blastx_gbnr_files/1824310_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1824310
        (357 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|1575578           (U67196) histidine protein kinase... +3   117  1.2e-05   1
A gi|924921            (U27456) branched-chain alpha-ket... +3    90  3.5e-05   2
A pir||A42924          [3-methyl-2-oxobutanoate dehydrog... +3    90  4.3e-05   2
A sp|O14874|BCKD_HUMAN [3-METHYL-2-OXOBUTANOATE DEHYDROG... +3    90  4.3e-05   2
A gi|2809220           (AF043070) branched chain alpha k... +3    90  4.3e-05   2
A sp|Q00972|BCKD_RAT   [3-METHYL-2-OXOBUTANOATE DEHYDROG... +3    90  4.3e-05   2
A bbs|110255           branched-chain alpha-ketoacid deh... +3    90  5.8e-05   2
A sp|Q16654|PDK4_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3   107  0.00014   1
A gnl|PID|e1285215     (AJ001418) pyruvate dehydrogenase... +3   105  0.00023   1
A gi|2772938           (AF034577) pyruvate dehydrogenase... +3   104  0.00030   1
A gi|3298574           (AF020845) pyruvate dehydrogenase... +3   104  0.00030   1
A sp|Q15120|PDK3_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3   103  0.00037   1
A sp|P40530|YIE2_YEAST HYPOTHETICAL 45.4 KD PROTEIN IN C... +3   102  0.00046   1
A sp|Q63065|PDK1_RAT   [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3   101  0.00068   1
A sp|Q15118|PDK1_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3   101  0.00068   1
A sp|Q64536|PDK2_RAT   [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3    99  0.0010    1
A sp|Q15119|PDK2_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3    99  0.0010    1
A gi|2801651           (AF042096) putative sensor protei... +3   103  0.0010    1
A sp|P37461|HYDH_SALTY SENSOR PROTEIN HYDH >pir||S19605 ... +3    92  0.0017    1
A gnl|PID|d1018731     (D90910) sensory transduction his... +3    98  0.0039    1
A gnl|PID|d1017778     (D90902) sensory transduction his... +3    96  0.0041    1
A sp|O02623|PDK_ASCSU  [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3    93  0.0044    1
A gi|2182835           (U81166) histidine kinase LlkinA ... +3    94  0.0046    1
A gnl|PID|d1018292     (D90907) sensory transduction his... +3    97  0.0053    1
A gi|461403            (L29642) sensor kinase [Pseudomon... +3    92  0.0092    1
A sp|P91622|PDK_DROME  [PYRUVATE DEHYDROGENASE(LIPOAMIDE... +3    90  0.0097    1
A gnl|PID|d1011472     (D64006) sensory transduction his... +3    89  0.012     1
A sp|P37894|PLEC_CAUCR NON-MOTILE AND PHAGE-RESISTANCE P... +3    92  0.015     1
A sp|Q02332|PDK_CAEEL  PROBABLE [PYRUVATE DEHYDROGENASE(... +3    88  0.015     1
A gnl|PID|d1018956     (D90912) sensory transduction his... +3    89  0.023     1
A gi|3243053           (AF071208) transition protein 2 [... -1    82  0.028     1
A gi|1401270           (U59741) RcaE [Fremyella diplosip... +3    88  0.029     1
A gi|2353767           (AF016236) DMSO/TMAO-sensor kinas... +3    89  0.029     1
A sp|P54302|LUXQ_VIBHA SENSOR PROTEIN LUXQ >pir||S49046 ... +3    89  0.031     1
A gnl|PID|e1309118     (Y16022) tat [Human immunodeficie... -1    76  0.033     1
A gnl|PID|e1309163     (Y16031) tat [Human immunodeficie... -1    76  0.033     1
A gnl|PID|d1011961     (D78193) homologous to sp:PHOR_BA... +3    87  0.034     1
A gnl|PID|d1025876     (AB006362) similar to sln1p of S.... +3    90  0.041     1
A prf||1505375A        vir gene [Bordetella pertussis]      +3    85  0.047     1
A gi|2961066           (AF013273) histidine kinase 1; Ca... +3    90  0.076     1
A gnl|PID|e1310291     (AL031031) putative sensory histi... +3    88  0.089     1
A gnl|PID|d1010873     (D64000) sensory transduction his... +3    86  0.090     1
A pir||A33862          hydH protein - Escherichia coli (... +3    79  0.13      1
A gnl|PID|e323041      (Z97065) RisS protein [Bordetella... +3    84  0.19      1
A gnl|PID|e1309452     (AJ224802) RisS protein [Bordetel... +3    84  0.19      1
A sp|P16575|BVGS_BORPE VIRULENCE SENSOR PROTEIN BVGS PRE... +3    85  0.23      1
A sp|P26762|BVGS_BORBR VIRULENCE SENSOR PROTEIN BVGS PRE... +3    85  0.23      1
A sp|P40330|BVGS_BORPA VIRULENCE SENSOR PROTEIN BVGS PRE... +3    85  0.23      1
A gnl|PID|d1010968     (D64001) sensory transduction his... +3    84  0.28      1
A sp|Q53135|CHEA_RHOSH CHEMOTAXIS PROTEIN CHEA >pir||S49... +3    84  0.28      1
A sp|Q03228|DIVJ_CAUCR HISTIDINE PROTEIN KINASE DIVJ >gi... +3    83  0.36      1
A pir||A46414          histidine protein kinase divJ - C... +3    83  0.36      1
A gi|145519            (M13463) cheA peptide [Escherichi... +3    79  0.44      1
A gi|1572605           (U69111) putative histidine kinas... +3    63  0.56      1
A pir||S11913          hypothetical protein 2 - Xanthomo... +3    62  0.65      1
A sp|P15939|NODV_BRAJA NODULATION PROTEIN V >pir||A35989... +3    82  0.67      1
A gi|2649119           (AE001003) signal-transducing his... +3    80  0.68      1
A gi|1825465           (U57900) tutC [Thauera T1]           +3    82  0.71      1
A gi|3420757           (AF079544) orf175 [Mycobacterium ... -1    61  0.76      1
A gnl|PID|e1286185     (AL022374) putative two-component... +3    80  0.79      1
A gi|152215            (J03174) fixL protein (5' end pot... +3    79  0.83      1
A sp|P14377|HYDH_ECOLI SENSOR PROTEIN HYDH >gi|396342 (U... +3    79  0.83      1
A gnl|PID|d1018819     (D90911) sensory transduction his... +3    80  0.84      1
A gi|155840            (M10845) chorion protein [Anthera... +2    60  0.84      1
A sp|P23222|FIXL_BRAJA SENSOR PROTEIN FIXL >gi|39523 (X5... +3    79  0.86      1
A sp|P10955|FIXL_RHIME SENSOR PROTEIN FIXL >pir||S39984 ... +3    79  0.86      1
A pir||S13330          fixL protein - Bradyrhizobium jap... +3    79  0.86      1
A pir||QRECCS          chemotaxis cheA protein - Escheri... +3    79  0.89      1
A gnl|PID|d1011085     (D64002) sensory transduction his... +3    78  0.90      1
A pir||A49591          spike protein - porcine epidemic ... +2    59  0.91      1
A gi|145529            (M34669) CheA protein (alt.) [Esc... +3    79  0.93      1
A sp|P07363|CHEA_ECOLI CHEMOTAXIS PROTEIN CHEA >gnl|PID|... +3    79  0.93      1
A gi|1498305           (U51927) SpiR [Salmonella typhimu... +3    79  0.97      1
A gi|7428              (X58114) testis-specific RNA [Dro... +2    57  0.99      1
A sp|P45609|PHOR_SHIDY PHOSPHATE REGULON SENSOR PROTEIN ... +3    76  0.991     1
A sp|P08400|PHOR_ECOLI PHOSPHATE REGULON SENSOR PROTEIN ... +3    76  0.991     1
A gi|1458240           (U64833) coded for by C. elegans ... -3    76  0.991     1
A gi|3282775           (AF043352) histidine protein kina... +3    76  0.991     1
A sp|Q11155|SEX3_MYCTU SENSOR-LIKE HISTIDINE KINASE SENX... +3    75  0.998     1
A gnl|PID|e1192298     (Y13627) SenX3 [Mycobacterium bov... +3    75  0.998     1
A gnl|PID|d1010630     (D63959) immunoglobulin lambda ch... +2    66  0.999     1
A sp|P09384|CHEA_SALTY CHEMOTAXIS PROTEIN CHEA >pir||A28... +3    76  0.9997    1
A gi|2460283           (AF024654) hybrid histidine kinas... +3    79  0.9999    1
A sp|P77510|CITA_ECOLI SENSOR KINASE CITA >gi|1778536 (U... +3    75  0.99992   1
A gnl|PID|d1017013     (D90870) CHORION CLASS HIGH-CYSTE... +2    54  0.99993   1
A gi|196602            (M35646) immunoglobulin kappa-cha... -1    43  0.99994   2



>gi|1575578 (U67196) histidine protein kinase [Thermotoga maritima]
            Length = 412

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 1.2e-05, P = 1.2e-05
 Identities = 26/74 (35%), Positives = 42/74 (56%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             VVV+V D   GI  +A  +++   +  + +   KMGG G+GL   K  +D  GG+I++ +
Sbjct:   337 VVVEVEDTGPGIPKEAQSRIFEKFYRVDKARSRKMGGTGLGLTIVKTIVDKHGGKIEVES 396

Query:   189 TEGVGTTVRVIFPK 230
                 GT +RV+ PK
Sbjct:   397 EINQGTLMRVLLPK 410


>gi|924921 (U27456) branched-chain alpha-ketoacid dehydrogenase kinase [Rattus
           norvegicus]
           Length = 382

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 3.5e-05, Sum P(2) = 3.5e-05
 Identities = 16/34 (47%), Positives = 22/34 (64%), Frame = +3

Query:   111 MGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTV 212
             M GFG GLP S+ Y +  GG + L + +G+GT V
Sbjct:   333 MHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDV 366

 Score = 42 (14.8 bits), Expect = 3.5e-05, Sum P(2) = 3.5e-05
 Identities = 7/27 (25%), Positives = 18/27 (66%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT 89
             +++ ++D  GGIA   ++++  + +TT
Sbjct:   279 LIIRISDRGGGIAHKDLDRVMDYHFTT 305


>pir||A42924 [3-methyl-2-oxobutanoate dehydrogenase (lipoamide)] kinase (EC
            2.7.1.115) - rat >bbs|110254 branched-chain alpha-ketoacid
            dehydrogenase kinase 44 kda isoform [rats, lung, heart, Peptide
            Mitochondrial, 412 aa] >gi|203153 (M93271) branched-chain
            alpha-ketoacid dehydrogenase kinase [Rattus norvegicus]
            Length = 412

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 16/34 (47%), Positives = 22/34 (64%), Frame = +3

Query:   111 MGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTV 212
             M GFG GLP S+ Y +  GG + L + +G+GT V
Sbjct:   363 MHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDV 396

 Score = 42 (14.8 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 7/27 (25%), Positives = 18/27 (66%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT 89
             +++ ++D  GGIA   ++++  + +TT
Sbjct:   309 LIIRISDRGGGIAHKDLDRVMDYHFTT 335


>sp|O14874|BCKD_HUMAN [3-METHYL-2-OXOBUTANOATE DEHYDROGENASE (LIPOAMIDE)]
            KINASE PRECURSOR (BRANCHED-CHAIN ALPHA-KETOACID DEHYDROGENASE
            KINASE) (BCKDHKIN) >gi|2583173 (AF026548) branched chain
            alpha-ketoacid dehydrogenase kinase precursor [Homo sapiens]
            Length = 412

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 16/34 (47%), Positives = 22/34 (64%), Frame = +3

Query:   111 MGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTV 212
             M GFG GLP S+ Y +  GG + L + +G+GT V
Sbjct:   363 MHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDV 396

 Score = 42 (14.8 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 7/27 (25%), Positives = 18/27 (66%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT 89
             +++ ++D  GGIA   ++++  + +TT
Sbjct:   309 LIIRISDRGGGIAHKDLDRVMDYHFTT 335


>gi|2809220 (AF043070) branched chain alpha ketoacid dehydrogenase kinase;
            mitochondrial serine protein kinase; BCKD-K [Mus musculus]
            Length = 412

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 16/34 (47%), Positives = 22/34 (64%), Frame = +3

Query:   111 MGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTV 212
             M GFG GLP S+ Y +  GG + L + +G+GT V
Sbjct:   363 MHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDV 396

 Score = 42 (14.8 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 7/27 (25%), Positives = 18/27 (66%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT 89
             +++ ++D  GGIA   ++++  + +TT
Sbjct:   309 LIIRISDRGGGIAHKDLDRVMDYHFTT 335


>sp|Q00972|BCKD_RAT [3-METHYL-2-OXOBUTANOATE DEHYDROGENASE (LIPOAMIDE)] KINASE
            PRECURSOR (BRANCHED-CHAIN ALPHA-KETOACID DEHYDROGENASE KINASE)
            (BCKDHKIN)
            Length = 412

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 16/34 (47%), Positives = 22/34 (64%), Frame = +3

Query:   111 MGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTV 212
             M GFG GLP S+ Y +  GG + L + +G+GT V
Sbjct:   363 MHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDV 396

 Score = 42 (14.8 bits), Expect = 4.3e-05, Sum P(2) = 4.3e-05
 Identities = 7/27 (25%), Positives = 18/27 (66%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT 89
             +++ ++D  GGIA   ++++  + +TT
Sbjct:   309 LIIRISDRGGGIAHKDLDRVMDYHFTT 335


>bbs|110255 branched-chain alpha-ketoacid dehydrogenase kinase higher molecular
            weight isoform [rats, lung, heart, Peptide Mitochondrial, 461 aa]
            Length = 461

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 5.8e-05, Sum P(2) = 5.8e-05
 Identities = 16/34 (47%), Positives = 22/34 (64%), Frame = +3

Query:   111 MGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTV 212
             M GFG GLP S+ Y +  GG + L + +G+GT V
Sbjct:   412 MHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDV 445

 Score = 42 (14.8 bits), Expect = 5.8e-05, Sum P(2) = 5.8e-05
 Identities = 7/27 (25%), Positives = 18/27 (66%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT 89
             +++ ++D  GGIA   ++++  + +TT
Sbjct:   358 LIIRISDRGGGIAHKDLDRVMDYHFTT 384


>sp|Q16654|PDK4_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE ISOZYME 4
            PRECURSOR (PYRUVATE DEHYDROGENASE KINASE ISOFORM 4) >gi|1399197
            (U54617) pyruvate dehydrogenase kinase isoform 4 [Homo sapiens]
            >gi|1399210 (U54628) pyruvate dehydrogenase kinase isoform 4 [Homo
            sapiens] >gi|2337883 (AC002451) pyruvate dehydrogenase kinase
            isoform 4 [Homo sapiens]
            Length = 411

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 25/88 (28%), Positives = 48/88 (54%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSS--FDNK----MGGFGIGLPASKCYMDLWGG 170
             + + ++D  GG+    +++L+ + ++T  +   DN     + GFG GLP S+ Y   + G
Sbjct:   287 LTIKISDRGGGVPLRIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQG 346

Query:   171 RIDLYTTEGVGTTVRVIFPKAPTEVFVPK 257
              ++LY+  G GT   +I+ KA +   + K
Sbjct:   347 DLNLYSLSGYGTDA-IIYLKALSSESIEK 374


>gnl|PID|e1285215 (AJ001418) pyruvate dehydrogenase kinase-like protein [Mus
            musculus]
            Length = 412

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.00023, P = 0.00023
 Identities = 26/88 (29%), Positives = 47/88 (53%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSS--FDNK----MGGFGIGLPASKCYMDLWGG 170
             + + ++D  GG+     ++L+ + ++T  +   DN     + GFG GLP S+ Y   + G
Sbjct:   287 LTIKISDRGGGVPLRITDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQG 346

Query:   171 RIDLYTTEGVGTTVRVIFPKAPTEVFVPK 257
              ++LY+  G GT   +I+ KA +   V K
Sbjct:   347 DLNLYSMSGYGTDA-IIYLKALSSESVEK 374


>gi|2772938 (AF034577) pyruvate dehydrogenase kinase isoenzyme 4 [Rattus
            norvegicus]
            Length = 412

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 25/88 (28%), Positives = 47/88 (53%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSS--FDNK----MGGFGIGLPASKCYMDLWGG 170
             + + ++D  GG+     ++L+ + ++T  +   DN     + GFG GLP S+ Y   + G
Sbjct:   287 LTIKISDRGGGVPLRITDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQG 346

Query:   171 RIDLYTTEGVGTTVRVIFPKAPTEVFVPK 257
              ++LY+  G GT   +I+ KA +   + K
Sbjct:   347 DLNLYSMSGYGTDA-IIYLKALSSESIEK 374


>gi|3298574 (AF020845) pyruvate dehydrogenase kinase isoform 4 [Spermophilus
            tridecemlineatus]
            Length = 412

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 26/88 (29%), Positives = 47/88 (53%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSS--FDNK----MGGFGIGLPASKCYMDLWGG 170
             + + ++D  GG+     ++L+ + ++T  +   DN     + GFG GLP S+ Y   + G
Sbjct:   287 LTIKISDRGGGVPLRITDRLFSYMYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQG 346

Query:   171 RIDLYTTEGVGTTVRVIFPKAPTEVFVPK 257
              ++LY+  G GT   +I+ KA +   V K
Sbjct:   347 DLNLYSLSGYGTDA-IIYLKALSSESVEK 374


>sp|Q15120|PDK3_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE ISOZYME 3
            PRECURSOR (PYRUVATE DEHYDROGENASE KINASE ISOFORM 3) >pir||I70160
            pyruvate dehydrogenase kinase - human >gi|1088285 (L42452) pyruvate
            dehydrogenase kinase [Homo sapiens] >prf||2203383C pyruvate
            dehydrogenase kinase:ISOTYPE=3 [Homo sapiens]
            Length = 406

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.00037, P = 0.00037
 Identities = 26/78 (33%), Positives = 44/78 (56%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTT--NSSFDNK----MGGFGIGLPASKCYMDLWGGRI 176
             + ++D  GG+    +++L+ + ++T    S +      + GFG GLP S+ Y   + G +
Sbjct:   283 IKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDL 342

Query:   177 DLYTTEGVGTTVRVIFPKA 233
              LY+ EGVGT   VI+ KA
Sbjct:   343 KLYSMEGVGTDA-VIYLKA 360


>sp|P40530|YIE2_YEAST HYPOTHETICAL 45.4 KD PROTEIN IN CBR5-NOT3 INTERGENIC
            REGION >pir||S50696 hypothetical protein YIL042c - yeast
            (Saccharomyces cerevisiae) >gi|600006 (Z46861) unknown
            [Saccharomyces cerevisiae] >gi|763304 (Z47047) unknown
            [Saccharomyces cerevisiae]
            Length = 394

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.00046, P = 0.00046
 Identities = 27/86 (31%), Positives = 46/86 (53%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNS--SFD-----------NKMGGFGIGLPASKCYMDL 161
             + D  GGI P+    ++ + ++T++  S D           N + G G GLP  K Y++L
Sbjct:   302 IRDHGGGITPEVEALMFNYSYSTHTQQSADSESTDLPGEQINNVSGMGFGLPMCKTYLEL 361

Query:   162 WGGRIDLYTTEGVGTTVRVIFPKAPTE 242
             +GG+ID+ +  G GT V +   K P++
Sbjct:   362 FGGKIDVQSLLGWGTDVYIKL-KGPSK 387


>sp|Q63065|PDK1_RAT [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE ISOZYME 1
            PRECURSOR (PYRUVATE DEHYDROGENASE KINASE ISOFORM 1) (PDK P48)
            >pir||A49686 [pyruvate dehydrogenase (lipoamide)] kinase (EC
            2.7.1.99) - rat >gi|438874 (L22294) pyruvate dehydrogenase kinase
            kinase [Rattus norvegicus]
            Length = 434

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.00068, P = 0.00068
 Identities = 26/80 (32%), Positives = 44/80 (55%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT------NSSFDNKMGGFGIGLPASKCYMDLWGG 170
             + V ++D  GG+    +++L+ + ++T       +S    + GFG GLP S+ Y   + G
Sbjct:   310 LTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQG 369

Query:   171 RIDLYTTEGVGTTVRVIFPKA 233
              + LY+ EG GT   VI+ KA
Sbjct:   370 DLKLYSLEGYGTDA-VIYIKA 389


>sp|Q15118|PDK1_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE ISOZYME 1
            PRECURSOR (PYRUVATE DEHYDROGENASE KINASE ISOFORM 1) >pir||I55465
            pyruvate dehydrogenase kinase - human >gi|1088281 (L42450) pyruvate
            dehydrogenase kinase [Homo sapiens] >prf||2203383A pyruvate
            dehydrogenase kinase:ISOTYPE=1 [Homo sapiens]
            Length = 436

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.00069, P = 0.00068
 Identities = 26/80 (32%), Positives = 44/80 (55%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTT------NSSFDNKMGGFGIGLPASKCYMDLWGG 170
             + V ++D  GG+    +++L+ + ++T       +S    + GFG GLP S+ Y   + G
Sbjct:   312 LTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQG 371

Query:   171 RIDLYTTEGVGTTVRVIFPKA 233
              + LY+ EG GT   VI+ KA
Sbjct:   372 DLKLYSLEGYGTDA-VIYIKA 391


>sp|Q64536|PDK2_RAT [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE ISOZYME 2
            PRECURSOR (PYRUVATE DEHYDROGENASE KINASE ISOFORM 2) (PDK P45)
            >pir||A55305 [pyruvate dehydrogenase (lipoamide)] kinase (EC
            2.7.1.99) p45 chain precursor - rat >gi|694003 (U10357) pyruvate
            dehydrogenase kinase 2 subunit p45 [Rattus norvegicus]
            Length = 407

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.0010, P = 0.0010
 Identities = 24/77 (31%), Positives = 42/77 (54%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTTN-----SSFDNKMGGFGIGLPASKCYMDLWGGRID 179
             + ++D  GG+    +E+L+ + ++T       +    + GFG GLP S+ Y   + G + 
Sbjct:   286 IKMSDRGGGVPLRKIERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQ 345

Query:   180 LYTTEGVGTTVRVIFPKA 233
             L++ EG GT   VI+ KA
Sbjct:   346 LFSMEGFGTDA-VIYLKA 362


>sp|Q15119|PDK2_HUMAN [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE ISOZYME 2
            PRECURSOR (PYRUVATE DEHYDROGENASE KINASE ISOFORM 2) >pir||I70159
            pyruvate dehydrogenase kinase - human >gi|1088283 (L42451) pyruvate
            dehydrogenase kinase [Homo sapiens] >prf||2203383B pyruvate
            dehydrogenase kinase:ISOTYPE=2 [Homo sapiens]
            Length = 407

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.0010, P = 0.0010
 Identities = 24/77 (31%), Positives = 42/77 (54%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTTN-----SSFDNKMGGFGIGLPASKCYMDLWGGRID 179
             + ++D  GG+    +E+L+ + ++T       +    + GFG GLP S+ Y   + G + 
Sbjct:   286 IKMSDRGGGVPLRKIERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQ 345

Query:   180 LYTTEGVGTTVRVIFPKA 233
             L++ EG GT   VI+ KA
Sbjct:   346 LFSMEGFGTDA-VIYLKA 362


>gi|2801651 (AF042096) putative sensor protein [Bradyrhizobium japonicum]
            Length = 873

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.0010, P = 0.0010
 Identities = 25/73 (34%), Positives = 40/73 (54%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             VV  VTD+  GI  D  +K+  F W  + S  ++  G G+GL   + +++L GG++ + +
Sbjct:   792 VVFTVTDSGPGIPADMKDKV--FNWFESRSQGSRHRGAGLGLSLVRSFVELHGGKVRVDS 849

Query:   189 TEGVGTTVRVIFP 227
               G GT V   FP
Sbjct:   850 IVGRGTVVICDFP 862


>sp|P37461|HYDH_SALTY SENSOR PROTEIN HYDH >pir||S19605 hydrogenase regulatory
            protein hydH - Salmonella typhimurium (fragment) >gi|154141
            (M64988) ORF 1 [Salmonella typhimurium]
            Length = 208

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.0017, P = 0.0017
 Identities = 24/73 (32%), Positives = 38/73 (52%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             V++ VTD+  GIAPD +E ++   +TT      K  G G+GL   +  ++  GG I + +
Sbjct:   135 VIITVTDSGKGIAPDQLEAIFTPYFTT------KADGTGLGLAVVQNIIEQHGGAIKVKS 188

Query:   189 TEGVGTTVRVIFP 227
              EG G    +  P
Sbjct:   189 IEGKGAVFTIWLP 201


>gnl|PID|d1018731 (D90910) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 950

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.0039, P = 0.0039
 Identities = 27/69 (39%), Positives = 35/69 (50%), Frame = +3

Query:     3 THVVVDVTDAAGGIAPDAVEKLWLFGWTTN--SSFDNKMGGFGIGLPASKCYMDLWGGRI 176
             T +   VTD   G+ PD   KL  F W     +S   + GG G+GL  SK   +L GG I
Sbjct:   608 TKLQFSVTDTGIGLTPDQQSKL--FQWFNQGETSTSRQYGGTGLGLAISKSLTELMGGDI 665

Query:   177 DLYTTEGVGTT 209
              L +  G G+T
Sbjct:   666 WLESVVGQGST 676


>gnl|PID|d1017778 (D90902) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 661

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.0041, P = 0.0041
 Identities = 23/74 (31%), Positives = 39/74 (52%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             ++ ++ D   GI    +EK+  F      S    + G GIGL  ++  +  +GGRI++ +
Sbjct:   588 IIFEIQDYGIGIPETELEKI--FEPFQRGSNVGHIAGIGIGLTIARKLITFYGGRIEIKS 645

Query:   189 TEGVGTTVRVIFPK 230
               G GTTV ++ PK
Sbjct:   646 ELGQGTTVSLVIPK 659


>sp|O02623|PDK_ASCSU [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE PRECURSOR
            (PYRUVATE DEHYDROGENASE KINASE) >gi|1945392 (U94519) pyruvate
            dehydrogenase kinase [Ascaris suum]
            Length = 399

  Plus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.0044, P = 0.0044
 Identities = 20/81 (24%), Positives = 39/81 (48%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTT-----NSSFDNKMGGFGIGLPASKCYMDLWGGRID 179
             + ++D  GG++   +++L+ + ++T            + G+G GLP S+ Y   + G + 
Sbjct:   282 IKISDRGGGVSRTILDRLFTYMYSTAPPPPRDGTQPPLAGYGYGLPLSRLYARYFHGDMY 341

Query:   180 LYTTEGVGTTVRVIFPKAPTE 242
             L + EG GT   +     P E
Sbjct:   342 LVSMEGYGTDAMIFLKAIPVE 362


>gi|2182835 (U81166) histidine kinase LlkinA [Lactococcus lactis cremoris]
            Length = 490

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.0046, P = 0.0046
 Identities = 21/74 (28%), Positives = 41/74 (55%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             V+  V+D   GIA + +  L+   +  + + + ++GG G+GLP      + + G I++ +
Sbjct:   416 VITSVSDKGIGIAEEDINHLFERFFRADKARNREIGGTGLGLPILARLAENYQGEIEVSS 475

Query:   189 TEGVGTTVRVIFPK 230
               G+G+T  + FPK
Sbjct:   476 ELGIGSTFTLKFPK 489


>gnl|PID|d1018292 (D90907) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 998

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.0053, P = 0.0053
 Identities = 26/73 (35%), Positives = 40/73 (54%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLW-LFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLY 185
             + ++VTD   GIAP+   K++ +F  +   S   K GG G+GL  ++    L GG I L 
Sbjct:   757 LAIEVTDTGIGIAPEDQAKIFDVFTQSQGQS-TRKYGGTGLGLTITRRLTALLGGEISLS 815

Query:   186 TTEGVGTTVRVIFP 227
             +  G G+T  + FP
Sbjct:   816 SRLGEGSTFILHFP 829


>gi|461403 (L29642) sensor kinase [Pseudomonas fluorescens]
           Length = 575

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.0093, P = 0.0092
 Identities = 26/87 (29%), Positives = 42/87 (48%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLW-LFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTT 191
             VDV D+  G+A +   K++ LFG   N    ++  G GIGL   +  ++  GG + + + 
Sbjct:   354 VDVIDSGVGLAEEDQNKVFDLFGQAANQHGTHQRDGLGIGLSLVRQLVEAHGGSVSVQSK 413

Query:   192 E-GVGTTVRVIFPKAPTEVFVPKGTSS 269
               G G T  V+ P +      PK  +S
Sbjct:   414 GLGQGCTFTVLLPLSHPNDSAPKQPAS 440


>sp|P91622|PDK_DROME [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE PRECURSOR
            (PYRUVATE DEHYDROGENASE KINASE) (DMPDK) >gnl|PID|d1014420 (D88814)
            similar to pyruvate dehydrogenase kinase [Drosophila melanogaster]
            Length = 413

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.0098, P = 0.0097
 Identities = 26/80 (32%), Positives = 42/80 (52%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTN---SSFDNK---MGGFGIGLPASKCYMDLWGG 170
             + V ++D  GGI     ++L+ + ++T    S  D     + G+G GLP S+ Y   + G
Sbjct:   288 ICVKISDQGGGIPRSQTDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHG 347

Query:   171 RIDLYTTEGVGTTVRVIFPKA 233
              I L + EG GT   +I+ KA
Sbjct:   348 DIVLLSCEGFGTDA-IIYLKA 367


>gnl|PID|d1011472 (D64006) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 405

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.012, P = 0.012
 Identities = 23/71 (32%), Positives = 35/71 (49%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTE 194
             V VTD   GIA   +  ++   W  + S     GG G+GL  +K  ++L GG + + +T 
Sbjct:   333 VTVTDTGIGIAEGDLPYVFERFWRADKSRSRYSGGTGLGLAIAKRLVELQGGSLTVTSTL 392

Query:   195 GVGTTVRVIFP 227
             G G+  R   P
Sbjct:   393 GQGSEFRFSLP 403


>sp|P37894|PLEC_CAUCR NON-MOTILE AND PHAGE-RESISTANCE PROTEIN >pir||S27533
            histidine protein kinase pleC - Caulobacter crescentus >gi|144273
            (M91449) non-motile and phage-resistance protein [Caulobacter
            crescentus]
            Length = 842

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.015, P = 0.015
 Identities = 23/73 (31%), Positives = 36/73 (49%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             + V VTD   GIA + + +L        S F     G G+GL  +K  + +  G +++++
Sbjct:   755 IKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKTTQGTGLGLALTKSLITMHDGVLEMHS 814

Query:   189 TEGVGTTVRVIFP 227
             T G GTTV    P
Sbjct:   815 TPGEGTTVSFTLP 827


>sp|Q02332|PDK_CAEEL PROBABLE [PYRUVATE DEHYDROGENASE(LIPOAMIDE)] KINASE
            PRECURSOR (PYRUVATE DEHYDROGENASE KINASE) >pir||S44666 ZK370.5
            protein - Caenorhabditis elegans >gi|156505 (M98552) homology with
            phosphoprotein; putative [Caenorhabditis elegans]
            Length = 401

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.015, P = 0.015
 Identities = 21/81 (25%), Positives = 38/81 (46%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTT-----NSSFDNKMGGFGIGLPASKCYMDLWGGRID 179
             + + D  GG++   +E+L+ + ++T            + G+G GLP S+ Y   + G + 
Sbjct:   282 IKICDRGGGVSRTILERLYNYMYSTAPPPPRDGTQAPLAGYGYGLPLSRLYARYFLGDLF 341

Query:   180 LYTTEGVGTTVRVIFPKAPTE 242
             L + EG GT   +     P E
Sbjct:   342 LVSMEGHGTDACIYLKAVPVE 362


>gnl|PID|d1018956 (D90912) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 674

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.024, P = 0.023
 Identities = 22/70 (31%), Positives = 36/70 (51%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V D   G+  + + KL+      +SS   K GG G+GL  ++ +  + GG I L +  GV
Sbjct:   595 VKDTGIGLTEEQMSKLFQPFTQADSSTTRKYGGTGLGLAITRKFCQMMGGDIYLTSEIGV 654

Query:   201 GTTVRVIFPK 230
             G++  +  PK
Sbjct:   655 GSSFTIKLPK 664


>gi|3243053 (AF071208) transition protein 2 [Canis familiaris]
            Length = 129

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.028, P = 0.028
 Identities = 24/66 (36%), Positives = 36/66 (54%), Frame = -1

Query:   195 PLSYTS--LSSRPRG-PCNIWRQASRCQS-RPFCCQRKSLSSSQKAKVSPR-HQERYHPP 31
             P+++T    +SRP+G  C+    +S CQ+    C Q +S S S     S   HQ +   P
Sbjct:     9 PITHTQPHSNSRPQGHTCSQCTCSSHCQTCSQSCSQSRSSSQSPTGHHSSSGHQSQ--SP 66

Query:    30 HPSHPPQH 7
             HP+ PP+H
Sbjct:    67 HPTLPPRH 74


>gi|1401270 (U59741) RcaE [Fremyella diplosiphon]
            Length = 655

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.029, P = 0.029
 Identities = 24/73 (32%), Positives = 35/73 (47%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             VV  V D   GI  D +E+++      +SS   K GG G+GL   +  ++   GRI   +
Sbjct:   575 VVFRVRDEGQGIPADQLERIFERFQQVDSSDSRKKGGTGLGLTICRKIIEQHNGRIWAES 634

Query:   189 TEGVGTTVRVIFP 227
             T G G+T     P
Sbjct:   635 TPGCGSTFAFTLP 647


>gi|2353767 (AF016236) DMSO/TMAO-sensor kinase [Rhodobacter sphaeroides]
            Length = 815

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.030, P = 0.029
 Identities = 22/72 (30%), Positives = 38/72 (52%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V+D   GIA + +E+++     ++SS   + GG G+GL   +      GGR+D+ +T G 
Sbjct:   468 VSDTGPGIAAEKLEEIFKPYIQSDSSISRRHGGTGLGLAICRRLAGHLGGRLDVRSTPGF 527

Query:   201 GTTVRVIFPKAP 236
             G+   +    AP
Sbjct:   528 GSRFTLEVALAP 539


>sp|P54302|LUXQ_VIBHA SENSOR PROTEIN LUXQ >pir||S49046 luxQ protein - Vibrio
            harveyi >gi|459205 (U07069) LuxQ [Vibrio harveyi]
            Length = 859

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.032, P = 0.031
 Identities = 21/73 (28%), Positives = 40/73 (54%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             +VV++TD   GI  D +++++       S+   + GG G+GL   K  +D+  G + + +
Sbjct:   636 LVVELTDTGIGIESDKLDQMFEPFVQEESTTTREYGGSGLGLTIVKNLVDMLEGDVQVRS 695

Query:   189 TEGVGTTVRVIFP 227
             ++G GTT  +  P
Sbjct:   696 SKGGGTTFVITLP 708


>gnl|PID|e1309118 (Y16022) tat [Human immunodeficiency virus type 1]
            Length = 70

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.034, P = 0.033
 Identities = 19/54 (35%), Positives = 22/54 (40%), Frame = -1

Query:   171 SRPRGPCNIWRQASRCQSRPFCCQRKSLSSSQKAKVSPRHQERYHPPHPSHPPQ 10
             S+P+ PCN     S C     C  RK L  S   K   RH    HP H    P+
Sbjct:    16 SQPQTPCNTCYCKSCCYHCYVCFTRKGLGISYGRKKRRRHAAASHPVHQDPVPE 69


>gnl|PID|e1309163 (Y16031) tat [Human immunodeficiency virus type 1]
            Length = 70

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.034, P = 0.033
 Identities = 20/63 (31%), Positives = 25/63 (39%), Frame = -1

Query:   198 PPLSYTSLSSRPRGPCNIWRQASRCQSRPFCCQRKSLSSSQKAKVSPRHQERYHPPHPSH 19
             PP  +    S+P+ PCN       C     C  RK L  S   K   R    +HP H   
Sbjct:     9 PPWHHPG--SQPQNPCNKCYCKKCCYHCYVCFTRKGLGISYGRKKRRRTAAAHHPDHKDL 66

Query:    18 PPQ 10
             PP+
Sbjct:    67 PPE 69


>gnl|PID|d1011961 (D78193) homologous to sp:PHOR_BACSU [Bacillus subtilis]
            >gnl|PID|e1184766 (Z99124) similar to two-component sensor
            histidine kinase [YycF] [Bacillus subtilis]
            Length = 611

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.034, P = 0.034
 Identities = 23/71 (32%), Positives = 35/71 (49%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTE 194
             + V D   GI    VEK++   +  + +   K+GG G+GL  +K  +   GG I   + E
Sbjct:   529 ISVKDEGIGIPKKDVEKVFDRFYRVDKARTRKLGGTGLGLAIAKEMVQAHGGDIWADSIE 588

Query:   195 GVGTTVRVIFP 227
             G GTT+    P
Sbjct:   589 GKGTTITFTLP 599


>gnl|PID|d1025876 (AB006362) similar to sln1p of S. cerevisiae [Candida
            albicans]
            Length = 1377

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.042, P = 0.041
 Identities = 24/83 (28%), Positives = 39/83 (46%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             + ++VTD   GI P   EK++      + +     GG G+GL   +    +  G + L +
Sbjct:   973 IQIEVTDTGPGIEPALQEKVFEPFVQGDQTLSRSYGGTGLGLSICRQLATMMHGTLTLKS 1032

Query:   189 TEGVGTTVRVIFPKAPT-EVFVP 254
             T G G+T  +  P   T E+ VP
Sbjct:  1033 TIGKGSTFTLTLPLPQTGEIMVP 1055


>prf||1505375A vir gene [Bordetella pertussis]
            Length = 327

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.048, P = 0.047
 Identities = 24/72 (33%), Positives = 36/72 (50%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWL-FGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDL 182
             HV   V+D   GI+     +L+  F     S+      G G+GL  S+  ++L GG + +
Sbjct:    45 HVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGPAPGTGLGLSISRRLVELMGGTLVM 104

Query:   183 YTTEGVGTTVRV 218
              +  GVGTTV V
Sbjct:   105 RSAPGVGTTVSV 116


>gi|2961066 (AF013273) histidine kinase 1; CaHK1 [Candida albicans]
            Length = 2471

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.079, P = 0.076
 Identities = 24/68 (35%), Positives = 35/68 (51%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTE 194
             V V D+  GI+  +  K++      + S   + GG G+GL  SK   +L GG I   + E
Sbjct:  2152 VSVEDSGIGISKKSQNKVFGAFSQVDGSARREYGGSGLGLAISKKLTELMGGTIRFESEE 2211

Query:   195 GVGTTVRV 218
             G+GTT  V
Sbjct:  2212 GIGTTFYV 2219


>gnl|PID|e1310291 (AL031031) putative sensory histidine kinase [Streptomyces
            coelicolor]
            Length = 1829

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.093, P = 0.089
 Identities = 24/84 (28%), Positives = 39/84 (46%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             +   V+D   GIA   ++ ++      + +   K GG G+GL  S+    L GG I   +
Sbjct:  1538 IAFSVSDTGIGIAASKMQVIFEAFKQADGTTSRKYGGTGLGLSISREIAQLLGGEIHAQS 1597

Query:   189 TEGVGTTVRVIFPKAPTEVFVPKG 260
               G G+T  +  P  P+E+  P G
Sbjct:  1598 EPGRGSTFTLYLPLHPSEL-PPHG 1620


>gnl|PID|d1010873 (D64000) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 1178

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.094, P = 0.090
 Identities = 25/80 (31%), Positives = 38/80 (47%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLY 185
             H++  V D   GI     EKL  F     +S    + G G+GL   K Y++  GG I++ 
Sbjct:  1089 HLLFQVRDEGIGIPLQDQEKL--FEAFHRASNVGDIPGTGLGLSIVKRYVEFQGGTIEVI 1146

Query:   186 TTEGVGTTVRVIFPKAPTEV 245
             +  G GTT+ +  P  P  +
Sbjct:  1147 SMPGKGTTMVIKLPLNPAPI 1166


>pir||A33862 hydH protein - Escherichia coli (fragment) >gi|146427 (M28369)
            hydH [Escherichia coli]
            Length = 137

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.14, P = 0.13
 Identities = 23/73 (31%), Positives = 37/73 (50%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             V + VTD+  GIA D ++ ++   +TT      K  G G+GL      ++  GG I + +
Sbjct:    61 VKISVTDSGKGIAADQLDAIFTPYFTT------KAEGTGLGLAVVHNIVEQHGGTIQVAS 114

Query:   189 TEGVGTTVRVIFP 227
              EG G+T  +  P
Sbjct:   115 QEGKGSTFTLWLP 127


>gnl|PID|e323041 (Z97065) RisS protein [Bordetella bronchiseptica]
            >gnl|PID|e1309464 (AJ224803) RisS protein [Bordetella
            parapertussis]
            Length = 474

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.21, P = 0.19
 Identities = 21/75 (28%), Positives = 38/75 (50%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             + ++V D   GIAP+ V++L L  ++   +    + G G+GL   +  +   GG + +  
Sbjct:   389 LAIEVADRGPGIAPEEVDRL-LRPFSRGEAARTGVSGAGLGLAIVERLLKHVGGSLRMLP 447

Query:   189 TEGVGTTVRVIFPKA 233
              +G G   R+  PKA
Sbjct:   448 RQGGGLIARIELPKA 462


>gnl|PID|e1309452 (AJ224802) RisS protein [Bordetella avium] >gnl|PID|e1309466
            (AJ224804) RisS protein [Bordetella parapertussis]
            >gnl|PID|e1309470 (AJ224799) RisS protein [Bordetella pertussis]
            Length = 474

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.21, P = 0.19
 Identities = 21/75 (28%), Positives = 38/75 (50%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             + ++V D   GIAP+ V++L L  ++   +    + G G+GL   +  +   GG + +  
Sbjct:   389 LAIEVADRGPGIAPEEVDRL-LRPFSRGEAARTGVSGAGLGLAIVERLLKHVGGSLRMLP 447

Query:   189 TEGVGTTVRVIFPKA 233
              +G G   R+  PKA
Sbjct:   448 RQGGGLIARIELPKA 462


>sp|P16575|BVGS_BORPE VIRULENCE SENSOR PROTEIN BVGS PRECURSOR >pir||A40185
            virulence protein bvgC - Bordetella pertussis >gi|144040 (M25401)
            BvgS protein [Bordetella pertussis]
            Length = 1238

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.26, P = 0.23
 Identities = 24/72 (33%), Positives = 36/72 (50%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWL-FGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDL 182
             HV   V+D   GI+     +L+  F     S+      G G+GL  S+  ++L GG + +
Sbjct:   871 HVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGPAPGTGLGLSISRRLVELMGGTLVM 930

Query:   183 YTTEGVGTTVRV 218
              +  GVGTTV V
Sbjct:   931 RSAPGVGTTVSV 942


>sp|P26762|BVGS_BORBR VIRULENCE SENSOR PROTEIN BVGS PRECURSOR >pir||S17944
            virulence protein bvgS - Bordetella bronchiseptica >gi|39354
            (X58355) bvgS product, put. sensor protein [Bordetella
            bronchiseptica]
            Length = 1238

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.26, P = 0.23
 Identities = 24/72 (33%), Positives = 36/72 (50%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWL-FGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDL 182
             HV   V+D   GI+     +L+  F     S+      G G+GL  S+  ++L GG + +
Sbjct:   871 HVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGPAPGTGLGLSISRRLVELMGGTLVM 930

Query:   183 YTTEGVGTTVRV 218
              +  GVGTTV V
Sbjct:   931 RSAPGVGTTVSV 942


>sp|P40330|BVGS_BORPA VIRULENCE SENSOR PROTEIN BVGS PRECURSOR >pir||S17946
            virulence protein bvgS - Bordetella parapertussis >gi|39729
            (X52948) bvgS product, put. sensor protein [Bordetella
            parapertussis]
            Length = 1238

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.26, P = 0.23
 Identities = 24/72 (33%), Positives = 36/72 (50%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWL-FGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDL 182
             HV   V+D   GI+     +L+  F     S+      G G+GL  S+  ++L GG + +
Sbjct:   871 HVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGPAPGTGLGLSISRRLVELMGGTLVM 930

Query:   183 YTTEGVGTTVRV 218
              +  GVGTTV V
Sbjct:   931 RSAPGVGTTVSV 942


>gnl|PID|d1010968 (D64001) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 675

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.33, P = 0.28
 Identities = 28/95 (29%), Positives = 44/95 (46%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTE 194
             V +TD   GI P+ +E ++   +    +     GG GIGL   +  +  WGG I    ++
Sbjct:   567 VTITDTGRGIEPNRLETVFDRFYQEEGALRRSRGGTGIGLAICRQIVSGWGGEI-WAASD 625

Query:   195 GV--GT----TVRVIFPKAPT---EVFVPKGTSSSS 275
             G   GT    TV ++ P+ P    E   PK   ++S
Sbjct:   626 GKNHGTQFHFTVPIVMPENPNLGVEEVAPKKRKATS 661


>sp|Q53135|CHEA_RHOSH CHEMOTAXIS PROTEIN CHEA >pir||S49211 cheA protein -
            Rhodobacter sphaeroides >gi|510671 (X80027) cheA gene product
            [Rhodobacter sphaeroides]
            Length = 686

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.33, P = 0.28
 Identities = 24/78 (30%), Positives = 43/78 (55%), Frame = +3

Query:    12 VVDVTDAAGGIAPDA--VEK-----LWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGG 170
             V+++    G +A DA   E+     L++ G++T +S  + + G G+G+   K  ++  GG
Sbjct:   460 VLEIAQGKGLVAQDAQLTEEEIDGLLFMPGFST-ASVVSDLSGRGVGMDVVKSAIESLGG 518

Query:   171 RIDLYTTEGVGTTVRVIFP 227
             RI + +  GVGTT  +  P
Sbjct:   519 RITIASDPGVGTTFTISLP 537


>sp|Q03228|DIVJ_CAUCR HISTIDINE PROTEIN KINASE DIVJ >gi|144219 (M98873)
            histidine protein kinase [Caulobacter crescentus]
            Length = 596

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.45, P = 0.36
 Identities = 21/69 (30%), Positives = 34/69 (49%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V D   GI+P+ +E+L    +      + +  G G+GL   + +  L GG + + +  G 
Sbjct:   482 VADTGVGISPEDLERLGR-PYEQAGGAEQRARGTGLGLSLVRAFAQLLGGEMVIESRLGA 540

Query:   201 GTTVRVIFP 227
             GTTV V  P
Sbjct:   541 GTTVSVRLP 549


>pir||A46414 histidine protein kinase divJ - Caulobacter crescentus
            Length = 596

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.45, P = 0.36
 Identities = 21/69 (30%), Positives = 34/69 (49%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V D   GI+P+ +E+L    +      + +  G G+GL   + +  L GG + + +  G 
Sbjct:   482 VADTGVGISPEDLERLGR-PYEQAGGAEQRARGTGLGLSLVRAFAQLLGGEMVIESRLGA 540

Query:   201 GTTVRVIFP 227
             GTTV V  P
Sbjct:   541 GTTVSVRLP 549


>gi|145519 (M13463) cheA peptide [Escherichia coli]
           Length = 225

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.57, P = 0.44
 Identities = 14/50 (28%), Positives = 29/50 (58%), Frame = +3

Query:    78 GWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTVRVIFP 227
             G++T     + + G G+G+   K  +   GG +++ + +G GTT+R++ P
Sbjct:    29 GFSTAEQVTD-VSGRGVGMDVVKRNIQKMGGHVEIQSKQGTGTTIRILLP 77


>gi|1572605 (U69111) putative histidine kinase [Xanthomonas campestris]
            Length = 42

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 0.81, P = 0.56
 Identities = 14/37 (37%), Positives = 21/37 (56%), Frame = +3

Query:   117 GFGIGLPASKCYMDLWGGRIDLYTTEGVGTTVRVIFP 227
             G G+GL  S   ++   GRID+ +T G G + R+  P
Sbjct:     1 GTGLGLSISYGIINKHHGRIDVESTPGQGASFRITLP 37


>pir||S11913 hypothetical protein 2 - Xanthomonas campestris pv. campestris
            >gi|48537 (X54015) gene 2 [Xanthomonas campestris]
            Length = 46

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 1.0, P = 0.65
 Identities = 13/37 (35%), Positives = 21/37 (56%), Frame = +3

Query:   117 GFGIGLPASKCYMDLWGGRIDLYTTEGVGTTVRVIFP 227
             G G+GL  S   ++   GRID+ +  G G + R++ P
Sbjct:     5 GTGLGLSISYGIINKHHGRIDVESVPGQGASFRIVLP 41


>sp|P15939|NODV_BRAJA NODULATION PROTEIN V >pir||A35989 nodulation protein V -
            Bradyrhizobium japonicum >gi|152120 (M31765) nodulation protein
            (nodV) [Bradyrhizobium japonicum]
            Length = 889

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 1.1, P = 0.67
 Identities = 23/74 (31%), Positives = 37/74 (50%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLY 185
             +V + VTD   GIA +  +++    +TT SS      G G+GL   +  +++ GGRI + 
Sbjct:   815 YVQLSVTDCGVGIAENDADRVLDPFFTTKSS------GLGMGLSICRSIVEVHGGRISVV 868

Query:   186 TTEGVGTTVRVIFP 227
                G G T +   P
Sbjct:   869 QKNGPGATFQFALP 882


>gi|2649119 (AE001003) signal-transducing histidine kinase [Archaeoglobus
            fulgidus]
            Length = 438

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 1.1, P = 0.68
 Identities = 27/71 (38%), Positives = 36/71 (50%), Frame = +3

Query:    12 VVDVTDAAGGIAPDAV-EKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             V+ V D   GI PD + ++++  G+TT        GG GIGL   K   D+ GG I +Y 
Sbjct:   373 VLRVADTGKGI-PDHIKQRIFEEGFTT--------GGTGIGLFIVKKLTDILGGAISVYD 423

Query:   189 TEGVGTTVRVIF 224
              E  GT   V F
Sbjct:   424 NEPSGTIFEVRF 435


>gi|1825465 (U57900) tutC [Thauera T1]
            Length = 979

  Plus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 1.2, P = 0.71
 Identities = 23/73 (31%), Positives = 40/73 (54%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             + V V D+  G+AP   E ++      ++ + +K+ G G+GL  S+  ++  GGR+D+ +
Sbjct:   901 LTVSVHDSGPGLAPGEAENVF------DAFYTSKVEGLGMGLAISRSIIEAHGGRLDVLS 954

Query:   189 --TEGVGTTVRVIFP 227
               TEG G T     P
Sbjct:   955 PSTEG-GCTFCFTLP 968


>gi|3420757 (AF079544) orf175 [Mycobacterium avium]
            Length = 79

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.4, P = 0.76
 Identities = 15/39 (38%), Positives = 22/39 (56%), Frame = -1

Query:   198 PPLSYTSLSSRPRGPCNIWRQASRCQSRPFCCQRKSLSS 82
             PP +  S + RPRGP ++ R AS     P    R+++SS
Sbjct:    28 PPNALASTTCRPRGP-SVTRTASASVLTPASMARRAVSS 65


>gnl|PID|e1286185 (AL022374) putative two-component sensor [Streptomyces
            coelicolor]
            Length = 566

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 1.6, P = 0.79
 Identities = 24/74 (32%), Positives = 34/74 (45%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V D   GIA D  E ++  GW+T     ++  G  IGLP  +   +  GG   +    G 
Sbjct:   475 VRDTGPGIAADHRELVFAAGWSTKEPPAHRERG--IGLPLVRRLAERQGGSATVGEAYGG 532

Query:   201 GTTVRVIFPKAPTE 242
             G    V+ P+A TE
Sbjct:   533 GAEFVVVLPEALTE 546


>gi|152215 (J03174) fixL protein (5' end pot.); putative [Rhizobium meliloti]
           Length = 464

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 1.7, P = 0.83
 Identities = 25/73 (34%), Positives = 33/73 (45%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             V V V D  GGI  +   +L+    TT +S      G GIGL  SK  ++  GG + +  
Sbjct:   387 VAVVVEDTGGGIPEEVAGQLFKPFVTTKAS------GMGIGLSISKRIVEAHGGEMTVSK 440

Query:   189 TEGVGTTVRVIFP 227
              E  G T R   P
Sbjct:   441 NEAGGATFRFTLP 453


>sp|P14377|HYDH_ECOLI SENSOR PROTEIN HYDH >gi|396342 (U00006) hydH [Escherichia
            coli] >gi|1790436 (AE000473) o465 [Escherichia coli]
            Length = 465

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 1.8, P = 0.83
 Identities = 23/73 (31%), Positives = 37/73 (50%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             V + VTD+  GIA D ++ ++   +TT      K  G G+GL      ++  GG I + +
Sbjct:   389 VKISVTDSGKGIAADQLDAIFTPYFTT------KAEGTGLGLAVVHNIVEQHGGTIQVAS 442

Query:   189 TEGVGTTVRVIFP 227
              EG G+T  +  P
Sbjct:   443 QEGKGSTFTLWLP 455


>gnl|PID|d1018819 (D90911) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 633

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 1.8, P = 0.84
 Identities = 25/85 (29%), Positives = 43/85 (50%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V+D   GIA   +++L++    T +   +  G  G+GLP S+ ++ L GG+I + +    
Sbjct:   325 VSDTGPGIAAHEMDELFVPFAQTETGLKSCQGN-GLGLPISQKFVQLMGGQIQVRSKVDQ 383

Query:   201 GTTVRVIFPKAPTEVFV-PKGTSSSS 275
             G+     F   P +V   PK T  +S
Sbjct:   384 GSA---FFFAIPVQVMAAPKPTPETS 406


>gi|155840 (M10845) chorion protein [Antheraea polyphemus]
           Length = 48

  Plus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.8, P = 0.84
 Identities = 8/10 (80%), Positives = 8/10 (80%), Frame = +2

Query:    11 CGGCDGCGGW 40
             CGGC GC GW
Sbjct:    20 CGGCGGCDGW 29


>sp|P23222|FIXL_BRAJA SENSOR PROTEIN FIXL >gi|39523 (X56808) ttg start codon
            [Bradyrhizobium japonicum] >gnl|PID|e1285521 (AJ005001) FixL
            protein [Bradyrhizobium japonicum]
            Length = 505

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.0, P = 0.86
 Identities = 21/75 (28%), Positives = 34/75 (45%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             + V+V+D   G   D +  L+   +TT  +      G G+GL  S+  ++  GGR+   +
Sbjct:   434 IEVEVSDTGSGFQDDVIPNLFQTFFTTKDT------GMGVGLSISRSIIEAHGGRMWAES 487

Query:   189 TEGVGTTVRVIFPKA 233
                 G T R   P A
Sbjct:   488 NASGGATFRFTLPAA 502


>sp|P10955|FIXL_RHIME SENSOR PROTEIN FIXL >pir||S39984 nitrogen fixation
            regulatory protein fixL - Rhizobium meliloti >gi|49404 (Z21854)
            FixL [Rhizobium meliloti]
            Length = 505

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.0, P = 0.86
 Identities = 25/73 (34%), Positives = 33/73 (45%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             V V V D  GGI  +   +L+    TT +S      G GIGL  SK  ++  GG + +  
Sbjct:   428 VAVVVEDTGGGIPEEVAGQLFKPFVTTKAS------GMGIGLSISKRIVEAHGGEMTVSK 481

Query:   189 TEGVGTTVRVIFP 227
              E  G T R   P
Sbjct:   482 NEAGGATFRFTLP 494


>pir||S13330 fixL protein - Bradyrhizobium japonicum
            Length = 505

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.0, P = 0.86
 Identities = 21/75 (28%), Positives = 34/75 (45%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             + V+V+D   G   D +  L+   +TT  +      G G+GL  S+  ++  GGR+   +
Sbjct:   434 IEVEVSDTGSGFQDDVIPNLFQTFFTTKDT------GMGVGLSISRSIIEAHGGRMWAES 487

Query:   189 TEGVGTTVRVIFPKA 233
                 G T R   P A
Sbjct:   488 NASGGATFRFTLPAA 502


>pir||QRECCS chemotaxis cheA protein - Escherichia coli >gi|145530 (M34669)
            CheA protein (alt.) [Escherichia coli]
            Length = 557

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.2, P = 0.89
 Identities = 14/50 (28%), Positives = 29/50 (58%), Frame = +3

Query:    78 GWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTVRVIFP 227
             G++T     + + G G+G+   K  +   GG +++ + +G GTT+R++ P
Sbjct:   361 GFSTAEQVTD-VSGRGVGMDVVKRNIQKMGGHVEIQSKQGTGTTIRILLP 409


>gnl|PID|d1011085 (D64002) sensory transduction histidine kinase [Synechocystis
            sp.]
            Length = 417

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 2.3, P = 0.90
 Identities = 26/73 (35%), Positives = 36/73 (49%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWL-FGWTTNS-SFDNKMGGFGIGLPASKCYMDLWGGRIDL 182
             ++  V D   GI P+    L+  F   ++  SF  K  G G+GL  S+    L GG I L
Sbjct:   335 LIFSVIDTGIGIDPEDQRDLFQPFKQISHPPSFAEK--GTGLGLALSRRLAQLHGGDIQL 392

Query:   183 YTTEGVGTTVRVIFP 227
              +T GVG+    I P
Sbjct:   393 TSTPGVGSCFSAILP 407


>pir||A49591 spike protein - porcine epidemic diarrhea virus (fragment)
            >gi|406758 (Z24733) spike protein [porcine epidemic diarrhea virus]
            Length = 37

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 2.5, P = 0.91
 Identities = 10/21 (47%), Positives = 11/21 (52%), Frame = +2

Query:     8 CCGGCDGCGGWYRS*CRGETL 70
             CCG C  CG  +   CRG  L
Sbjct:     5 CCGCCGCCGACFSGCCRGPRL 25


>gi|145529 (M34669) CheA protein (alt.) [Escherichia coli]
           Length = 654

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.7, P = 0.93
 Identities = 14/50 (28%), Positives = 29/50 (58%), Frame = +3

Query:    78 GWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTVRVIFP 227
             G++T     + + G G+G+   K  +   GG +++ + +G GTT+R++ P
Sbjct:   458 GFSTAEQVTD-VSGRGVGMDVVKRNIQKMGGHVEIQSKQGTGTTIRILLP 506


>sp|P07363|CHEA_ECOLI CHEMOTAXIS PROTEIN CHEA >gnl|PID|d1016433 (D90831)
            Chemotaxis protein CheA (EC 2.7.3.-). [Escherichia coli]
            >gi|1788197 (AE000282) chemotaxis protein CheA [Escherichia coli]
            Length = 654

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.7, P = 0.93
 Identities = 14/50 (28%), Positives = 29/50 (58%), Frame = +3

Query:    78 GWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTVRVIFP 227
             G++T     + + G G+G+   K  +   GG +++ + +G GTT+R++ P
Sbjct:   458 GFSTAEQVTD-VSGRGVGMDVVKRNIQKMGGHVEIQSKQGTGTTIRILLP 506


>gi|1498305 (U51927) SpiR [Salmonella typhimurium]
            Length = 823

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 3.5, P = 0.97
 Identities = 26/84 (30%), Positives = 40/84 (47%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V+D+  GI  +  ++  +F  T     D    G GIGL  +     + GG + L +  GV
Sbjct:   547 VSDSGKGI--EIQQQSQIF--TAFYQADTNSQGTGIGLTIASSLAKMMGGNLTLKSVPGV 602

Query:   201 GTTVRVIFPKAPTEVFVP-KGTSSS 272
             GT V ++ P    +   P KGT S+
Sbjct:   603 GTCVSLVLPLQEYQPPQPIKGTLSA 627


>gi|7428 (X58114) testis-specific RNA [Drosophila hydei]
         Length = 49

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 4.2, P = 0.99
 Identities = 10/20 (50%), Positives = 12/20 (60%), Frame = +2

Query:     2 HTCCGGCDGCGGWYRS*CRG 61
             ++CCG C  C G Y S C G
Sbjct:    21 YSCCGPCYSCCGPYYSCCGG 40


>sp|P45609|PHOR_SHIDY PHOSPHATE REGULON SENSOR PROTEIN PHOR >pir||B44753 phoR
            protein - Shigella dysenteriae >gi|294893 (M31793) phosphate
            regulatory protein phoR (gtg start codon) [Shigella dysenteriae]
            Length = 431

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 4.7, P = 0.99
 Identities = 19/70 (27%), Positives = 35/70 (50%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V D   GIAP+ + +L    +  + +   + GG G+GL   K  ++    R+++ +T G 
Sbjct:   354 VEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGK 413

Query:   201 GTTVRVIFPK 230
             GT    + P+
Sbjct:   414 GTRFSFVIPE 423


>sp|P08400|PHOR_ECOLI PHOSPHATE REGULON SENSOR PROTEIN PHOR >pir||RGECFR
            phosphate regulon regulatory protein - Escherichia coli >gi|581188
            (X04704) phoR gene product (AA 1-431) [Escherichia coli]
            >gi|1657596 (U73857) phosphate regulon sensor protein phoR
            [Escherichia coli] >gi|1786600 (AE000146) phosphate regulon sensor
            protein PhoR [Escherichia coli]
            Length = 431

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 4.7, P = 0.99
 Identities = 19/70 (27%), Positives = 35/70 (50%), Frame = +3

Query:    21 VTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGV 200
             V D   GIAP+ + +L    +  + +   + GG G+GL   K  ++    R+++ +T G 
Sbjct:   354 VEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGK 413

Query:   201 GTTVRVIFPK 230
             GT    + P+
Sbjct:   414 GTRFSFVIPE 423


>gi|1458240 (U64833) coded for by C. elegans cDNA CEESD76F;  weak similarity to
            rat neurogenic locus NOTCH homolog protein ! (PIR:S18188)
            [Caenorhabditis elegans]
            Length = 432

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 4.7, P = 0.99
 Identities = 20/66 (30%), Positives = 35/66 (53%), Frame = -3

Query:   217 TRTVVPTPSVVYKSILPPQRSM*HLEAGKPMPKPPILLSKEEFVVQPKSQSFSTASGAIP 38
             T +V+PTP+++  +    Q+S    +   P+P PP+L+ + E  +  K+ S S  +   P
Sbjct:   312 TPSVIPTPAMMSPNPAMVQKSS---KPSTPIPAPPVLVPQVE--LPAKTSSVSQKTTVSP 366

Query:    37 PAASVT 20
             P   VT
Sbjct:   367 PVEKVT 372


>gi|3282775 (AF043352) histidine protein kinase PhoR [Vibrio cholerae]
            Length = 433

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 4.7, P = 0.99
 Identities = 19/72 (26%), Positives = 33/72 (45%), Frame = +3

Query:    15 VDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTE 194
             ++V D   GI P  + +L    +  + +     GG G+GL   K  +      +D+Y+  
Sbjct:   356 LEVEDKGEGIEPQHLHRLTERFYRVDKARSRDTGGSGLGLAIVKHALAHHDTHLDIYSKV 415

Query:   195 GVGTTVRVIFPK 230
             GVG+    + PK
Sbjct:   416 GVGSKFSFVLPK 427


>sp|Q11155|SEX3_MYCTU SENSOR-LIKE HISTIDINE KINASE SENX3 >gnl|PID|e255152
            (Z77162) senX3 [Mycobacterium tuberculosis] >gnl|PID|e321546
            (Y13628) SenX3 [Mycobacterium tuberculosis]
            Length = 410

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 6.4, P = 1.0
 Identities = 20/74 (27%), Positives = 36/74 (48%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLY 185
             ++ + VTD   GIAP+  E+++   +  + +     GG G+GL   K       G I ++
Sbjct:   304 NIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHDGTIRVW 363

Query:   186 TTEGVGTTVRVIFP 227
             +  G G+T  +  P
Sbjct:   364 SKPGTGSTFTLALP 377


>gnl|PID|e1192298 (Y13627) SenX3 [Mycobacterium bovis BCG]
            Length = 410

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 6.4, P = 1.0
 Identities = 20/74 (27%), Positives = 36/74 (48%), Frame = +3

Query:     6 HVVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLY 185
             ++ + VTD   GIAP+  E+++   +  + +     GG G+GL   K       G I ++
Sbjct:   304 NIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHDGTIRVW 363

Query:   186 TTEGVGTTVRVIFP 227
             +  G G+T  +  P
Sbjct:   364 SKPGTGSTFTLALP 377


>gnl|PID|d1010630 (D63959) immunoglobulin lambda chain [Gallus gallus]
            Length = 111

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.9, P = 1.0
 Identities = 13/33 (39%), Positives = 18/33 (54%), Frame = +2

Query:     5 TCCGGCDGCG-GWYRS*CRGE---TLAFWLDDK 91
             TC GG  GCG GW++    G    T+ +W D +
Sbjct:    24 TCSGGSSGCGYGWFQQKSPGSAPVTVIYWNDKR 56


>sp|P09384|CHEA_SALTY CHEMOTAXIS PROTEIN CHEA >pir||A28959 chemotaxis protein
            cheA - Salmonella typhimurium >gi|153900 (J03611) sensory protein
            (cheA; gtg start codon) [Salmonella typhimurium]
            Length = 671

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 8.1, P = 1.0
 Identities = 14/50 (28%), Positives = 29/50 (58%), Frame = +3

Query:    78 GWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYTTEGVGTTVRVIFP 227
             G++T     + + G G+G+   K  +   GG +++ + +G GTT+R++ P
Sbjct:   475 GFSTAEQVTD-VSGRGVGMDVVKRNIQEMGGHVEIQSKQGSGTTIRILLP 523


>gi|2460283 (AF024654) hybrid histidine kinase DHKB [Dictyostelium discoideum]
            Length = 1969

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 9.1, P = 1.0
 Identities = 23/77 (29%), Positives = 36/77 (46%), Frame = +3

Query:     3 THVVV--DVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRI 176
             TH ++  DV D+  GI  + +  L+      +S    K  G G+GL  SK    + GG +
Sbjct:  1109 THSLIKFDVEDSGIGIKTEHLNPLFASFSQIDSGNSRKYRGTGLGLSISKRLCKMMGGDV 1168

Query:   177 DLYTTEGVGTTVRVIFP 227
              + +  GVG+T     P
Sbjct:  1169 KVKSEFGVGSTFSFTIP 1185


>sp|P77510|CITA_ECOLI SENSOR KINASE CITA >gi|1778536 (U82598) sensor kinase
            CitA homolog [Escherichia coli] >gi|1786837 (AE000167) o552 was
            o455; This 455 aa ORF is 29 pct identical (15 gaps) to 441 residues
            of an approx. 544 aa protein YJDH_ECOLI SW: P39272; This 77 aa ORF
            is 28 pct identical (2 gaps) to 59 residues of an approx. 400 aa
            protein YWFF_BACSU SW...
            Length = 552

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 9.4, P = 1.0
 Identities = 22/74 (29%), Positives = 35/74 (47%), Frame = +3

Query:     9 VVVDVTDAAGGIAPDAVEKLWLFGWTTNSSFDNKMGGFGIGLPASKCYMDLWGGRIDLYT 188
             VV++V D   G+     +K++  G +T +   ++ G  GIGL     Y+   GG I L  
Sbjct:   469 VVIEVADQGCGVPESLRDKIFEQGVSTRA---DEPGEHGIGLYLIASYVTRCGGVITLED 525

Query:   189 TEGVGTTVRVIFPK 230
              +  GT   +  PK
Sbjct:   526 NDPCGTLFSIYIPK 539


>gnl|PID|d1017013 (D90870) CHORION CLASS HIGH-CYSTEINE HCB PROTEIN 13 PRECURSOR
            (HC-B.13). [Escherichia coli]
            Length = 66

  Plus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 9.6, P = 1.0
 Identities = 7/9 (77%), Positives = 7/9 (77%), Frame = +2

Query:     8 CCGGCDGCG 34
             CC GC GCG
Sbjct:    58 CCNGCSGCG 66


>gi|196602 (M35646) immunoglobulin kappa-chain [Mus musculus]
           Length = 66

  Minus Strand HSPs:

 Score = 43 (15.1 bits), Expect = 9.8, Sum P(2) = 1.0
 Identities = 10/23 (43%), Positives = 13/23 (56%), Frame = -1

Query:   201 PPPLS-YTSLSSRPRGPCNI-WR 139
             PP L  Y S+  R  GPC + W+
Sbjct:     6 PPKLLIYLSIQPRIWGPCQLQWQ 28

 Score = 39 (13.7 bits), Expect = 9.8, Sum P(2) = 1.0
 Identities = 6/9 (66%), Positives = 7/9 (77%), Frame = -1

Query:    48 ERYHPPHPS 22
             +R HP HPS
Sbjct:    32 DRLHPQHPS 40


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.97
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.323   0.139   0.457  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.336   0.151   0.549  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.342   0.146   0.560  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.328   0.138   0.483  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.329   0.141   0.472  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.327   0.135   0.407  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      118       118       10.  68 3 1000 22  0.095   33
                                                     29  0.10    35
   +2      0      118       118       10.  68 3 1000 22  0.095   33
                                                     29  0.10    35
   +1      0      119       119       10.  68 3 1000 22  0.096   33
                                                     29  0.11    35
   -1      0      119       119       10.  68 3 1000 22  0.096   33
                                                     29  0.11    35
   -2      0      118       118       10.  68 3 1000 22  0.095   33
                                                     29  0.10    35
   -3      0      118       118       10.  68 3 1000 22  0.095   33
                                                     29  0.10    35


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  86
  No. of states in DFA:  327 (32 KB)
  Total size of DFA:  40 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  31.14u 1.14s 32.28t  Elapsed: 00:00:07
  Total cpu time:  31.22u 6.09s 37.31t  Elapsed: 00:00:12
  Start:  Thu Sep 24 16:11:02 1998   End:  Thu Sep 24 16:11:14 1998

Date: 17:26:58 on Mon 18 Dec 117.