blastx_gbnr_files/1868738_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  1868738
        (317 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|e1287779     (AL022600) hypothetical protein [... +3    83  8.5e-06   2
A gi|17238             (Z18090) catalase isozyme A (EC 1... +3    68  0.81      1
A gi|1067058           (Z49070) T09F3.1 [Caenorhabditis ... +3    70  0.98      1
A pir||A32624          osteogenin - bovine (fragments)      -1    54  0.9994    1
A sp|Q09753|BD01_HUMAN BETA-DEFENSIN 1 PRECURSOR (HBD-1)... -2    53  0.99991   1



>gnl|PID|e1287779 (AL022600) hypothetical protein [Schizosaccharomyces pombe]
            Length = 273

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 8.5e-06, Sum P(2) = 8.5e-06
 Identities = 19/51 (37%), Positives = 27/51 (52%), Frame = +3

Query:   159 SKPKCTKRY-EAPMRWATLGFSYDWTSKTYTRENYS-AFPPALKRRIEEIL 305
             +KP    R     +RW TLG  YDWT+K Y   + S  FP  L   +E+++
Sbjct:   122 TKPLTVDRLVHKKLRWVTLGEQYDWTTKEYPDPSKSPGFPKDLGDFVEKVV 172

 Score = 51 (18.0 bits), Expect = 8.5e-06, Sum P(2) = 8.5e-06
 Identities = 13/51 (25%), Positives = 20/51 (39%), Frame = +3

Query:    15 RCFEFVAVPGLLFFPDAISEEEQQAFCRDAILRYGDSSQHPNHLSTHASKP 167
             R F F   PGLL   + +S E Q    +  +       ++  +LS     P
Sbjct:    47 RVFSFQKAPGLLILKNYVSSELQMQLLKSIMFTQIQDPENKTNLSPFYQLP 97


>gi|17238 (Z18090) catalase isozyme A (EC 1.11.1.6) [Arabidopsis thaliana]
          Length = 112

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.6, P = 0.81
 Identities = 17/45 (37%), Positives = 25/45 (55%), Frame = +3

Query:    39 PGLLFFPDAISEEEQQAFCRDAILRYGDSSQH---PNHLSTHASKPKC 173
             PGL+  P     +++   CR  I  YGD+ +H   PN+L    + PKC
Sbjct:    28 PGLVV-PGIYYSDDKLLQCR--IFAYGDTQRHRLGPNYLQLPVNAPKC 72


>gi|1067058 (Z49070) T09F3.1 [Caenorhabditis elegans]
            Length = 189

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 4.2, P = 0.98
 Identities = 23/90 (25%), Positives = 39/90 (43%), Frame = +3

Query:    60 DAISEEEQQAFCRDAILRYGDSSQHPNHLSTHASKPKCTKRYEAPMRWATLGFSYDWTSK 239
             +   E  Q   C+ +I R+G  +   NHLS HA      K+Y  P   A+  F+  + + 
Sbjct:    37 EPFGELYQCQLCKKSISRHGQYANLLNHLSRHARLHASKKQYCCPKCGAS--FTRRYLAS 94

Query:   240 TYTRENYSA-------FPPALKRRIEEILHLC 314
             T+ +E +         F   L+     +L +C
Sbjct:    95 THIKEVHGEPKLQPHDFAAELREEYRRLLEMC 126


>pir||A32624 osteogenin - bovine (fragments)
            Length = 56

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 7.3, P = 1.0
 Identities = 11/23 (47%), Positives = 15/23 (65%), Frame = -1

Query:   179 FSALWLAGVC*QMVGMLTGIPVP 111
             F A + +G C Q VG++ GIP P
Sbjct:     2 FDAYYCSGAC-QAVGVVPGIPEP 23


>sp|Q09753|BD01_HUMAN BETA-DEFENSIN 1 PRECURSOR (HBD-1) (DEFENSIN, BETA 1)
            >gi|1293651 (U50931) beta-defensin-1 [Homo sapiens]
            >gnl|PID|e209045 (X92744) hBD-1 [Homo sapiens] >gi|1755148 (U73945)
            beta-defensin-1 [Homo sapiens]
            Length = 68

  Minus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 9.4, P = 1.0
 Identities = 13/28 (46%), Positives = 13/28 (46%), Frame = -2

Query:    85 CCSSSEMASGKNSNPGTATNSKHRTCES 2
             C   SEMASG N   G    S H  C S
Sbjct:    12 CLLLSEMASGGNFLTGLGHRSDHYNCVS 39


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=6.00
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.322   0.134   0.430  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.346   0.145   0.474  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.341   0.149   0.511  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.344   0.153   0.534  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.336   0.141   0.456  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.332   0.135   0.462  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      105       105       10.  66 3 1000 22  0.11    32
                                                     29  0.11    34
   +2      0      105       105       10.  66 3 1000 22  0.11    32
                                                     29  0.11    34
   +1      0      105       105       10.  66 3 1000 22  0.11    32
                                                     29  0.11    34
   -1      0      105       105       10.  66 3 1000 22  0.11    32
                                                     29  0.11    34
   -2      0      105       105       10.  66 3 1000 22  0.11    32
                                                     29  0.11    34
   -3      0      105       105       10.  66 3 1000 22  0.11    32
                                                     29  0.11    34


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  5
  No. of states in DFA:  315 (31 KB)
  Total size of DFA:  38 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  26.58u 1.18s 27.76t  Elapsed: 00:00:06
  Total cpu time:  26.62u 1.65s 28.27t  Elapsed: 00:00:07
  Start:  Thu Sep 24 16:52:30 1998   End:  Thu Sep 24 16:52:37 1998

Date: 14:43:31 on Sun 17 Dec 117.