blastx_gbnr_files/2739_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  2739
        (352 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|552132            (K01664) Bkm-like protein [Drosop... -2    78  0.017     1
A pir||C21124          Bkm-like sex-determining region h... -2    78  0.017     1
A pir||B21124          Bkm-like sex-determining region h... -2    78  0.017     1
A pir||S60837          M protein precursor - Streptococc... +3    66  0.28      1
A gi|1620044           (U42580) a372L [Paramecium bursar... +1    66  0.28      1
A gnl|PID|d1000903     (D00570) open reading frame (196 ... -2    78  0.28      1
A pir||I54413          MHC c3/g5 protein - mouse (fragme... +3    64  0.41      1
A pir||S50999          superoxide dismutase (EC 1.15.1.1... +3    57  0.95      1
A sp|P50491|AMA1_PLAFH APICAL MEMBRANE ANTIGEN 1 PRECURS... +3    76  0.95      1
A sp|P08016|EGGS_SCHMA PUTATIVE EGGSHELL PROTEIN >pir||A... +3    69  0.99      1
A sp|P15515|HIS1_HUMAN HISTATIN 1 PRECURSOR (HISTIDINE-R... +3    55  0.994     1
A gnl|PID|e220212      (X95276) ORF105 [Plasmodium falci... +1    66  0.999     1
A gnl|PID|d1021566     (AB001684) ORF51c [Chlorella vulg... +1    54  0.999     1
A gnl|PID|d1021580     (AB001684) ORF54d [Chlorella vulg... -3    53  0.99992   1



>gi|552132 (K01664) Bkm-like protein [Drosophila melanogaster]
           Length = 81

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.017, P = 0.017
 Identities = 13/50 (26%), Positives = 35/50 (70%), Frame = -2

Query:   198 VNIRMSVELHIYMTVRVNKHLNFHCCVHKSVVRIILHANIFLLLLLNIYI 49
             + I +S+ L IY+++ ++ +L+ + C++ S+  + ++ +I+L + L+IY+
Sbjct:    19 IGIYLSIYLSIYLSIYLSIYLSIYLCIYLSI-SLSIYLSIYLSIYLSIYL 67

 Score = 77 (27.1 bits), Expect = 0.022, P = 0.022
 Identities = 18/73 (24%), Positives = 43/73 (58%), Frame = -2

Query:   267 DLSFSLIINFHR*GXYF-LYTFVQVNIRMSVELHIYMTVRVNKHLNFHCCVHKSVVRIIL 91
             D+  S+ +     G Y  +Y  + ++I +S+ L IY+ + ++  L+ +  ++ S+  + +
Sbjct:     7 DMGVSISLGGSFIGIYLSIYLSIYLSIYLSIYLSIYLCIYLSISLSIYLSIYLSIY-LSI 65

Query:    90 HANIFLLLLLNIYI 49
             + +I+L L L+IY+
Sbjct:    66 YLSIYLSLYLSIYL 79

 Score = 76 (26.8 bits), Expect = 0.028, P = 0.028
 Identities = 13/53 (24%), Positives = 36/53 (67%), Frame = -2

Query:   198 VNIRMSVELHIYMTVRVNKHLNFHCCVHKSV---VRIILHANIFLLLLLNIYI 49
             + I +S+ L IY+++ ++ +L+ + C++ S+   + + ++ +I+L + L+IY+
Sbjct:    19 IGIYLSIYLSIYLSIYLSIYLSIYLCIYLSISLSIYLSIYLSIYLSIYLSIYL 71


>pir||C21124 Bkm-like sex-determining region hypothetical protein CS319 - fruit
            fly (Drosophila melanogaster) (fragment)
            Length = 81

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.017, P = 0.017
 Identities = 13/50 (26%), Positives = 35/50 (70%), Frame = -2

Query:   198 VNIRMSVELHIYMTVRVNKHLNFHCCVHKSVVRIILHANIFLLLLLNIYI 49
             + I +S+ L IY+++ ++ +L+ + C++ S+  + ++ +I+L + L+IY+
Sbjct:    19 IGIYLSIYLSIYLSIYLSIYLSIYLCIYLSI-SLSIYLSIYLSIYLSIYL 67

 Score = 77 (27.1 bits), Expect = 0.022, P = 0.022
 Identities = 18/73 (24%), Positives = 43/73 (58%), Frame = -2

Query:   267 DLSFSLIINFHR*GXYF-LYTFVQVNIRMSVELHIYMTVRVNKHLNFHCCVHKSVVRIIL 91
             D+  S+ +     G Y  +Y  + ++I +S+ L IY+ + ++  L+ +  ++ S+  + +
Sbjct:     7 DMGVSISLGGSFIGIYLSIYLSIYLSIYLSIYLSIYLCIYLSISLSIYLSIYLSIY-LSI 65

Query:    90 HANIFLLLLLNIYI 49
             + +I+L L L+IY+
Sbjct:    66 YLSIYLSLYLSIYL 79

 Score = 76 (26.8 bits), Expect = 0.028, P = 0.028
 Identities = 13/53 (24%), Positives = 36/53 (67%), Frame = -2

Query:   198 VNIRMSVELHIYMTVRVNKHLNFHCCVHKSV---VRIILHANIFLLLLLNIYI 49
             + I +S+ L IY+++ ++ +L+ + C++ S+   + + ++ +I+L + L+IY+
Sbjct:    19 IGIYLSIYLSIYLSIYLSIYLSIYLCIYLSISLSIYLSIYLSIYLSIYLSIYL 71


>pir||B21124 Bkm-like sex-determining region hypothetical protein CS314 - fruit
            fly (Drosophila melanogaster) (fragment)
            Length = 105

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.017, P = 0.017
 Identities = 15/60 (25%), Positives = 39/60 (65%), Frame = -2

Query:   219 FLYTFVQV--NIRMSVELHIYMTVRVNKHLNFHCCVHKSV-VRIILHANIFLLLLLNIYI 49
             F+  F+ +  +I +S+ L IY+++ ++ HL+ +   ++S+ + + ++ +I++   L+IYI
Sbjct:    36 FISIFISIYLSIYLSIYLSIYLSIYLSIHLSIYLSTYQSIYIYLYIYISIYISTYLSIYI 95

 Score = 71 (25.0 bits), Expect = 0.37, P = 0.31
 Identities = 14/59 (23%), Positives = 36/59 (61%), Frame = -2

Query:   222 YFLYTFVQVNIRMSVELHIYMTVRVNKHLNFHCCVHKSVVRIILHA-NIFLLLLLNIYI 49
             + +Y  + ++I +S+ L IY+++ ++ +L+ +  +H S+      +  I+L + ++IYI
Sbjct:    29 WLIYLSIFISIFISIYLSIYLSIYLSIYLSIYLSIHLSIYLSTYQSIYIYLYIYISIYI 87


>pir||S60837 M protein precursor - Streptococcus pyogenes (serotype M59)
            (fragment) >gi|1235836 (U11987) emml gene product [Streptococcus
            pyogenes]
            Length = 88

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 0.32, P = 0.28
 Identities = 22/79 (27%), Positives = 39/79 (49%), Frame = +3

Query:    63 KEEEEKYLHGELYEQHSYEH-SNENLNVYLPGQSYKYVTQHSYEYLPEQMYKENNXLTDE 239
             K E+ K  +GEL  Q  Y+  +NEN ++     +Y      +Y Y  E++ K+N  L  +
Sbjct:    14 KAEQAKNNNGELTLQQKYDALTNENKSLRRERDNYL-----NYLYEKEELEKKNKELDSQ 68

Query:   240 NLLLKRMIDLDHLKIKKESN 299
                L  +++ D  + K+  N
Sbjct:    69 VAGLIGVVESDEEEAKRSKN 88


>gi|1620044 (U42580) a372L [Paramecium bursaria Chlorella virus 1]
            Length = 76

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 0.32, P = 0.28
 Identities = 16/41 (39%), Positives = 20/41 (48%), Frame = +1

Query:     7 RYSFFFIYFCFPLFYIDIQKKKKKNICMENYTNNTLMNTAM 129
             RY F FI FC  + Y D   K K  I + N TN  L  + +
Sbjct:    11 RYDFTFILFCLLVLY-DWMNKIKMMIFIHNETNRLLFKSVI 50


>gnl|PID|d1000903 (D00570) open reading frame (196 AA) [Mus musculus]
            Length = 196

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.33, P = 0.28
 Identities = 14/55 (25%), Positives = 37/55 (67%), Frame = -2

Query:   213 YTFVQVNIRMSVELHIYMTVRVNKHLN-FHCCVHKSVVRIILHANIFLLLLLNIYI 49
             Y  + ++I +S+ L IY+++    H++ +H  ++ S++ + ++ +I+L + L+IY+
Sbjct:    11 YVCLSISIYLSIYLSIYLSIY---HMSVYHLSIYLSIIYLSIYLSIYLSIYLSIYL 63


>pir||I54413 MHC c3/g5 protein - mouse (fragment) >gi|554213 (M14830) MHC c3/g5
            protein [Mus musculus]
            Length = 88

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 0.53, P = 0.41
 Identities = 13/41 (31%), Positives = 22/41 (53%), Frame = +3

Query:    78 KYLHGEL---YEQHSYEHSNENLNVYLPGQSYKYVTQHSYE 191
             ++LHG     Y+ H Y   NE+L+ +    +   +TQH +E
Sbjct:    17 QFLHGHYQHAYDGHDYITLNEDLSSWTAADAVAQITQHKWE 57


>pir||S50999 superoxide dismutase (EC 1.15.1.1) (Fe) - Azotobacter vinelandii
            >bbs|163374 iron superoxide dismutase, Fe-SOD {N-terminal} {EC
            1.15.1.1} [Azotobacter vinelandii, UW136, Peptide Partial, 49 aa]
            Length = 49

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 2.9, P = 0.95
 Identities = 14/39 (35%), Positives = 18/39 (46%), Frame = +3

Query:    57 YSKEEEEKYLHGELYEQHSYEHSNE---NLNVYLPGQSY 164
             Y K   E Y+  E  E H  +H N    NLN  +PG  +
Sbjct:     9 YEKNALEPYISTETLEYHYGKHHNTYVVNLNNLIPGTEF 47


>sp|P50491|AMA1_PLAFH APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE
            ANTIGEN) >gi|160578 (M58547) merozoite surface antigen [Plasmodium
            falciparum]
            Length = 622

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 3.1, P = 0.95
 Identities = 17/57 (29%), Positives = 31/57 (54%), Frame = +3

Query:   105 QHSYEHSNENLNVYLPGQSYK-YVTQHSYEYLPEQMYKENNXLTDENLLLKRMIDLDH 275
             Q+ +EH  +N +VY P   ++ +  ++ Y  L E  Y++ +   DEN L +    +DH
Sbjct:    25 QNYWEHPYQNSDVYRPINEHREHPKEYEYPLLQEHTYQQEDSGEDENTL-QHAYPIDH 81


>sp|P08016|EGGS_SCHMA PUTATIVE EGGSHELL PROTEIN >pir||A54530 eggshell protein -
            fluke (Schistosoma mansoni) (fragment) >gi|160977 (M15371) egg
            shell protein [Schistosoma mansoni]
            Length = 149

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 4.4, P = 0.99
 Identities = 16/51 (31%), Positives = 27/51 (52%), Frame = +3

Query:    51 YRYSKEEEEKYLHGELYEQHSY--EHSNENLNVYLPGQSYKYVTQHS-YEY 194
             Y Y K  ++K+ HG+ YE++ Y  E+S    + Y     Y Y +++  Y Y
Sbjct:    55 YGYDKYGDDKHGHGKDYEKYGYTKEYSKNYKDYYKKYDKYDYGSRYEKYSY 105


>sp|P15515|HIS1_HUMAN HISTATIN 1 PRECURSOR (HISTIDINE-RICH PROTEIN 1) (POST-PB
            PROTEIN) (PPB) (CONTAINS: HISTATIN 2) >pir||A32541 histatin 1
            precursor - human >gi|184054 (L05512) histatin 1 [Homo sapiens]
            >gi|292144 (M26664) histatin 1 [Homo sapiens]
            Length = 57

  Plus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 5.1, P = 0.99
 Identities = 16/53 (30%), Positives = 24/53 (45%), Frame = +3

Query:    12 FFFFHIFLFPIILYRYSKEEEEKYLHGELYEQHSYEHSNENLNVYLP-GQSYKY 170
             FF F + L  +++   S +  EK  HG   + H   HS+     Y   G +Y Y
Sbjct:     3 FFVFALVL-ALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLY 55


>gnl|PID|e220212 (X95276) ORF105 [Plasmodium falciparum]
            Length = 121

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.6, P = 1.0
 Identities = 13/45 (28%), Positives = 23/45 (51%), Frame = +1

Query:     1 GTRYSFFFIYFCFPLFYIDIQKKKKKNICMENYTNNTLMNTAMKI 135
             G+   F FI+ C  +   ++  K KKN+ ++ + N  + N   KI
Sbjct:     2 GSNPIFSFIFLCIIIMIFNLYYKLKKNLLLKKFKNIQINNNIKKI 46


>gnl|PID|d1021566 (AB001684) ORF51c [Chlorella vulgaris]
            Length = 51

  Plus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 6.9, P = 1.0
 Identities = 11/23 (47%), Positives = 14/23 (60%), Frame = +1

Query:    13 SFFFIYFCFPLFYIDIQKKKKKN 81
             SF  I+  F  F+   +KKKKKN
Sbjct:    29 SFILIFLIFFSFFFSKKKKKKKN 51


>gnl|PID|d1021580 (AB001684) ORF54d [Chlorella vulgaris]
            Length = 54

  Minus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 9.5, P = 1.0
 Identities = 16/40 (40%), Positives = 25/40 (62%), Frame = -3

Query:   131 FIAVFIRVLF--V*FSMQIFFFFFF*ISI*NNGKQKYMKKK 15
             F+   +++LF  + F   IFFFFFF + +    K+K +KKK
Sbjct:     6 FVLKPLKLLFSLMFFFFLIFFFFFF-LFVFFFTKKKQIKKK 45


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.96
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.323   0.140   0.428
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.385   0.178   0.656
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.358   0.162   0.553
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.346   0.152   0.540
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.355   0.160   0.540
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.409   0.199   0.797
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      116       111      10. 60 3  12 22    0.12 32
                                                  29    0.12 34
   +2      0      117       112      10. 60 3  12 22    0.12 32
                                                  29   0.096 35
   +1      0      117       112      10. 60 3  12 22    0.12 32
                                                  29   0.096 35
   -1      0      117       112      10. 60 3  12 22    0.12 32
                                                  29   0.096 35
   -2      0      117       113      10. 60 3  12 22    0.12 32
                                                  29   0.097 35
   -3      0      116       113      10. 60 3  12 22    0.12 32
                                                  29   0.097 35


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  14
  No. of states in DFA:  591 (58 KB)
  Total size of DFA:  147 KB (192 KB)
  Time to generate neighborhood:  0.01u 0.01s 0.02t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  80.58u 0.64s 81.22t  Elapsed: 00:00:21
  Total cpu time:  80.63u 0.66s 81.29t  Elapsed: 00:00:21
  Start:  Sat Feb  7 04:36:49 1998   End:  Sat Feb  7 04:37:10 1998

Date: 17:10:16 on Mon 18 Dec 117.