKQWTEVFHAIDKDKNGFLTREEIAQCLKEVGVCPNVADKIIKETDMNS 52


>gnl|PID|e1249533 (AJ001092) calmodulin-like protein [Branchiostoma
            lanceolatum]
            Length = 134

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 1.7, P = 0.82
 Identities = 17/66 (25%), Positives = 32/66 (48%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMGLPASAVENAMEKYE 332
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G      +  +++  
Sbjct:    62 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLG--EKLTDEEVDEMV 119

Query:   333 RNSQLD 350
             R + +D
Sbjct:   120 READID 125


>pir||MCLQ calmodulin - migratory locust >pdb|4CLN|  Calmodulin >pdb|2BBM|A
           Drosophila melanogaster >pdb|2BBN|A Drosophila melanogaster >gi|7688
           (Y00133) calmodulin (148 AA); pid:g7688 [Drosophila melanogaster]
           Length = 148

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.8, P = 0.83
 Identities = 19/74 (25%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   128 ADIDGDGQVNYEEF 141


>sp|P11118|CALM_EUGGR CALMODULIN >pir||MCEG calmodulin - Euglena gracilis
            Length = 148

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.8, P = 0.83
 Identities = 19/77 (24%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    68 FLTLMSRKMHDTDTEEEIKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   128 ADVDGDGQINYEEFVKM 144


>sp|P11121|CALM_PYUSP CALMODULIN >pir||MCAZS calmodulin - sea squirt
            Length = 148

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.8, P = 0.83
 Identities = 19/74 (25%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 127

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   128 ADIDGDGQVNYEEF 141


>sp|P07181|CALM_DROME CALMODULIN >pir||MCFF calmodulin - fruit fly (Drosophila
            melanogaster) >pir||MCGAC calmodulin - California sea hare >gi|5572
            (X56888) Calmodulin [Aplysia californica] >gnl|PID|e293331 (Y09863)
            calmodulin protein [Branchiostoma floridae] >gnl|PID|e293340
            (Y09880) calmodulin [Branchiostoma lanceolatum] >gnl|PID|d1020568
            (AB003081) calmodulin [Branchiostoma lanceolatum] >gnl|PID|d1020569
            (AB003082) calmodulin [Branchiostoma floridae] >gnl|PID|d1020570
            (AB003083) calmodulin [Halocynthia roretzi]
            Length = 149

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.8, P = 0.84
 Identities = 19/74 (25%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   129 ADIDGDGQVNYEEF 142


>gnl|PID|e321197 (Y13578) calmodulin [Ciona intestinalis]
            Length = 149

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.8, P = 0.84
 Identities = 19/74 (25%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   129 ADVDGDGQVNYEEF 142


>gi|2291247 (AF016429) similar to EF-hand calcium binding proteins; most
            similar to calmodulin [Caenorhabditis elegans]
            Length = 149

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.8, P = 0.84
 Identities = 19/74 (25%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   129 ADIDGDGQVNYEEF 142


>gi|310563 (L19359) calmodulin [Glycine max] >prf||2121384E calmodulin [Glycine
           max]
           Length = 150

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 1.9, P = 0.85
 Identities = 23/84 (27%), Positives = 43/84 (51%), Frame = +3

Query:   126 GTIGIMTGLFLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPA 299
             GTI  +   FL +    + ++ EE+     F+  DK  NGY+   EL   + ++G  L  
Sbjct:    62 GTIEFVE--FLNLMAKKMKETDEEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTD 119

Query:   300 SAVENAMEK--YERNSQLDFKQFQKI 371
               VE  +E+   + + Q+++ +F K+
Sbjct:   120 EEVEQMIEEADLDGDGQVNYDEFVKM 145


>pdb|1CTA|A Gallus gallus >pdb|1CTA|B Gallus gallus >pdb|1CTD|A Gallus gallus
            >pdb|1CTD|B Gallus gallus >pdb|1PON|A Gallus gallus
            Length = 36

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.9, P = 0.86
 Identities = 13/33 (39%), Positives = 22/33 (66%), Frame = +3

Query:   192 EEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             EE+  +A F+  DK+ +GY++++ELG  L   G
Sbjct:     4 EEELANA-FRIFDKNADGYIDIEELGEILRATG 35


>pir||KLPGI calcium-binding protein, intestinal - pig
            Length = 78

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.9, P = 0.86
 Identities = 16/33 (48%), Positives = 19/33 (57%), Frame = +3

Query:   165 FPLLLIDSGEEKADHALFQRLDKHGNGYLELKE 263
             FP LL   G    D  LFQ LDK+GNG +  +E
Sbjct:    39 FPSLL--KGPRTLDD-LFQELDKNGNGEVSFEE 68


>sp|P53440|CALF_NAEGR CALMODULIN, FLAGELLAR (CAM-1) >gi|458232 (U04381)
            flagellar calmodulin [Naegleria gruberi]
            Length = 155

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 2.1, P = 0.87
 Identities = 22/84 (26%), Positives = 43/84 (51%), Frame = +3

Query:   126 GTIGIMTGLFLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPA 299
             GTI      FL M    + D+  E+     F+  DK GNG++  +EL   + ++G  L  
Sbjct:    68 GTIDFTE--FLTMMAKKMKDTDNEEEIKEAFKVFDKDGNGFISAQELRHVMCNLGEKLTD 125

Query:   300 SAVENAMEK--YERNSQLDFKQFQKI 371
               V+  + +   + ++Q+++ +F K+
Sbjct:   126 EEVDEMIREADIDGDNQINYTEFVKM 151


>sp|P05419|CALN_CHICK NEO-CALMODULIN (NEOCAM) >pir||A29422 calmodulin-like
            protein - chicken (fragment) >gi|211368 (M18355) calmodulin-like
            protein [Gallus gallus]
            Length = 131

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 2.2, P = 0.89
 Identities = 19/74 (25%), Positives = 37/74 (50%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+  E+     F+  DK  NGY+   EL   +T++G  L    V+  + +
Sbjct:    58 FLTMMARKMKDTDSEEEIREAFRVFDKDSNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 117

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   118 ADIDGDGQVNYEEF 131


>gi|208092 (M11334) synthetic calmodulin [Artificial gene] >gi|208412 (M26151)
           camodulin [Artificial sequence]
           Length = 149

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 2.5, P = 0.92
 Identities = 18/77 (23%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + D+  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    69 FLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F ++
Sbjct:   129 ADVDGDGQVNYEEFVQV 145


>pdb|1AHR|  Calmodulin Mutant With A Two Residue Deletion In The Central Helix
            Calmodulin, Calcium-Binding Protein Mol_id: 1; Molecule:
            Calmodulin; Chain: Null; Engineered: Yes; Mutation: Del(T79),
            Del(D80)
            Length = 146

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 3.3, P = 0.96
 Identities = 21/72 (29%), Positives = 39/72 (54%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + DS EE  +   F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    68 FLTMMARKMKDSEEEIRE--AFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 125

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   126 ADIDGDGQVNYEEF 139


>gi|3243222 (AF069912) calmodulin [Xiphias gladius] >gi|3243224 (AF069913)
            calmodulin [Xiphias gladius]
            Length = 35

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 3.4, P = 0.97
 Identities = 12/33 (36%), Positives = 17/33 (51%), Frame = +3

Query:   183 DSGEEKADHALFQRLDKHGNGYLELKELGRALT 281
             D+  E+     F+  DK GNGY+   EL   +T
Sbjct:     3 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMT 35


>gnl|PID|e1264035 (AJ001093) calmodulin-like protein [Branchiostoma
            lanceolatum]
            Length = 225

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 3.5, P = 0.97
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D+ + K     F+  DK GNGY+   EL   +T++G  L    V+  + +
Sbjct:   152 FLTMMANKMKDTDQAKELSEAFKVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 211

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   212 ADIDGDGQVNYEEF 225


>gi|162030 (K02944) calmodulin A [Trypanosoma brucei] >gi|162031 (K02944)
           calmodulin B [Trypanosoma brucei] >gi|162032 (K02944) calmodulin C
           [Trypanosoma brucei]
           Length = 149

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 3.5, P = 0.97
 Identities = 20/77 (25%), Positives = 39/77 (50%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + DS  E+     F+  DK GNG+    EL   +T++G  L    V+  + +
Sbjct:    69 FLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFNSAAELRHIMTNLGEKLTDEEVDEMIRE 128

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   129 ADVDGDGQINYEEFVKM 145


>gnl|PID|d1027201 (AB009466) 155aa long hypothetical protein [Pyrococcus
            horikoshii] >gnl|PID|d1030056 (AP000001) 155aa long hypothetical
            protein [Pyrococcus horikoshii]
            Length = 155

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 3.9, P = 0.98
 Identities = 20/50 (40%), Positives = 30/50 (60%), Frame = +3

Query:   186 SGEEKADHALFQRLDKHGNGYLELKELGRALTDMGLPASAVENAMEKYER 335
             +G ++ D  + + L K  N  + L ELGR +   GL ASAV+N +EK E+
Sbjct:     2 AGIDEIDEVIVRELRK--NSRITLTELGRKV---GLTASAVKNRIEKLEK 46


>sp|P13833|MLR_DICDI MYOSIN REGULATORY LIGHT CHAIN (RMLC) >pir||A30938 myosin
            regulatory light chain - slime mold (Dictyostelium discoideum)
            >gi|167833 (M25251) regulatory myosin light chain [Dictyostelium
            discoideum]
            Length = 161

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 4.3, P = 0.99
 Identities = 18/55 (32%), Positives = 27/55 (49%), Frame = +3

Query:   126 GTIGIMTGLFLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG 290
             G IG     F+ M    +  +  E+     F+  D  GNGY+  K+L +ALT +G
Sbjct:    74 GAIGFPE--FMSMMSRRMKQTSNEQILMNAFKTFDPEGNGYILTKDLSKALTTLG 126


>gnl|PID|d1014427 (D88976) troponin C [Branchiostoma lanceolatum]
            >gnl|PID|d1014429 (D88978) troponin C [Branchiostoma lanceolatum]
            Length = 164

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 4.6, P = 0.99
 Identities = 25/81 (30%), Positives = 44/81 (54%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKAD---HALFQRLDKHGNGYLELKELGRALTD--MG--LPASAVE 311
             FL M    + DS  E  D    A F+ LDK+G+G+++  E  RAL     G  L    + 
Sbjct:    76 FLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEF-RALASECAGDDLTDDELH 134

Query:   312 NAMEKYE--RNSQLDFKQFQKI 371
               M++Y+  R+ + D++++++I
Sbjct:   135 EFMDEYDGNRDGRFDYEEWKEI 156


>sp|P41041|CALM_PNECA CALMODULIN >pir||JN0722 calmodulin - Pneumocystis carinii
            >gi|169404 (L05572) calmodulin [Pneumocystis carinii]
            Length = 151

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 4.9, P = 0.99
 Identities = 20/77 (25%), Positives = 36/77 (46%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + D   E+     F+  DK GNG +   EL   +T++G  L    V+  + +
Sbjct:    71 FLAMMARKMKDVDSEEEIREAFKVFDKDGNGIISAAELRHVMTNLGEKLTDEEVDEMIRE 130

Query:   327 YERNSQ--LDFKQFQKI 371
              + +    +D+ +F K+
Sbjct:   131 ADVDGDGVIDYSEFVKM 147


>sp|P05932|CALL_ARBPU CALMODULIN BETA >pir||S02691 calmodulin B - sea urchin
            (Arbacia punctulata) (fragment)
            Length = 138

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 5.0, P = 0.99
 Identities = 18/74 (24%), Positives = 38/74 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL M    + ++  E+     F+  DK GNG++   EL   +T++G  L    V+  + +
Sbjct:    58 FLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 117

Query:   327 --YERNSQLDFKQF 362
                + + Q+++++F
Sbjct:   118 ADIDGDGQVNYEEF 131


>gi|2267084 (AF007889) calmodulin [Symbiodinium microadriaticum]
            Length = 138

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 5.0, P = 0.99
 Identities = 18/77 (23%), Positives = 40/77 (51%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + D+  E+     F+  D+ GNG++   EL   +T++G  L    V+  + +
Sbjct:    58 FLSLMARKMKDTDTEEELIEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 117

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   118 ADVDGDGQINYEEFVKM 134


>pir||JC1310 calmodulin-related calcium-binding protein - Stylonychia lemnae
            (clone 719) (SGC5)
            Length = 69

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 5.7, P = 1.0
 Identities = 11/26 (42%), Positives = 16/26 (61%), Frame = +3

Query:   216 FQRLDKHGNGYLELKELGRALTDMGL 293
             F+  DK G+G +  KELG  +  +GL
Sbjct:    17 FKMFDKDGDGTITAKELGIVMRQLGL 42


>sp|P25070|TCH2_ARATH CALMODULIN-RELATED PROTEIN 2, TOUCH-INDUCED >gi|2583169
            (AF026473) calmodulin-related protein [Arabidopsis thaliana]
            Length = 161

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 5.8, P = 1.0
 Identities = 20/54 (37%), Positives = 32/54 (59%), Frame = +3

Query:   213 LFQRLDKHGNGYL---ELKELGRALTDMGLPASAVENAMEKYER--NSQLDFKQF 362
             +FQR DK+G+G +   ELKE+ RAL+    P   V   M++++   N  +D  +F
Sbjct:    21 VFQRFDKNGDGKISVDELKEVIRALSPTASPEETV-TMMKQFDLDGNGFIDLDEF 74


>gnl|PID|e327459 (Z97336) calmodulin [Arabidopsis thaliana]
            Length = 151

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 6.5, P = 1.0
 Identities = 20/77 (25%), Positives = 38/77 (49%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    L +S  E+     F+  DK  NGY+   EL   + ++G  L    VE  +++
Sbjct:    70 FLNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQMIKE 129

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++ +F K+
Sbjct:   130 ADLDGDGQVNYDEFVKM 146


>gnl|PID|e223522 (Z69663) F48F7.1 [Caenorhabditis elegans]
            Length = 70

  Minus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 7.7, P = 1.0
 Identities = 13/47 (27%), Positives = 22/47 (46%), Frame = -1

Query:   321 PWRFQQRLPADPYPSAPSLIPSAP----NSHCRVCPSAGTTRGRPFP 193
             P      +   P  +  S +PS P    ++  +V P++G T+  PFP
Sbjct:     9 PGVMNSTIQQQPQSATSSFLPSGPISSTSTSSQVVPTSGATQQPPFP 55


>gi|3153655 (AF056851) genome polyprotein [Hepatitis C virus]
            Length = 61

  Minus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 7.7, P = 1.0
 Identities = 14/36 (38%), Positives = 18/36 (50%), Frame = -1

Query:   303 RLPADPYPSAPSLIPSAPNSHCRVCPSA-GTTRGRP 199
             R P  P    PSL P  P +   + P+A GT+ G P
Sbjct:    26 RRPIPPVGLRPSLRPGRPKTSSLLTPTAAGTSTGLP 61


>gi|406661 (Z26706) Calcium-binding protein [Arabidopsis thaliana]
           Length = 101

  Plus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 7.7, P = 1.0
 Identities = 18/68 (26%), Positives = 34/68 (50%), Frame = +3

Query:   189 GEEKAD-HALFQRLDKHGNGYLELKELGRALTDMGLPASA----VENAMEKYERN--SQL 347
             G  ++D    F   D+ G+G++   EL + L  +GLP +     VE  +   + N   ++
Sbjct:    26 GSPESDLEXAFNVFDEDGDGFISAVELQKVLKKLGLPEAGEIEQVEKMIVSVDSNHDGRV 85

Query:   348 DFKQFQKI 371
             DF +F+ +
Sbjct:    86 DFFEFKNM 93


>gnl|PID|d1014428 (D88977) troponin C [Branchiostoma floridae]
            Length = 164

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 8.1, P = 1.0
 Identities = 24/81 (29%), Positives = 44/81 (54%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKAD---HALFQRLDKHGNGYLELKELGRALTD--MG--LPASAVE 311
             FL M    + DS  E  D    A F+ LDK+G+G+++  E  RAL     G  L    + 
Sbjct:    76 FLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEF-RALASECAGDDLTDDELH 134

Query:   312 NAMEKYE--RNSQLDFKQFQKI 371
               M++Y+  R+ + D+++++++
Sbjct:   135 EFMDEYDGNRDGRFDYEEWKEL 156


>gnl|PID|e237261 (Z71757) calmodulin-domain protein kinase [Eimeria tenella]
            Length = 487

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 8.3, P = 1.0
 Identities = 20/68 (29%), Positives = 37/68 (54%), Frame = +3

Query:   180 IDSGEEKAD-HALFQRLDKHGNGYLELKELGRALTDM----GLPASAVENAMEKYERNSQ 344
             + + EE  + + +FQR+DK+G+G L+ +EL     ++    G   SA++ +  ++E    
Sbjct:   328 LTTNEETVELNKIFQRMDKNGDGQLDKQELMEGYVELMKLKGEDVSALDQSAIEFEVEQV 387

Query:   345 LDFKQFQK 368
             LD   F K
Sbjct:   388 LDAVAFDK 395


>gnl|PID|e238792 (X97612) CaMF-1 [Fagus sylvatica]
            Length = 148

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 8.7, P = 1.0
 Identities = 17/53 (32%), Positives = 29/53 (54%), Frame = +3

Query:   216 FQRLDKHGNGYLELKELGRALTDMGL-PASA-VENAMEKYER--NSQLDFKQF 362
             F   DK G+G +  KELG  +  +G  P  A +++ + + +R  N  +DF +F
Sbjct:    17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDRDGNGTIDFPEF 69


>sp|P29289|TPC1_HOMAM TROPONIN C, ISOFORM 1 >pir||S18394 troponin C isoform 1 -
            American lobster >bbs|61761 troponin C isoform 1,  TnC-1 [lobsters,
            Peptide, 150 aa]
            Length = 150

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 9.0, P = 1.0
 Identities = 24/82 (29%), Positives = 40/82 (48%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHAL---FQRLDKHGNGYLE---LKELGRALTDMGLPASAVEN 314
             F  +    L +  EE     L   F+  D+ GNGY+    LKE+ R L D  L    +++
Sbjct:    68 FAALAAKFLSEEDEEALKKELKEAFRIYDRGGNGYITVHTLKEILREL-DNKLTEDNLDS 126

Query:   315 AMEKYERNSQ--LDFKQFQKIRN 377
              +E+ + +    +DF +F K+ N
Sbjct:   127 IIEEVDEDGSGTIDFNEFMKMMN 149


>gi|170076 (L01433) calmodulin [Glycine max] >prf||2121384D calmodulin [Glycine
           max]
           Length = 150

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 9.0, P = 1.0
 Identities = 20/82 (24%), Positives = 40/82 (48%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMG--LPASAVENAMEK 326
             FL +    + D+  E+     F+  DK  NGY+   EL   + ++G  L    VE  +++
Sbjct:    69 FLSLMAKKVKDTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKE 128

Query:   327 --YERNSQLDFKQFQKIRNDAR 386
                + + Q+++++F K+    R
Sbjct:   129 ADLDGDGQVNYEEFVKMMMTVR 150


>gi|587454 (X80231) calmodulin [Sauroleishmania tarentolae]
           Length = 140

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 9.9, P = 1.0
 Identities = 18/77 (23%), Positives = 39/77 (50%), Frame = +3

Query:   153 FLGMFPLLLIDSGEEKADHALFQRLDKHGNGYLELKELGRALTDMGLPAS--AVENAMEK 326
             FL +    + DS  E+     F+  DK GNG++   E+   +T +G   +   V+  + +
Sbjct:    60 FLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAEVRHVMTKLGEKRTDEEVDEMIRE 119

Query:   327 --YERNSQLDFKQFQKI 371
                + + Q+++++F K+
Sbjct:   120 ADVDGDGQINYEEFVKM 136


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.97
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.322   0.140   0.399  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.345   0.153   0.569  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.361   0.154   0.608  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.338   0.146   0.513  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.345   0.148   0.466  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.336   0.142   0.494  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      132       132       10.  70 3 1000 22  0.11    33
                                                     30  0.096   36
   +2      0      132       132       10.  70 3 1000 22  0.11    33
                                                     30  0.096   36
   +1      0      133       133       10.  70 3 1000 22  0.11    33
                                                     30  0.097   36
   -1      0      133       133       10.  70 3 1000 22  0.11    33
                                                     30  0.097   36
   -2      0      132       132       10.  70 3 1000 22  0.11    33
                                                     30  0.096   36
   -3      0      132       132       10.  70 3 1000 22  0.11    33
                                                     30  0.096   36


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  100
  No. of states in DFA:  327 (32 KB)
  Total size of DFA:  41 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  31.63u 1.29s 32.92t  Elapsed: 00:00:07
  Total cpu time:  31.74u 7.12s 38.86t  Elapsed: 00:00:13
  Start:  Thu Sep 24 15:26:45 1998   End:  Thu Sep 24 15:26:58 1998

Date: 16:21:1 on Sun 17 Dec 117.