blastx_gbnr_files/504508_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  504508
        (234 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|507789            (L28825) antigen [Plasmodium falc... +3   215  9.2e-17   1
A gi|558071            (U08851) polymorphic antigen [Pla... +3   215  1.3e-16   1
A gi|558073            (U08852) polymorphic antigen [Pla... +3   215  1.3e-16   1
A gi|507791            (L07944) polymorphic antigen [Pla... +3   215  1.3e-16   1
A gi|2558930           (AF024624) merozoite surface prot... +3    89  0.0011    1
A gi|1197667           (U46857) vitellogenin [Anolis pul... -3    90  0.0016    1
A gnl|PID|e317491      (Z95620) unknown [Schizosaccharom... -3    94  0.0018    1
A sp|P53214|YG1F_YEAST HYPOTHETICAL 57.5 KD PROTEIN IN V... -3    92  0.0068    1
A gnl|PID|d1014443     (D89043) serine repeat antigen [P... -3    84  0.013     1
A gnl|PID|d1014446     (D89046) serine repeat antigen [P... -3    84  0.014     1
A gi|1197665           (U46856) vitellogenin [Anolis pul... -3    82  0.016     1
A dbj||D89103_1        (D89103) unnamed protein product ... -3    84  0.022     1
A gi|295671            (L11275) selected as a weak suppr... -3    84  0.032     1
A sp|P32583|SR40_YEAST SUPRESSOR PROTEIN SRP40 >pir||S38... -3    84  0.032     1
A sp|P36027|MID2_YEAST MATING PROCESS PROTEIN MID2 (SERI... -3    83  0.037     1
A gnl|PID|d1014448     (D89048) serine repeat antigen [P... -3    77  0.081     1
A prf||1921322A        polyserin [Homo sapiens]             -3    71  0.086     1
A gi|552180            (M21323) parasite protein [Plasmo... -3    79  0.089     1
A pir||A54512          serine-repeat antigen (clone 366)... -3    79  0.090     1
A gi|160687            (J03983) serine rich protein (SER... -3    84  0.093     1
A gi|212879            (K02113) Gallus gallus vitellogen... -3    76  0.11      1
A sp|P53301|YG46_YEAST HYPOTHETICAL 52.8 KD PROTEIN IN B... -3    80  0.11      1
A sp|P38190|YBF3_YEAST VERY HYPOTHETICAL 13.2 KD PROTEIN... -3    69  0.14      1
A pir||S59634          endo-1,4-beta-xylanase (EC 3.2.1.... -3    80  0.14      1
A gi|1103869           (U39815) surface coat glycoprotei... -3    71  0.19      1
A sp|P53189|YGC8_YEAST HYPOTHETICAL 56.4 KD PROTEIN IN R... -3    78  0.19      1
A pir||S51892          probable membrane protein YOL105c... -3    78  0.20      1
A sp|P40954|CHI3_CANAL CHITINASE 3 PRECURSOR >gi|571429 ... -3    78  0.20      1
A sp|P31569|YCF2_OENVI HYPOTHETICAL PROTEIN (ORF 2280) >... +3    64  0.22      2
A sp|P31568|YCF2_OENPI HYPOTHETICAL PROTEIN (ORF 2280) >... +3    65  0.23      2
A gi|2408006           (Z99161) hypothetical protein [Sc... -3    77  0.23      1
A sp|P34735|YLU2_PICAN HYPOTHETICAL PROTEIN IN LEU2 3'RE... -3    75  0.24      1
A gi|436923            (U01849) ORF1 [Trypanosoma brucei]   -2    68  0.26      1
A sp|P53832|YN23_YEAST HYPOTHETICAL 52.3 KD PROTEIN IN M... -3    76  0.27      1
A gnl|PID|d1014671     (D89547) vitellogenin I [Gallus g... -3    82  0.28      1
A pir||S67570          hypothetical protein YDL037c - ye... -3    73  0.31      1
A gi|347502            (L22173) putative [Saccharomyces ... -3    73  0.34      1
A sp|P32623|UTR2_YEAST UTR2 PROTEIN (UNKNOWN TRANSCRIPT ... -3    73  0.34      1
A sp|P53269|YG31_YEAST HYPOTHETICAL 27.2 KD PROTEIN IN C... -3    71  0.35      1
A gnl|PID|d1021604     (AB002306) KIAA0308 [Homo sapiens]   -3    79  0.36      1
A gnl|PID|d1014442     (D89042) serine repeat antigen [P... -3    70  0.43      1
A pir||E64441          hypothetical protein MJ1134 - Met... +3    52  0.44      2
A gi|2232272           (AF005405) B2-aldehyde-forming en... -3    68  0.45      1
A pir||S30839          UTR2 protein - yeast (Saccharomyc... -3    73  0.45      1
A gi|1684843           (U77717) pinin [Bos taurus]          -3    75  0.46      1
A pir||I53073          fetal troponin T 2 - rat (fragmen... +3    63  0.47      1
A sp|P10476|GUNA_PSEFL ENDOGLUCANASE A PRECURSOR (ENDO-1... -3    76  0.49      1
A sp|P53882|YNR6_YEAST HYPOTHETICAL 67.4 KD PROTEIN IN R... -3    74  0.50      1
A gnl|PID|e312887      (Z72946) ORF YGR159c [Saccharomyc... -3    67  0.50      1
A gi|459202            (U07055) vitellogenin 1 [Fundulus... -3    78  0.54      1
A sp|P40472|SIM1_YEAST SIM1 PROTEIN >pir||S49886 probabl... -3    72  0.55      1
A gnl|PID|e332357      (Z98254) 114E2.b [Drosophila mela... -3    73  0.55      1
A pir||S61993          probable membrane protein YOR009w... -3    72  0.56      1
A pir||C61615          sericin MG-2 - greater wax moth (... -3    69  0.57      1
A sp|P40442|YIQ9_YEAST HYPOTHETICAL 99.7 KD PROTEIN IN S... -3    75  0.59      1
A sp|P28284|ICP0_HSV2H TRANS-ACTING TRANSCRIPTIONAL PROT... -3    74  0.61      1
A gnl|PID|e304193      (Z86099) RL2 [human herpesvirus 2]   -3    74  0.61      1
A sp|P42835|EGT2_YEAST EGT2 PROTEIN PRECURSOR (EARLY G1 ... -3    75  0.61      1
A pir||S46404          vitellogenin - yellow fever mosqu... -3    78  0.63      1
A pir||A56657          PfEMP2/MESA protein (clone 9025/1... +3    62  0.63      1
A gi|1513292           (U66523) ORFveg113; similar to ly... -3    66  0.63      1
A gi|790835            (L41842) vitellogenin [Aedes aegy... -3    78  0.63      1
A pir||D61615          sericin MG-1 - greater wax moth (... -3    61  0.64      1
A pir||S03386          antigen (clone 22) - Plasmodium f... +3    61  0.64      1
A gi|643117            (X80879) orf3 gene product [unide... -3    61  0.64      1
A sp|P14328|SP96_DICDI SPORE COAT PROTEIN SP96 >pir||S07... -3    72  0.65      1
A gi|1684847           (U77718) pinin [Homo sapiens]        -3    73  0.65      1
A pir||A35419          neutrophil protein - pig (fragmen... -3    68  0.66      1
A gi|552181            (M21324) parasite protein [Plasmo... -3    62  0.69      1
A sp|P54867|SLG1_YEAST SLG1 PROTEIN PRECURSOR >pir||S619... -3    69  0.71      1
A gi|2565091           (U80761) CTG26 alternate open rea... -3    61  0.72      1
A sp|P53308|YG4U_YEAST HYPOTHETICAL 11.9 KD PROTEIN IN D... -3    60  0.73      1
A sp|P02845|VIT2_CHICK VITELLOGENIN II PRECURSOR (CONTAI... -3    76  0.75      1
A pir||I50441          vitellogenin - chicken >gi|212881... -3    76  0.75      1
A gi|726397            (U23173) K07E1.1 gene product [Ca... -2    51  0.75      2
A pir||S28974          vitellogenin precursor - silver l... -3    74  0.75      2
A gi|1684845           (U77716) pinin [Canis familiaris]    -3    72  0.76      1
A gnl|PID|e348088      (Z78059) C34B4.2 [Caenorhabditis ... -3    58  0.79      2
A gnl|PID|d1012542     (D83268) vitellogenin [Athalia ro... -3    62  0.79      1
A sp|Q04503|DP87_DICDI PRESPORE PROTEIN DP87 PRECURSOR >... -3    70  0.79      1
A gi|392799            (U00691) G5/D6 ORF [Dictyostelium... +3    64  0.80      1
A pir||S61704          probable transcription factor YPL... -3    68  0.81      1
A sp|P32323|AGA1_YEAST A-AGGLUTININ ATTACHMENT SUBUNIT P... -3    71  0.81      1
A gi|2105341           (U86945) similar to variola A38R ... -3    68  0.82      1
A gi|2580460           (U19729) Ylr391w-ap [Saccharomyce... -3    65  0.82      1
A gi|1226309           (U50312) B0222.1 gene product [Ca... -3    66  0.83      1
A sp|P18126|GUNB_PSEFL ENDOGLUCANASE B PRECURSOR (ENDO-1... -3    69  0.84      1
A gi|529204            (U12964) serine-rich [Caenorhabdi... -3    62  0.85      1
A gi|695502            (Z48544) ZK945.10 [Caenorhabditis... -3    70  0.86      1
A sp|P17260|KRE1_YEAST KRE1 PROTEIN PRECURSOR >pir||A346... -3    66  0.87      1
A pir||S02708          troponin T - fruit fly (Drosophil... +3    67  0.88      1
A sp|P20962|THYP_HUMAN PARATHYMOSIN >pir||A32264 parathy... +3    58  0.88      1
A pir||S48660          troponin T 1, fast skeletal muscl... +3    58  0.88      1
A gnl|PID|e300478      (Z84818) GP80 [Bovine herpesvirus 4] -3    65  0.88      1
A sp|P53753|YN96_YEAST HYPOTHETICAL 121.1 KD PROTEIN IN ... -3    72  0.88      1
A sp|P19351|TRT_DROME  TROPONIN T, SKELETAL MUSCLE (UPHE... +3    67  0.89      1
A pir||S13251          troponin T - fruit fly (Drosophil... +3    67  0.89      1
A sp|Q08193|YOD0_YEAST HYPOTHETICAL 51.9 KD PROTEIN IN M... -3    68  0.89      1
A pir||I48694          probable transcription factor NFE... -3    70  0.89      1
A gi|1794254           (U67916) dentin sialophosphoprote... -3    71  0.90      1
A gi|684938            (U20661) unknown [Dictyostelium d... -3    67  0.90      1
A gi|1255424           (U53154) C33G8.3 gene product [Ca... +3    60  0.91      1
A pir||S53465          flocculation protein FLO1 precurs... -3    73  0.91      1
A sp|Q09625|YS8A_CAEEL HYPOTHETICAL 84.3 KD PROTEIN ZK94... -3    70  0.91      1
A sp|P47178|YJ9O_YEAST HYPOTHETICAL 29.5 KD PROTEIN IN R... -3    65  0.91      1
A gi|2267235           (U69874) delayed anaerobic 1 [Sac... -3    65  0.91      1
A sp|P39738|FLID_BACSU FLAGELLAR HOOK-ASSOCIATED PROTEIN... -3    55  0.91      2
A gi|1762345           (U56901) flagellar hook-associate... -3    55  0.91      2
A gi|1181373           (U42580) Ser-rich [Paramecium bur... -3    61  0.91      1
A sp|P53880|YNR9_YEAST HYPOTHETICAL 17.6 KD PROTEIN IN N... -2    60  0.92      1
A gi|1163086           (U43510) microfilarial sheath pro... -3    63  0.92      1
A sp|P38894|FLO5_YEAST FLOCCULATION PROTEIN FLO5 PRECURS... -3    71  0.93      1
A gi|2307004           (AF011923) tropomyosin-like prote... +3    60  0.93      1
A sp|P22865|US45_LACLA SECRETED 45 KD PROTEIN PRECURSOR ... -3    67  0.93      1
A gi|2062609           (U85969) middle molecular weight ... +3    61  0.93      2
A sp|P40552|YIB1_YEAST HYPOTHETICAL 26.3 KD PROTEIN IN P... -3    64  0.93      1
A sp|P04550|THYP_RAT   PARATHYMOSIN (ZINC-BINDING 11.5 K... +3    57  0.93      1
A prf||1514113A        Zn binding protein [Rattus norveg... +3    57  0.93      1
A sp|P08814|THYP_BOVIN PARATHYMOSIN                         +3    57  0.93      1
A gi|587436            (X79855) troponin T [Homo sapiens]   +3    57  0.93      1
A gi|206033            (M33025) parathymosin [Rattus nor... +3    57  0.93      1
A sp|P38844|YHU3_YEAST HYPOTHETICAL 33.4 KD PROTEIN IN R... -3    65  0.94      1
A sp|P18709|VTA2_XENLA VITELLOGENIN A2 PRECURSOR (VTG A2... -3    73  0.94      1
A pir||S19652          cellodextrinase C - Pseudomonas f... -3    69  0.94      1
A sp|P27033|GUNC_PSEFL ENDOGLUCANASE C PRECURSOR (ENDO-1... -3    69  0.94      1
A sp|Q01042|IE68_HSVSA IMMEDIATE-EARLY PROTEIN >pir||EDB... +3    66  0.94      1
A prf||1804350B        ECLF2 upstream ORF [saimirine her... +3    66  0.94      1
A gi|313757            (Y00354) vitellogenin A2 precurso... -3    73  0.95      1
A dbj||D89125_1        (D89125) unnamed protein product ... -3    64  0.95      1
A pir||S30385          G9a protein - human >gi|287865 (X... +3    70  0.96      1
A pir||E48338          hypothetical protein orf71 - equi... -3    57  0.96      1
A gi|406446            (U02192) Homology to surface prot... -2    57  0.96      1
A sp|Q10020|YSX1_CAEEL HYPOTHETICAL 14.2 KD PROTEIN T28D... +3    58  0.96      1
A sp|P39712|YAG3_YEAST HYPOTHETICAL 138.1 KD PROTEIN IN ... -3    71  0.96      1
A gi|2252837           (AF013293) No definition line fou... +3    46  0.96      2
A sp|P53935|YNJ1_YEAST HYPOTHETICAL 141.5 KD PROTEIN IN ... +1    44  0.97      3
A gi|2258370           (AF007261) haem lyase [Reclinomon... -2    49  0.97      2
A pir||S51959          hypothetical protein YAL063 - yea... -3    71  0.97      1
A gi|2340062           (L49466) troponin T fast skeletal... +3    63  0.97      1
A pir||A31512          parathymosin - bovine (fragments)    +3    56  0.97      1
A gi|1181469           (U42580) A306L [Paramecium bursar... +3    56  0.97      1
A gi|1052834           (M93360) ORF UL119 [Macaca mulatt... -3    62  0.98      1
A pir||C30010          hypothetical ORF-6 protein - Saur... -2    62  0.98      1
A sp|P53335|YG5W_YEAST HYPOTHETICAL 31.3 KD PROTEIN IN T... +1    48  0.98      2
A gi|1082159           (Z68121) T24D3.1 [Caenorhabditis ... -3    61  0.98      1
A gi|520471            (U08853) transcription factor LCR... -3    65  0.98      1
A gi|507164            (U04818) PITSLRE alpha 2-4 [Homo ... +3    66  0.99      1
A sp|P36076|YKI8_YEAST HYPOTHETICAL 65.2 KD PROTEIN IN M... +3    66  0.99      1
A gi|1522691           (U63111) dentin phosphoprotein pr... -3    62  0.99      1
A gi|2062611           (U85970) middle molecular weight ... +3    57  0.99      2
A gnl|PID|e276496      (Z81312) unknown [Schizosaccharom... -3    64  0.99      1
A pir||S59310          probable membrane protein YMR317w... -3    69  0.99      1
A pir||S63665          titin protein - human (fragment)     -3    55  0.99      1
A pir||I51116          NF-180 - sea lamprey >gi|632549 (... +3    69  0.99      1
A sp|Q04893|YM96_YEAST HYPOTHETICAL 113.1 KD PROTEIN IN ... -3    69  0.99      1
A bbs|178390           (S82450) vitellogenin=phosphoglyc... -3    64  0.991     1
A sp|Q99457|NPL3_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIK... -3    65  0.992     1
A pir||S66852          hypothetical protein YOL155c - ye... -3    68  0.992     1
A sp|P00164|CYB_TRYBB  CYTOCHROME B >pir||CBUTB ubiquino... -2    48  0.993     2
A gnl|PID|e263523      (Z79639) F54E4.3 [Caenorhabditis ... +2    43  0.993     2
A gnl|PID|d1014444     (D89044) serine repeat antigen [P... -3    61  0.993     1
A gi|1177622           (X89715) AOF1001 gene product [Sa... -3    68  0.994     1
A gnl|PID|d1012134     (D79215) fibroblast growth factor... -3    60  0.995     1
A sp|P26632|EGR1_BRARE EARLY GROWTH RESPONSE PROTEIN 1 (... -3    51  0.995     2
A sp|P46335|YXBE_BACSU HYPOTHETICAL 23.1 KD PROTEIN IN H... -3    60  0.995     1
A gi|4814              (X66245) YJU1 gene product [Sacch... -3    60  0.995     1
A pir||JC4525          nucleic acid-binding protein E5.1... -3    62  0.995     1
A sp|P13816|GARP_PLAFF GLUTAMIC ACID-RICH PROTEIN PRECUR... +3    66  0.995     1
A gnl|PID|d1020704     (AB003521) flocculin [Saccharomyc... -3    67  0.995     1
A gnl|PID|d1014445     (D89045) serine repeat antigen [P... -3    60  0.996     1
A gnl|PID|d1014447     (D89047) serine repeat antigen [P... -3    60  0.996     1
A gi|2605632           (D89996) NTAK alpha2 [Rattus rattus] -3    67  0.996     1
A gi|2605630           (D89995) NTAK alpha1 [Rattus rattus] -3    67  0.996     1
A sp|P44139|YC53_HAEIN HYPOTHETICAL PROTEIN HI1253 >pir|... -1    44  0.996     2
A gi|2081630           (U20661) unknown [Dictyostelium d... -3    67  0.996     1
A sp|P47033|YJH8_YEAST HYPOTHETICAL 89.2 KD PROTEIN IN S... -3    67  0.996     1
A sp|Q01565|GSQD_ERWCH GENERAL SECRETION PATHWAY PROTEIN... -3    66  0.996     1
A gnl|PID|e250310      (Z75553) ZC443.4 [Caenorhabditis ... +3    63  0.997     1
A pir||S51910          cryptogene protein G4 - Sauroleis... -2    58  0.997     1
A gnl|PID|e288614      (Z83122) R11A5.1 [Caenorhabditis ... +3    67  0.997     1
A gi|343544            (M33228) ATPase 6 [Trypanosoma br... -2    60  0.997     1
A pir||S62361          squamosa-promoter binding protein... +3    58  0.997     1
A gi|1492089           (U60315) MC146R [Molluscum contag... -3    63  0.998     1
A gi|507162            (U04817) PITSLRE alpha 2-3 [Homo ... +3    66  0.998     1
A gi|507429            (U07705) PITSLRE isoform PBETA22 ... +3    66  0.998     1
A pir||A55237          transcription factor E2F-4 - huma... -3    63  0.998     1
A gi|507160            (U04816) PITSLRE alpha 2-2 [Homo ... +3    66  0.998     1
A gi|507427            (U07704) PITSLRE isoform PBETA21 ... +3    66  0.998     1
A gi|2313831           (AE000583) H. pylori predicted co... -1    43  0.998     2
A gi|507168            (U04824) PITSLRE alpha 2-1 [Homo ... +3    66  0.998     1
A gnl|PID|e334256      (Z98595) putative glycolipid anch... -3    64  0.998     1
A pir||A55817          cyclin-dependent kinase p130-PITS... +3    66  0.998     1
A sp|Q09441|YP83_CAEEL HYPOTHETICAL 139.1 KD PROTEIN C08... +3    68  0.998     1
A gnl|PID|d1021635     (AB002337) KIAA0339 [Homo sapiens]   -3    68  0.999     1
A gi|340613            (L07545) A 'c' was inserted after... -2    62  0.999     1
A gnl|PID|e315099      (Y13050) hunchback zinc finger pr... -3    66  0.999     1
A sp|P54639|CYS4_DICDI CYSTEINE PROTEINASE 4 PRECURSOR >... -3    63  0.999     1
A gnl|PID|e327027      (Z97342) resistance gene homolog ... +3    62  0.999     1
A gi|587438            (X79856) troponin T [Homo sapiens]   +3    57  0.9990    1
A gi|2209115           (AF004294) myelin transcription f... +3    67  0.9991    1
A sp|Q03674|PLB2_YEAST PUTATIVE LYSOPHOSPHOLIPASE PRECUR... -3    65  0.9992    1
A pir||S74260          troponin T1f, fast skeletal muscl... +3    53  0.9993    1
A pir||I66796          fetal troponin T 3 - rat (fragmen... +3    53  0.9993    1
A gi|1294789           (L76261) ND3 gene product [Meloid... -1    53  0.9993    1
A gnl|PID|e234456      (Z70684) F28D1.2 [Caenorhabditis ... +3    60  0.9993    1
A gi|2257949           (AF006052) beta-1,4-endoglucanase... -3    63  0.9994    1
A gi|1825751           (U88311) similar to UDP-glucurono... -3    48  0.9994    2
A dbj||D89208_1        (D89208) similar to Saccharomyces... -3    61  0.9995    1
A pir||A49672          transcription factor Nrf1 - human    -3    65  0.9995    1
A gi|793929            (U24265) special lobe-specific pr... -3    65  0.9995    1
A gnl|PID|e309990      (Z82052) T25E12.e [Caenorhabditis... +3    63  0.9995    1
A gnl|PID|e324949      (Y14079) hypothetical protein [Ba... -3    63  0.9995    1
A sp|Q04635|ESC1_SCHPO ESC1 PROTEIN >pir||S28066 esc1 pr... -3    62  0.9996    1
A pir||A55004          transcription factor TFC11 - huma... -3    65  0.9996    1
A gnl|PID|e304709      (Z35948) ORF YBR078w [Saccharomyc... -3    59  0.9997    1
A sp|P03161|DPOL_HPBGS DNA POLYMERASE (A PROTEIN) >pir||... -1    48  0.9998    2
A gnl|PID|d1007782     (D37989) Om(1E) protein [Drosophi... -3    63  0.9998    1
A gi|550444            (L21710) 58 kDa phosphoprotein [P... +3    59  0.9998    1
A sp|P34375|YLM1_CAEEL HYPOTHETICAL 12.0 KD PROTEIN D200... -3    53  0.9998    1
A gi|1621359           (U70826) vitellogenin II precurso... -3    68  0.9999    1
A sp|P53862|YNW8_YEAST HYPOTHETICAL 28.6 KD PROTEIN IN U... -3    59  0.9999    1
A sp|P36127|YK12_YEAST HYPOTHETICAL 12.4 KD PROTEIN IN S... +1    52  0.99990   1
A pir||S48790          troponin T, cardiac muscle (clone... +3    52  0.99990   1
A pir||QFBO            micro glutamic acid-rich protein ... +3    52  0.99990   1
A gnl|PID|d1021481     (AB001684) ORF67 [Chlorella vulga... -1    52  0.99990   1
A gi|2570557           (AF023215) anti-fluorescein monoc... -3    52  0.99990   1
A gnl|PID|e302832      (Y08769) microvascular endothelia... +1    54  0.99991   1
A sp|P33322|CBF5_YEAST CENTROMERE/MICROTUBULE BINDING PR... +1    48  0.99992   2
A sp|P46060|RGP1_HUMAN RAN GTPASE ACTIVATING PROTEIN 1 >... +3    63  0.99992   1
A gi|1778865           (U83248) GtpA [Dictyostelium disc... -3    59  0.99994   1
A sp|P54681|RTOA_DICDI RTOA PROTEIN (RATIO-A) >gi|120601... -3    61  0.99994   1
A sp|P38739|YHC8_YEAST HYPOTHETICAL 63.8 KD PROTEIN IN G... -3    63  0.99994   1



>gi|507789 (L28825) antigen [Plasmodium falciparum]
           Length = 354

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 9.2e-17, P = 9.2e-17
 Identities = 46/63 (73%), Positives = 46/63 (73%), Frame = +3

Query:    33 ENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ENMLSHLYVS KDK  ISKEN DVLDEK  E EETEEE LEEKN  ET SEI ED E  E
Sbjct:   209 ENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEE 268

Query:   213 VXE 221
               E
Sbjct:   269 EEE 271

 Score = 182 (64.1 bits), Expect = 5.0e-13, P = 5.0e-13
 Identities = 46/76 (60%), Positives = 46/76 (60%), Frame = +3

Query:    33 ENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ENMLSHLYVS KDK  ISKEN DVLDEK  E EETEEE LEEKN  ET SEI ED E  E
Sbjct:   209 ENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEE 268

Query:   213 VXE------------- 221
               E             
Sbjct:   269 EEEEKEEENDKKKEQE 284


>gi|558071 (U08851) polymorphic antigen [Plasmodium falciparum]
           Length = 379

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 1.3e-16, P = 1.3e-16
 Identities = 46/63 (73%), Positives = 46/63 (73%), Frame = +3

Query:    33 ENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ENMLSHLYVS KDK  ISKEN DVLDEK  E EETEEE LEEKN  ET SEI ED E  E
Sbjct:   235 ENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEE 294

Query:   213 VXE 221
               E
Sbjct:   295 EEE 297


>gi|558073 (U08852) polymorphic antigen [Plasmodium falciparum]
           Length = 379

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 1.3e-16, P = 1.3e-16
 Identities = 46/63 (73%), Positives = 46/63 (73%), Frame = +3

Query:    33 ENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ENMLSHLYVS KDK  ISKEN DVLDEK  E EETEEE LEEKN  ET SEI ED E  E
Sbjct:   235 ENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEE 294

Query:   213 VXE 221
               E
Sbjct:   295 EEE 297


>gi|507791 (L07944) polymorphic antigen [Plasmodium falciparum]
           Length = 380

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 1.3e-16, P = 1.3e-16
 Identities = 46/63 (73%), Positives = 46/63 (73%), Frame = +3

Query:    33 ENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ENMLSHLYVS KDK  ISKEN DVLDEK  E EETEEE LEEKN  ET SEI ED E  E
Sbjct:   236 ENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEE 295

Query:   213 VXE 221
               E
Sbjct:   296 EEE 298


>gi|2558930 (AF024624) merozoite surface protein 3 [Plasmodium falciparum]
            Length = 64

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.0011, P = 0.0011
 Identities = 18/21 (85%), Positives = 18/21 (85%), Frame = +3

Query:    33 ENMLSHLYVSXKDKXXISKEN 95
             ENMLSHLYVS KDK  ISKEN
Sbjct:    43 ENMLSHLYVSSKDKENISKEN 63


>gi|1197667 (U46857) vitellogenin [Anolis pulchellus]
            Length = 182

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.0016, P = 0.0016
 Identities = 26/44 (59%), Positives = 28/44 (63%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S TS  SSSS  SD  SSS  SS SSSS SS SS  SS++S  S
Sbjct:    78 SSTSSDSSSSSSSDSSSSSSDSSSSSSSDSSSSSSDSSSSSSDS 121

 Score = 87 (30.6 bits), Expect = 0.0035, P = 0.0035
 Identities = 27/56 (48%), Positives = 32/56 (57%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSS-XSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  SSSS  SD  SSS  S  SSSS SS  SS  SS++S  S D  S S  ++
Sbjct:    52 SSSSDKSSSSSSSDSSSSSSSSDSSSSSTSSDSSSSSSSDSSSSSSDSSSSSSSDS 107

 Score = 86 (30.3 bits), Expect = 0.0045, P = 0.0045
 Identities = 25/51 (49%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  SD  SSS  S  SSSS S  SS  S ++S  S D  S S
Sbjct:    61 SSSSDSSSSSSSSDSSSSSTSSDSSSSSSSDSSSSSSDSSSSSSSDSSSSS 111

 Score = 86 (30.3 bits), Expect = 0.0045, P = 0.0045
 Identities = 27/51 (52%), Positives = 30/51 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  SD  SSS  SS SSSS S  SS  SS++S  S D  S S
Sbjct:    70 SSSSDSSSSSTSSDSSSSS--SSDSSSSSSDSSSSSSSDSSSSSSDSSSSS 118

 Score = 85 (29.9 bits), Expect = 0.0058, P = 0.0058
 Identities = 23/41 (56%), Positives = 27/41 (65%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  +SSS  SD  SSS  SS SSSS SS SS  SS++S
Sbjct:   140 SSSSSSASSSSSSDSSSSSSSSSHSSSSDSSSSSSHSSSSS 180

 Score = 84 (29.6 bits), Expect = 0.0076, P = 0.0076
 Identities = 27/52 (51%), Positives = 30/52 (57%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSS-XFSSNTSXFSLDIXSLS 68
             S +S  SSSS  SD  SSS  SS SSS  SS SS   SS++S  S D  S S
Sbjct:    93 SSSSSDSSSSSSSDSSSSSSDSSSSSSDSSSSSSDSSSSDSSSSSSDSSSSS 144

 Score = 83 (29.2 bits), Expect = 0.0099, P = 0.0099
 Identities = 28/53 (52%), Positives = 30/53 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSX----FSSNTSXFSLDIXS 74
             S TS  SSSS  SD  SSS  SS SSSS SS SS      SS++S  S D  S
Sbjct:    78 SSTSSDSSSSSSSDSSSSSSDSSSSSSSDSSSSSSDSSSSSSDSSSSSSDSSS 130

 Score = 81 (28.5 bits), Expect = 0.017, P = 0.017
 Identities = 23/44 (52%), Positives = 27/44 (61%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SS S  SD  SSS  SS SSS+ SS SS  SS++S  S
Sbjct:   119 SDSSSSSSDSSSSDSSSSSSDSSSSSSASSSSSSDSSSSSSSSS 162

 Score = 81 (28.5 bits), Expect = 0.017, P = 0.017
 Identities = 25/49 (51%), Positives = 28/49 (57%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +S  SSSS  S   SSS  SS SSSS SS SS  S ++S  S D  S S
Sbjct:    48 SSSSSSSSDKSSSSSSSDSSSSSSSSDSSSSSTSSDSSSSSSSDSSSSS 96

 Score = 81 (28.5 bits), Expect = 0.017, P = 0.017
 Identities = 25/51 (49%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S   SSS  SD  SSS   S SSSS SS SS  SS++S  S    S S
Sbjct:    85 SSSSSSDSSSSSSDSSSSSSSDSSSSSSDSSSSSSDSSSSSSDSSSSDSSS 135

 Score = 80 (28.2 bits), Expect = 0.022, P = 0.022
 Identities = 24/55 (43%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S   SSS  SD  SSS  SS SSS  SS  S  SS+ S  S    S S  ++
Sbjct:   100 SSSSSSDSSSSSSDSSSSSSDSSSSSSDSSSSDSSSSSSDSSSSSSASSSSSSDS 154

 Score = 78 (27.5 bits), Expect = 0.037, P = 0.036
 Identities = 24/51 (47%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SS S SS S   SS++   S D  S S
Sbjct:    87 SSSSDSSSSSSDSSSSSSSDSSSSSSDSSSSSSDSSSSSSDSSSSDSSSSS 137

 Score = 77 (27.1 bits), Expect = 0.048, P = 0.047
 Identities = 24/51 (47%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S   SSS  SD  SSS  SS SSS  SS SS  S ++S  S    S S
Sbjct:   126 SDSSSSDSSSSSSDSSSSSSASSSSSSDSSSSSSSSSHSSSSDSSSSSSHS 176

 Score = 75 (26.4 bits), Expect = 0.081, P = 0.078
 Identities = 24/51 (47%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   S S  SS +SSS SS SS  SS++S  S    S S
Sbjct:   122 SSSSSDSSSSDSSSSSSDSSSSSSASSSSSSDSSSSSSSSSHSSSSDSSSS 172

 Score = 75 (26.4 bits), Expect = 0.081, P = 0.078
 Identities = 27/51 (52%), Positives = 30/51 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S   SSS  SD  SSS  SS SSSS SS SS  SS++S  S D  S S
Sbjct:   126 SDSSSSDSSSSSSDSSSSSSASS-SSSSDSSSSSSSSSHSS--SSDSSSSS 173

 Score = 74 (26.0 bits), Expect = 0.10, P = 0.099
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S TS  +SSS  S    SS  SS  SSS SS S   SS+TS  S
Sbjct:    41 SDTSSDTSSSSSSSSDKSSSSSSSDSSSSSSSSDSSSSSTSSDS 84

 Score = 74 (26.0 bits), Expect = 0.10, P = 0.099
 Identities = 23/51 (45%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SS+  SS S SS SS SS  SS++   S    S S
Sbjct:   128 SSSSDSSSSSSDSSSSSSASSSSSSDSSSSSSSSSHSSSSDSSSSSSHSSS 178

 Score = 72 (25.3 bits), Expect = 0.18, P = 0.16
 Identities = 22/42 (52%), Positives = 24/42 (57%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +S  SSSS  S   SSS  SS SSSS SS  S  SS +S  S
Sbjct:    44 SSDTSSSSSSSSDKSSSSSSSDSSSSSSSSDSSSSSTSSDSS 85

 Score = 72 (25.3 bits), Expect = 0.18, P = 0.16
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSS   S    SS  SS SSSS S  SS  SS++S  S    S S
Sbjct:    97 SDSSSSSSSDSSSSSSDSSSSSSDSSSSSSDSSSSDSSSSSSDSSSSSSAS 147

 Score = 71 (25.0 bits), Expect = 0.23, P = 0.20
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SSSS  S   S+S  SS  SSS SS SS  SS+ S  S    S S
Sbjct:   129 SSSDSSSSSSDSSSSSSASSSSSSDSSSSSSSSSHSSSSDSSSSSSHSSSS 179

 Score = 71 (25.0 bits), Expect = 0.23, P = 0.20
 Identities = 24/55 (43%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S TS  +SSS  S    SS  SS  SSS SS S   SS+TS    D  S S  ++
Sbjct:    41 SDTSSDTSSSSSSSSDKSSSSSSSDSSSSSSSSDSSSSSTSS---DSSSSSSSDS 92

 Score = 69 (24.3 bits), Expect = 0.38, P = 0.32
 Identities = 22/54 (40%), Positives = 26/54 (48%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             SSS   SD  SSS  SS  SSS SS  S  SS++S  S    S     +   D+
Sbjct:    39 SSSDTSSDTSSSSSSSSDKSSSSSSSDSSSSSSSSDSSSSSTSSDSSSSSSSDS 92

 Score = 66 (23.2 bits), Expect = 0.84, P = 0.57
 Identities = 21/48 (43%), Positives = 24/48 (50%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S   +SS  S   SSS   S SSSS  S SS  SS++S  S    S S
Sbjct:    39 SSSDTSSDTSSSSSSSSDKSSSSSSSDSSSSSSSSDSSSSSTSSDSSS 86

 Score = 61 (21.5 bits), Expect = 3.0, P = 0.95
 Identities = 18/39 (46%), Positives = 21/39 (53%), Frame = -3

Query:   184 SDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SD  S +  SS SSS  SS SS   S++S  S D  S S
Sbjct:    41 SDTSSDTSSSSSSSSDKSSSSSSSDSSSSSSSSDSSSSS 79


>gnl|PID|e317491 (Z95620) unknown [Schizosaccharomyces pombe]
            Length = 309

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.0018, P = 0.0018
 Identities = 27/53 (50%), Positives = 30/53 (56%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             P S +S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    90 PSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 142

 Score = 93 (32.7 bits), Expect = 0.0023, P = 0.0023
 Identities = 26/49 (53%), Positives = 30/49 (61%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S+ I S
Sbjct:    99 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVPITS 147

 Score = 86 (30.3 bits), Expect = 0.013, P = 0.013
 Identities = 25/50 (50%), Positives = 29/50 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL 71
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S+
Sbjct:    94 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSV 143

 Score = 86 (30.3 bits), Expect = 0.013, P = 0.013
 Identities = 26/51 (50%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + TS  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    86 TTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 136

 Score = 85 (29.9 bits), Expect = 0.017, P = 0.017
 Identities = 26/51 (50%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    89 SPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 139

 Score = 85 (29.9 bits), Expect = 0.017, P = 0.017
 Identities = 26/55 (47%), Positives = 32/55 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  SSS  I+   SSS  SS SSSS SS SS  SS++S F   + S +F  T
Sbjct:   134 SSSSSSSSSVPITSSTSSSHSSSSSSSSSSSSSSRPSSSSS-FITTMSSSTFIST 187

 Score = 84 (29.6 bits), Expect = 0.022, P = 0.022
 Identities = 25/51 (49%), Positives = 30/51 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S  ++SS  SS SSSS SS SS  SS  S  S  I ++S
Sbjct:   130 SSSSSSSSSSSSSVPITSSTSSSHSSSSSSSSSSSSSSRPSSSSSFITTMS 180

 Score = 83 (29.2 bits), Expect = 0.028, P = 0.028
 Identities = 25/51 (49%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T+  S SS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    83 STTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 133

 Score = 83 (29.2 bits), Expect = 0.028, P = 0.028
 Identities = 25/51 (49%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + T+  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    85 TTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 135

 Score = 82 (28.9 bits), Expect = 0.036, P = 0.035
 Identities = 25/51 (49%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SSSSV   SS  SS++S  S    S S
Sbjct:   115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSVPITSSTSSSHSSSSSSSSSSSS 165

 Score = 80 (28.2 bits), Expect = 0.060, P = 0.058
 Identities = 24/51 (47%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T+  +S S  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    82 SSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 132

 Score = 80 (28.2 bits), Expect = 0.060, P = 0.058
 Identities = 24/51 (47%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + T+   SSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    84 TTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 134

 Score = 80 (28.2 bits), Expect = 0.060, P = 0.058
 Identities = 23/53 (43%), Positives = 29/53 (54%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             P S ++  ++S   S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    79 PSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 131

 Score = 79 (27.8 bits), Expect = 0.077, P = 0.074
 Identities = 24/51 (47%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSS+  +   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    75 SSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

 Score = 79 (27.8 bits), Expect = 0.077, P = 0.074
 Identities = 24/51 (47%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + +   SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    87 TTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 137

 Score = 78 (27.5 bits), Expect = 0.099, P = 0.094
 Identities = 22/41 (53%), Positives = 25/41 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  SSSS  S   SSS  SS SSSS SS S   +S+TS
Sbjct:   110 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVPITSSTS 150

 Score = 77 (27.1 bits), Expect = 0.13, P = 0.12
 Identities = 23/51 (45%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS  SSSS  S   +++   S SSSS SS SS  SS++S  S    S S
Sbjct:    69 STTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

 Score = 77 (27.1 bits), Expect = 0.13, P = 0.12
 Identities = 24/51 (47%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  +    SS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    74 SSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

 Score = 76 (26.8 bits), Expect = 0.16, P = 0.15
 Identities = 23/51 (45%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S   SSS  +   S S  SS SSSS SS SS  SS++S  S    S S
Sbjct:    73 SSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 123

 Score = 76 (26.8 bits), Expect = 0.16, P = 0.15
 Identities = 23/51 (45%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  S  S+++  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    77 SSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 127

 Score = 75 (26.4 bits), Expect = 0.21, P = 0.19
 Identities = 24/51 (47%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SSSS SS     SS +S  S    S S
Sbjct:   111 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVPITSSTSSSHSSSSSSSS 161

 Score = 73 (25.7 bits), Expect = 0.35, P = 0.29
 Identities = 22/51 (43%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T+  SSSS  S   +++  S  SSSS SS SS  SS++S  S    S S
Sbjct:    68 SSTTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSS 118

 Score = 73 (25.7 bits), Expect = 0.35, P = 0.29
 Identities = 24/52 (46%), Positives = 29/52 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFF-SSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS  SSSS  S   +++   SS SSSS SS SS  SS++S  S    S S
Sbjct:    69 STTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 120

 Score = 73 (25.7 bits), Expect = 0.35, P = 0.29
 Identities = 25/53 (47%), Positives = 29/53 (54%), Frame = -3

Query:   220 SXTSXXSSSS--XISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS  SSSS    S   ++S  SS SSSS SS SS  SS++S  S    S S
Sbjct:    69 STTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 121

 Score = 72 (25.3 bits), Expect = 0.44, P = 0.36
 Identities = 22/51 (43%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S SS  +   +S   SS SSSS SS SS  SS++S  S    S S
Sbjct:    72 SSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 122

 Score = 72 (25.3 bits), Expect = 0.44, P = 0.36
 Identities = 22/51 (43%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SS++  +   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    76 SSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

 Score = 71 (25.0 bits), Expect = 0.57, P = 0.43
 Identities = 22/51 (43%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SS+  ++  SSS SS SS  SS++S  S    S S
Sbjct:    66 SVSSTTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSS 116

 Score = 70 (24.6 bits), Expect = 0.73, P = 0.52
 Identities = 20/44 (45%), Positives = 26/44 (59%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SSS +S   SSS  SS SSSS ++ +S  SS++S  S    S S
Sbjct:    63 SSSSVSSTTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSS 106

 Score = 70 (24.6 bits), Expect = 0.73, P = 0.52
 Identities = 22/51 (43%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  S  +SSS  S   SSS  ++ S SS SS SS  SS++S  S    S S
Sbjct:    65 SSVSSTTSSSSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSS 115

 Score = 67 (23.6 bits), Expect = 1.6, P = 0.79
 Identities = 21/54 (38%), Positives = 30/54 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXS---SSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SSSS I+   SS+F S+ +   SSS SS SS   S+T+  +L+    S
Sbjct:   165 SSSRPSSSSSFITTMSSSTFISTVTVTPSSSSSSTSSEVPSSTAALALNASKAS 218

 Score = 65 (22.9 bits), Expect = 2.6, P = 0.92
 Identities = 19/50 (38%), Positives = 30/50 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSS-VSSXSSXFSSNTSXFSLDIXS 74
             S +S  SSSS      SSSF ++ SSS+ +S+ +   SS++S  S ++ S
Sbjct:   156 SSSSSSSSSSSSRPSSSSSFITTMSSSTFISTVTVTPSSSSSSTSSEVPS 205


>sp|P53214|YG1F_YEAST HYPOTHETICAL 57.5 KD PROTEIN IN VMA7-RPS31A INTERGENIC
            REGION >pir||S64314 probable membrane protein YGR023w - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e243927 (Z72807) ORF YGR023w
            [Saccharomyces cerevisiae]
            Length = 551

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.0068, P = 0.0068
 Identities = 26/54 (48%), Positives = 33/54 (61%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +P S TS   SSS  S+  SSS+ SS SSS++ S SS FSS++S  S    S S
Sbjct:   205 VPSSSTSSPPSSS--SELTSSSYSSSSSSSTLFSYSSSFSSSSSSSSSSSSSSS 256

 Score = 88 (31.0 bits), Expect = 0.018, P = 0.018
 Identities = 26/55 (47%), Positives = 31/55 (56%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             L   S +S  SSS+  S   S S  SS SSSS SS SS  SS++S F+L   S S
Sbjct:   220 LTSSSYSSSSSSSTLFSYSSSFSSSSSSSSSSSSSSSSSSSSSSSYFTLSTSSSS 274

 Score = 86 (30.3 bits), Expect = 0.030, P = 0.030
 Identities = 27/66 (40%), Positives = 34/66 (51%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFX-ETYK 50
             P S +S  +SSS  S   SS+ FS  SS S SS SS  SS++S  S    S  F   T  
Sbjct:   213 PPSSSSELTSSSYSSSSSSSTLFSYSSSFSSSSSSSSSSSSSSSSSSSSSSSYFTLSTSS 272

Query:    49 CDNIFS 32
               +I+S
Sbjct:   273 SSSIYS 278

 Score = 80 (28.2 bits), Expect = 0.13, P = 0.12
 Identities = 25/52 (48%), Positives = 28/52 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSF 65
             S T    SSS  S   SSS  SS SSSS SS SS F+ +TS  S    S S+
Sbjct:   231 SSTLFSYSSSFSSSSSSSSSSSSSSSSSSSSSSSYFTLSTSSSSSIYSSSSY 282

 Score = 78 (27.5 bits), Expect = 0.22, P = 0.19
 Identities = 23/45 (51%), Positives = 29/45 (64%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFF--SSXSSSSVSSXSS--XFSSNTS 98
             S +S  SSSS  S   SSS+F  S+ SSSS+ S SS   FSS++S
Sbjct:   246 SSSSSSSSSSSSSSSSSSSYFTLSTSSSSSIYSSSSYPSFSSSSS 290

 Score = 73 (25.7 bits), Expect = 0.74, P = 0.52
 Identities = 22/67 (32%), Positives = 34/67 (50%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             ++  S ++   SS   S  +SSS  +S S+SSV   SS  SS  S  S ++ S S+  + 
Sbjct:   171 VISTSSSTFTFSSESSSSLISSSISTSVSTSSVYVPSSSTSSPPSSSS-ELTSSSYSSSS 229

Query:    52 KCDNIFS 32
                 +FS
Sbjct:   230 SSSTLFS 236

 Score = 71 (25.0 bits), Expect = 1.2, P = 0.70
 Identities = 27/70 (38%), Positives = 35/70 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFF--SSXSSSSVSSXSS--XFSSN-----TSXFSLDIXSLS 68
             S +S  SSSS  S   SSS+F  S+ SSSS+ S SS   FSS+     TS  +    S S
Sbjct:   246 SSSSSSSSSSSSSSSSSSSYFTLSTSSSSSIYSSSSYPSFSSSSSSNPTSSITSTSASSS 305

Query:    67 FXETYKCDNI 38
                  +  N+
Sbjct:   306 ITPASEYSNL 315

 Score = 69 (24.3 bits), Expect = 2.0, P = 0.86
 Identities = 19/40 (47%), Positives = 24/40 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S +S  SSSS  S   SSS  SS  + S SS SS +SS++
Sbjct:   242 SSSSSSSSSSSSSSSSSSSSSSSYFTLSTSSSSSIYSSSS 281

 Score = 69 (24.3 bits), Expect = 2.0, P = 0.86
 Identities = 20/52 (38%), Positives = 28/52 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSS-SFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T   SS+S  +  ++S SF S   SSS+ + SS  SS  S  S+ + S S
Sbjct:    63 SSTDATSSASLSTPSIASVSFTSFPQSSSLLTLSSTLSSELSSSSMQVSSSS 114

 Score = 68 (23.9 bits), Expect = 2.6, P = 0.92
 Identities = 22/51 (43%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T   SSS  IS   S+  FSS SSSS+ S S   S +TS   +   S S
Sbjct:   161 SSTLSTSSSLVISTSSSTFTFSSESSSSLISSSISTSVSTSSVYVPSSSTS 211

 Score = 67 (23.6 bits), Expect = 3.3, P = 0.96
 Identities = 26/60 (43%), Positives = 28/60 (46%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             LL  S T     SS  S  VSSS  SS SS   SS SS   S +S  S  I S S   T+
Sbjct:    92 LLTLSSTLSSELSSS-SMQVSSSSTSSSSSEVTSSSSSSSISPSSSSSTIISSSSSLPTF 150

 Score = 67 (23.6 bits), Expect = 3.3, P = 0.96
 Identities = 25/66 (37%), Positives = 35/66 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSS----SVSSXSSXFSSNT--SXFSLDIXSLSFXE 59
             S  +  SSSS IS   SSS   S SSS    +V+S SS  +S+T  +  SL I + S   
Sbjct:   120 SEVTSSSSSSSISPSSSSSTIISSSSSLPTFTVASTSSTVASSTLSTSSSLVISTSSSTF 179

Query:    58 TYKCDN 41
             T+  ++
Sbjct:   180 TFSSES 185

 Score = 66 (23.2 bits), Expect = 4.2, P = 0.98
 Identities = 24/56 (42%), Positives = 30/56 (53%), Frame = -3

Query:   220 SXTSXXSSSS--XISDXVSSSFFSSX---SSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS   SSS   +S  +SS   SS    SSSS SS SS  +S++S  S+   S S
Sbjct:    82 SFTSFPQSSSLLTLSSTLSSELSSSSMQVSSSSTSSSSSEVTSSSSSSSISPSSSS 137

 Score = 65 (22.9 bits), Expect = 5.4, P = 1.0
 Identities = 22/71 (30%), Positives = 33/71 (46%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S TS   SSS ++  +SS+  S  SSSS+   SS  SS++S  +    S S   +     
Sbjct:    82 SFTSFPQSSSLLT--LSSTLSSELSSSSMQVSSSSTSSSSSEVTSSSSSSSISPSSSSST 139

Query:    40 IFSKECPMVAY 8
             I S    +  +
Sbjct:   140 IISSSSSLPTF 150

 Score = 64 (22.5 bits), Expect = 6.9, P = 1.0
 Identities = 21/53 (39%), Positives = 28/53 (52%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             +S  +S S  S  V SS  SS  SSS    SS +SS++S  +L   S SF  +
Sbjct:   192 SSISTSVSTSSVYVPSSSTSSPPSSSSELTSSSYSSSSSSSTLFSYSSSFSSS 244

 Score = 63 (22.2 bits), Expect = 8.8, P = 1.0
 Identities = 20/48 (41%), Positives = 27/48 (56%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  S+SS  S+  SSS  SS S S  SS S+  SS++S  +  + S S
Sbjct:   111 SSSSTSSSSSEVTSSS--SSSSISPSSSSSTIISSSSSLPTFTVASTS 156


>gnl|PID|d1014443 (D89043) serine repeat antigen [Plasmodium falciparum]
            Length = 233

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.013, P = 0.013
 Identities = 23/47 (48%), Positives = 28/47 (59%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             LP + T+   SSS  S   S+S  SS SSSS SS SS  SS++S  S
Sbjct:   161 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 207

 Score = 80 (28.2 bits), Expect = 0.037, P = 0.036
 Identities = 25/48 (52%), Positives = 29/48 (60%), Frame = -3

Query:   229 LPXSXT----SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             LP + T    S  SSSS  S+  SSS  SS SSSS SS SS  SS++S
Sbjct:   161 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

 Score = 77 (27.1 bits), Expect = 0.079, P = 0.076
 Identities = 22/40 (55%), Positives = 24/40 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS +
Sbjct:   171 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSES 210

 Score = 76 (26.8 bits), Expect = 0.10, P = 0.097
 Identities = 22/39 (56%), Positives = 24/39 (61%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  SSSS  S   SSS  SS SSSS SS SS  SS+ S
Sbjct:   172 SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSES 210

 Score = 72 (25.3 bits), Expect = 0.28, P = 0.25
 Identities = 20/39 (51%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S +S  SSSS  S   SSS  SS SSSS SS S    +N
Sbjct:   176 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSESLPAN 214

 Score = 67 (23.6 bits), Expect = 1.0, P = 0.64
 Identities = 24/58 (41%), Positives = 30/58 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             LP + T+   SSS  S   S+S  SS SSSS SS SS  SS++S  S         E+
Sbjct:   161 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS--------SES 210


>gnl|PID|d1014446 (D89046) serine repeat antigen [Plasmodium falciparum]
            Length = 243

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.015, P = 0.014
 Identities = 23/47 (48%), Positives = 28/47 (59%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             LP + T+   SSS  S   S+S  SS SSSS SS SS  SS++S  S
Sbjct:   161 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 207

 Score = 80 (28.2 bits), Expect = 0.040, P = 0.039
 Identities = 25/48 (52%), Positives = 29/48 (60%), Frame = -3

Query:   229 LPXSXT----SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             LP + T    S  SSSS  S+  SSS  SS SSSS SS SS  SS++S
Sbjct:   161 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 208

 Score = 77 (27.1 bits), Expect = 0.086, P = 0.082
 Identities = 22/40 (55%), Positives = 24/40 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS +
Sbjct:   171 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSES 210

 Score = 76 (26.8 bits), Expect = 0.11, P = 0.10
 Identities = 22/39 (56%), Positives = 24/39 (61%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  SSSS  S   SSS  SS SSSS SS SS  SS+ S
Sbjct:   172 SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSES 210

 Score = 72 (25.3 bits), Expect = 0.30, P = 0.26
 Identities = 20/39 (51%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S +S  SSSS  S   SSS  SS SSSS SS S    +N
Sbjct:   176 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSESLPAN 214

 Score = 67 (23.6 bits), Expect = 1.1, P = 0.66
 Identities = 24/58 (41%), Positives = 30/58 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             LP + T+   SSS  S   S+S  SS SSSS SS SS  SS++S  S         E+
Sbjct:   161 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS--------SES 210


>gi|1197665 (U46856) vitellogenin [Anolis pulchellus]
            Length = 200

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.016, P = 0.016
 Identities = 28/64 (43%), Positives = 34/64 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSSS  SD   SS  SS SSSS SS SS  SS++S  S    S S   + +  +
Sbjct:   130 SSSSDSSSSSSSSDSSDSS--SSSSSSSDSSDSSSSSSSSSDSSSSDSSRSSSRSSESSH 187

Query:    40 IFSK 29
             I  K
Sbjct:   188 ITKK 191

 Score = 80 (28.2 bits), Expect = 0.027, P = 0.027
 Identities = 23/44 (52%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  SD  SSS  S  S SS SS SS  SS++S  S
Sbjct:   121 SRSSSDSSSSSSSDSSSSSSSSDSSDSSSSSSSSSDSSDSSSSS 164

 Score = 78 (27.5 bits), Expect = 0.046, P = 0.045
 Identities = 24/49 (48%), Positives = 26/49 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S  S  SSSS  S   SSS  S  SSSS SS  S  SS++S  S D  S
Sbjct:   124 SSDSSSSSSSDSSSSSSSSDSSDSSSSSSSSSDSSDSSSSSSSSSDSSS 172

 Score = 76 (26.8 bits), Expect = 0.076, P = 0.073
 Identities = 30/60 (50%), Positives = 34/60 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S TS  SSSS  SD  SSS  SS SSSS SS SS  SS++S  S D  S S   +   D+
Sbjct:   105 SDTSSSSSSSS-SDK-SSSRSSSDSSSSSSSDSS--SSSSSSDSSDSSSSSSSSSDSSDS 160

 Score = 68 (23.9 bits), Expect = 0.60, P = 0.45
 Identities = 22/58 (37%), Positives = 28/58 (48%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             +S  SS +  S   SSS  SS  SSS SS SS   S++S  S D    S   +   D+
Sbjct:   100 SSDTSSDTSSSSSSSSSDKSSSRSSSDSSSSSSSDSSSSSSSSDSSDSSSSSSSSSDS 157

 Score = 64 (22.5 bits), Expect = 1.7, P = 0.81
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S TS  +SSS  S   SS   SS SSS  SS SS  SS++S  S
Sbjct:   101 SDTSSDTSSSSSSS--SSDKSSSRSSSDSSSSSSSDSSSSSSSS 142

 Score = 60 (21.1 bits), Expect = 4.6, P = 0.99
 Identities = 20/44 (45%), Positives = 22/44 (50%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SSS  S   SSS  SS S  S S  SS  SS++S  S    S S
Sbjct:    99 SSSDTSSDTSSSSSSSSSDKSSSRSSSDSSSSSSSDSSSSSSSS 142

 Score = 60 (21.1 bits), Expect = 4.6, P = 0.99
 Identities = 23/45 (51%), Positives = 25/45 (55%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SSS   SD  SSS  SS SS   SS SS  SS++S  S D  S S
Sbjct:    99 SSSDTSSDTSSSS--SSSSSDKSSSRSSSDSSSSS--SSDSSSSS 139


>dbj||D89103_1 (D89103) unnamed protein product [Schizosaccharomyces pombe]
            Length = 316

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.023, P = 0.022
 Identities = 27/69 (39%), Positives = 33/69 (47%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKC 47
             P S +S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S      +  
Sbjct:   160 PSSSSSKSSSSSKSSSSSSSSSKSSSSSSS-SSKSSSSSSSSSKSSASPSSSKSSSKFSS 218

Query:    46 DNIFSKECP 20
              +  +   P
Sbjct:   219 SSFITSTTP 227

 Score = 83 (29.2 bits), Expect = 0.029, P = 0.029
 Identities = 25/53 (47%), Positives = 28/53 (52%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             P S +S  SSS   S   SSS   S SSSS SS SS  SS++S  S    S S
Sbjct:   149 PSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSS 201

 Score = 77 (27.1 bits), Expect = 0.13, P = 0.12
 Identities = 25/51 (49%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  S  SSSS  S   SSS  SS S SS SS SS  SS++S  S    S S
Sbjct:   147 STPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSS 197

 Score = 76 (26.8 bits), Expect = 0.17, P = 0.15
 Identities = 28/69 (40%), Positives = 33/69 (47%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXE---- 59
             P S +S  SSS   S   SSS   S SSSS SS SS  SS++S  S    S S       
Sbjct:   149 PSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSSKSSASPS 208

Query:    58 TYKCDNIFS 32
             + K  + FS
Sbjct:   209 SSKSSSKFS 217

 Score = 75 (26.4 bits), Expect = 0.22, P = 0.19
 Identities = 26/55 (47%), Positives = 28/55 (50%), Frame = -3

Query:   226 PXSXTSXXSSS--SXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             P S +S  SSS  S  S   SSS  SS SSSS  S SS  SS+ S  S    S S
Sbjct:   149 PSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSSKS 203

 Score = 73 (25.7 bits), Expect = 0.36, P = 0.30
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  S    SS  S  SSSS SS SS  SS +S  S
Sbjct:   144 SSSSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSS 187

 Score = 71 (25.0 bits), Expect = 0.59, P = 0.44
 Identities = 23/45 (51%), Positives = 25/45 (55%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SSSS  S   SSS  S  SSSS SS SS  SS++S  S    S S
Sbjct:   144 SSSSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSS 188

 Score = 68 (23.9 bits), Expect = 1.2, P = 0.71
 Identities = 20/49 (40%), Positives = 26/49 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +S   + S I    SSS+F + SSS+ SS SS  SS+ S  S    S S
Sbjct:   123 SSTSIAPSMIGTRTSSSYFITSSSSTPSSSSSSSSSSPSSSSSKSSSSS 171

 Score = 66 (23.2 bits), Expect = 2.1, P = 0.87
 Identities = 20/63 (31%), Positives = 28/63 (44%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S   SSS  S   SSS F + ++ + SS S    SN    S D  S +   T    +
Sbjct:   201 SKSSASPSSSKSSSKFSSSSFITSTTPASSSSSGAIVSNAKTASTDDSSSASSATSSVSS 260

Query:    40 IFS 32
             + S
Sbjct:   261 VVS 263

 Score = 65 (22.9 bits), Expect = 2.6, P = 0.93
 Identities = 20/44 (45%), Positives = 23/44 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  S   SS+  SS  SSS  S SS  +S T   S
Sbjct:   187 SSSSSKSSSSSSSSSKSSASPSSSKSSSKFSSSSFITSTTPASS 230

 Score = 65 (22.9 bits), Expect = 2.6, P = 0.93
 Identities = 23/61 (37%), Positives = 30/61 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL-SFXETYKCD 44
             S +S  SSSS  S   SS+  SS  SSS  S SS  +S T   S    ++ S  +T   D
Sbjct:   187 SSSSSKSSSSSSSSSKSSASPSSSKSSSKFSSSSFITSTTPASSSSSGAIVSNAKTASTD 246

Query:    43 N 41
             +
Sbjct:   247 D 247

 Score = 63 (22.2 bits), Expect = 4.3, P = 0.99
 Identities = 17/39 (43%), Positives = 25/39 (64%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  S++S +S  VSS+  SS  S+S SS S+  SS+ S
Sbjct:   249 SSASSATSSVSSVVSSA--SSALSASASSASASVSSSAS 285

 Score = 63 (22.2 bits), Expect = 4.3, P = 0.99
 Identities = 21/55 (38%), Positives = 27/55 (49%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + P    +  SSS  I+   S+   SS SSSS  S SS  SS++S  S    S S
Sbjct:   127 IAPSMIGTRTSSSYFITSSSSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSS 181

 Score = 62 (21.8 bits), Expect = 5.6, P = 1.0
 Identities = 19/49 (38%), Positives = 27/49 (55%), Frame = -3

Query:   211 SXXSSSSXISDX-VSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  SS + +S+   +S+  SS +SS+ SS SS  SS +S  S    S S
Sbjct:   229 SSSSSGAIVSNAKTASTDDSSSASSATSSVSSVVSSASSALSASASSAS 277

 Score = 60 (21.1 bits), Expect = 9.2, P = 1.0
 Identities = 24/68 (35%), Positives = 32/68 (47%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             + P    +  SSS  I+   SSS  SS SSSS SS SS  S ++S       S S  ++ 
Sbjct:   127 IAPSMIGTRTSSSYFITS--SSSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSS 184

Query:    52 KCDNIFSK 29
                +  SK
Sbjct:   185 SSSSSSSK 192


>gi|295671 (L11275) selected as a weak suppressor of a mutant of the subunit
           AC40 of DNA dependant RNA polymerase I and III [Saccharomyces
           cerevisiae]
           Length = 406

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.033, P = 0.032
 Identities = 26/51 (50%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS  SSS SS SS  SS+ S  S D  S S
Sbjct:    27 SSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSESSS 77

 Score = 84 (29.6 bits), Expect = 0.033, P = 0.032
 Identities = 26/51 (50%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SS S SS SS  SS++S  S D  S S
Sbjct:    46 SSSSGESSSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSESSS 96

 Score = 79 (27.8 bits), Expect = 0.11, P = 0.11
 Identities = 24/55 (43%), Positives = 30/55 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  SSSS   +  SSS  SS SSSS SS SS   S++S  S    S S  ++
Sbjct:    38 SSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDS 92

 Score = 79 (27.8 bits), Expect = 0.11, P = 0.11
 Identities = 25/60 (41%), Positives = 29/60 (48%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSS   SD  S S  SS SSSS SS  S  SS+ S    D  S S   +   D+
Sbjct:   177 SSSSSSSSSDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDS 236

 Score = 78 (27.5 bits), Expect = 0.15, P = 0.14
 Identities = 27/65 (41%), Positives = 33/65 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSSS  SD  SSS   S SSSS SS SS  SS+ S    +    +     + DN
Sbjct:    78 SSSSSSSSSSSSSDSESSS--ESDSSSSGSSSSSSSSSDESSSESESEDETKKRARESDN 135

Query:    40 IFSKE 26
               +KE
Sbjct:   136 EDAKE 140

 Score = 77 (27.1 bits), Expect = 0.19, P = 0.17
 Identities = 24/51 (47%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S SS  SD  SSS  SS SSSS SS  S  SS +   S    S S
Sbjct:    59 SSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSS 109

 Score = 76 (26.8 bits), Expect = 0.24, P = 0.21
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             +S  SSSS  S   SSS  SS SS   SS SS  SS++S  S D
Sbjct:    26 SSSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSD 69

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 23/49 (46%), Positives = 26/49 (53%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             SSSS  S   SSS  SS SSSS    SS  SS++S  S D    S  E+
Sbjct:    27 SSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSES 75

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 26/51 (50%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    31 SSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSD-SESSSSSS 80

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 25/51 (49%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  SD   SS   S SSSS SS SS  SS+ S  S +  S S
Sbjct:    53 SSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSS-SSSDSESSSESDSSS 102

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 24/55 (43%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  SSSS  S   SSS  SS SS S  S  S  SS++S  S    S S  E+
Sbjct:    40 SSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSES 94

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 24/60 (40%), Positives = 30/60 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSSS  S+  S S   S SSSS S  SS   S++S  S D  S S   +   D+
Sbjct:   175 SDSSSSSSSSSDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDS 234

 Score = 73 (25.7 bits), Expect = 0.51, P = 0.40
 Identities = 23/48 (47%), Positives = 25/48 (52%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  SSSS  SD  S S  SS  SSS S  SS  SS++S    D  S S
Sbjct:   195 SQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDSDSDSSS 242

 Score = 72 (25.3 bits), Expect = 0.65, P = 0.48
 Identities = 26/58 (44%), Positives = 30/58 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS---NTSXFSLDIXSLSFXET 56
             S +S  S SS  SD  SSS  SS SSSS SS  S  SS   ++S  S    S S  E+
Sbjct:    59 SSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDES 116

 Score = 72 (25.3 bits), Expect = 0.65, P = 0.48
 Identities = 24/65 (36%), Positives = 29/65 (44%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  S SS  SD  SS   S   SSS SS SS  S + S  S D  S    ++    +
Sbjct:   198 SSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDSDSDSSSDSDSSGSSDSSSSSD 257

Query:    40 IFSKE 26
               S E
Sbjct:   258 SSSDE 262

 Score = 71 (25.0 bits), Expect = 0.83, P = 0.56
 Identities = 24/54 (44%), Positives = 27/54 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXE 59
             S  S  SSSS  S   SSS   S SSS   S SS  SS++S  S +  S S  E
Sbjct:    70 SSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESSSESESE 123

 Score = 69 (24.3 bits), Expect = 1.4, P = 0.74
 Identities = 24/50 (48%), Positives = 27/50 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXS-SSSVSSXSSXFSSNTSXFSLDIXS 74
             S +S   SSS  S   SSS  SS S SSS S  SS  SS++S  S D  S
Sbjct:    68 SDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESS 117

 Score = 68 (23.9 bits), Expect = 1.7, P = 0.83
 Identities = 26/65 (40%), Positives = 32/65 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSS   SD  SSS  S  S SS SS SS  SS+ S  S    S S  ++     
Sbjct:   224 SSSSSSSSSDSDSDSDSSSD-SDSSGSSDSSSSSDSSSDESTSSDSSDSDSDSDSGSSSE 282

Query:    40 IFSKE 26
             + +KE
Sbjct:   283 LETKE 287

 Score = 65 (22.9 bits), Expect = 3.7, P = 0.97
 Identities = 19/39 (48%), Positives = 21/39 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  SSS   SD  SSS  SS  S S SS SS  S + S
Sbjct:   198 SSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDS 236

 Score = 64 (22.5 bits), Expect = 4.7, P = 0.99
 Identities = 22/57 (38%), Positives = 25/57 (43%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S  S SS  SD  SSS  SS  S S S  SS   S+ S  S      S  E+   D+
Sbjct:   212 SSSSDSSSDSDSSSSSSSSSSDSDSDSDSSSDSDSSGSSDSSSSSDSSSDESTSSDS 268

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 19/44 (43%), Positives = 22/44 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S S   SD  SSS  SS S S   S S   SS++S  S
Sbjct:   161 SSSSSESESGSESDSDSSSSSSSSSDSESDSESDSQSSSSSSSS 204

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 21/49 (42%), Positives = 24/49 (48%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S +S  S S   SD  SSS  SS SS S S   S   S++S  S D  S
Sbjct:   161 SSSSSESESGSESDSDSSSS-SSSSSDSESDSESDSQSSSSSSSSDSSS 208

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 23/61 (37%), Positives = 28/61 (45%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSS-SVSSXSSXFSSNTSXFSLDIXSLSFXETYKCD 44
             S +   S S   SD  SSS  SS S S S S   S  SS++S  S D  S S   +   D
Sbjct:   163 SSSESESGSESDSDSSSSSSSSSDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSD 222

Query:    43 N 41
             +
Sbjct:   223 S 223

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 25/68 (36%), Positives = 32/68 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKC-- 47
             S +   S SS  SD   SS  SS S SS    +S  SS++   S D  S S  ET +   
Sbjct:   232 SDSDSDSDSSSDSDSSGSSDSSSSSDSSSDESTSSDSSDSDSDS-DSGSSSELETKEATA 290

Query:    46 DNIFSKECP 20
             D   ++E P
Sbjct:   291 DESKAEETP 299


>sp|P32583|SR40_YEAST SUPRESSOR PROTEIN SRP40 >pir||S38170 SRP40 protein -
            yeast (Saccharomyces cerevisiae) >gi|450552 (X73541) ORF YKR412
            [Saccharomyces cerevisiae] >gi|486581 (Z28317) ORF YKR092c
            [Saccharomyces cerevisiae]
            Length = 406

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.033, P = 0.032
 Identities = 26/51 (50%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS  SSS SS SS  SS+ S  S D  S S
Sbjct:    27 SSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSESSS 77

 Score = 84 (29.6 bits), Expect = 0.033, P = 0.032
 Identities = 26/51 (50%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SS S SS SS  SS++S  S D  S S
Sbjct:    46 SSSSGESSSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSESSS 96

 Score = 79 (27.8 bits), Expect = 0.11, P = 0.11
 Identities = 24/55 (43%), Positives = 30/55 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  SSSS   +  SSS  SS SSSS SS SS   S++S  S    S S  ++
Sbjct:    38 SSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDS 92

 Score = 79 (27.8 bits), Expect = 0.11, P = 0.11
 Identities = 25/60 (41%), Positives = 29/60 (48%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSS   SD  S S  SS SSSS SS  S  SS+ S    D  S S   +   D+
Sbjct:   177 SSSSSSSSSDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDS 236

 Score = 78 (27.5 bits), Expect = 0.15, P = 0.14
 Identities = 27/65 (41%), Positives = 33/65 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSSS  SD  SSS   S SSSS SS SS  SS+ S    +    +     + DN
Sbjct:    78 SSSSSSSSSSSSSDSESSS--ESDSSSSGSSSSSSSSSDESSSESESEDETKKRARESDN 135

Query:    40 IFSKE 26
               +KE
Sbjct:   136 EDAKE 140

 Score = 77 (27.1 bits), Expect = 0.19, P = 0.17
 Identities = 24/51 (47%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S SS  SD  SSS  SS SSSS SS  S  SS +   S    S S
Sbjct:    59 SSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSS 109

 Score = 76 (26.8 bits), Expect = 0.24, P = 0.21
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             +S  SSSS  S   SSS  SS SS   SS SS  SS++S  S D
Sbjct:    26 SSSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSD 69

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 23/49 (46%), Positives = 26/49 (53%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             SSSS  S   SSS  SS SSSS    SS  SS++S  S D    S  E+
Sbjct:    27 SSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSES 75

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 26/51 (50%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    31 SSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSD-SESSSSSS 80

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 25/51 (49%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  SD   SS   S SSSS SS SS  SS+ S  S +  S S
Sbjct:    53 SSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSS-SSSDSESSSESDSSS 102

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 24/55 (43%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  SSSS  S   SSS  SS SS S  S  S  SS++S  S    S S  E+
Sbjct:    40 SSSSSSSSSSGESSSSSSSSSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSES 94

 Score = 75 (26.4 bits), Expect = 0.31, P = 0.26
 Identities = 24/60 (40%), Positives = 30/60 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSSS  S+  S S   S SSSS S  SS   S++S  S D  S S   +   D+
Sbjct:   175 SDSSSSSSSSSDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDS 234

 Score = 73 (25.7 bits), Expect = 0.51, P = 0.40
 Identities = 23/48 (47%), Positives = 25/48 (52%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  SSSS  SD  S S  SS  SSS S  SS  SS++S    D  S S
Sbjct:   195 SQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDSDSDSSS 242

 Score = 72 (25.3 bits), Expect = 0.65, P = 0.48
 Identities = 26/58 (44%), Positives = 30/58 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS---NTSXFSLDIXSLSFXET 56
             S +S  S SS  SD  SSS  SS SSSS SS  S  SS   ++S  S    S S  E+
Sbjct:    59 SSSSSSSDSSDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDES 116

 Score = 72 (25.3 bits), Expect = 0.65, P = 0.48
 Identities = 24/65 (36%), Positives = 29/65 (44%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  S SS  SD  SS   S   SSS SS SS  S + S  S D  S    ++    +
Sbjct:   198 SSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDSDSDSSSDSDSSGSSDSSSSSD 257

Query:    40 IFSKE 26
               S E
Sbjct:   258 SSSDE 262

 Score = 71 (25.0 bits), Expect = 0.83, P = 0.56
 Identities = 24/54 (44%), Positives = 27/54 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXE 59
             S  S  SSSS  S   SSS   S SSS   S SS  SS++S  S +  S S  E
Sbjct:    70 SSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESSSESESE 123

 Score = 69 (24.3 bits), Expect = 1.4, P = 0.74
 Identities = 24/50 (48%), Positives = 27/50 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXS-SSSVSSXSSXFSSNTSXFSLDIXS 74
             S +S   SSS  S   SSS  SS S SSS S  SS  SS++S  S D  S
Sbjct:    68 SDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESS 117

 Score = 68 (23.9 bits), Expect = 1.7, P = 0.83
 Identities = 26/65 (40%), Positives = 32/65 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSS   SD  SSS  S  S SS SS SS  SS+ S  S    S S  ++     
Sbjct:   224 SSSSSSSSSDSDSDSDSSSD-SDSSGSSDSSSSSDSSSDESTSSDSSDSDSDSDSGSSSE 282

Query:    40 IFSKE 26
             + +KE
Sbjct:   283 LETKE 287

 Score = 65 (22.9 bits), Expect = 3.7, P = 0.97
 Identities = 19/39 (48%), Positives = 21/39 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  SSS   SD  SSS  SS  S S SS SS  S + S
Sbjct:   198 SSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDS 236

 Score = 64 (22.5 bits), Expect = 4.7, P = 0.99
 Identities = 22/57 (38%), Positives = 25/57 (43%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S  S SS  SD  SSS  SS  S S S  SS   S+ S  S      S  E+   D+
Sbjct:   212 SSSSDSSSDSDSSSSSSSSSSDSDSDSDSSSDSDSSGSSDSSSSSDSSSDESTSSDS 268

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 19/44 (43%), Positives = 22/44 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S S   SD  SSS  SS S S   S S   SS++S  S
Sbjct:   161 SSSSSESESGSESDSDSSSSSSSSSDSESDSESDSQSSSSSSSS 204

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 21/49 (42%), Positives = 24/49 (48%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S +S  S S   SD  SSS  SS SS S S   S   S++S  S D  S
Sbjct:   161 SSSSSESESGSESDSDSSSS-SSSSSDSESDSESDSQSSSSSSSSDSSS 208

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 23/61 (37%), Positives = 28/61 (45%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSS-SVSSXSSXFSSNTSXFSLDIXSLSFXETYKCD 44
             S +   S S   SD  SSS  SS S S S S   S  SS++S  S D  S S   +   D
Sbjct:   163 SSSESESGSESDSDSSSSSSSSSDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSD 222

Query:    43 N 41
             +
Sbjct:   223 S 223

 Score = 62 (21.8 bits), Expect = 7.7, P = 1.0
 Identities = 25/68 (36%), Positives = 32/68 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKC-- 47
             S +   S SS  SD   SS  SS S SS    +S  SS++   S D  S S  ET +   
Sbjct:   232 SDSDSDSDSSSDSDSSGSSDSSSSSDSSSDESTSSDSSDSDSDS-DSGSSSELETKEATA 290

Query:    46 DNIFSKECP 20
             D   ++E P
Sbjct:   291 DESKAEETP 299


>sp|P36027|MID2_YEAST MATING PROCESS PROTEIN MID2 (SERINE-RICH PROTEIN SMS1)
            (PROTEIN KINASE A INTERFERENCE PROTEIN) >pir||S52137 MID2 protein -
            yeast (Saccharomyces cerevisiae) >gnl|PID|d1006784 (D29945) Mid2p
            [Saccharomyces cerevisiae] >gi|662143 (U20618) Mid2p: Mating
            process protein [Saccharomyces cerevisiae] >gnl|PID|d1006794
            (D29964) serine-rich transmembrane protein [Saccharomyces
            cerevisiae] >prf||2104276A integral membrane protein [Saccharomyces
            cerevisiae] >prf||2105188A Ser-rich transmembrane protein
            [Saccharomyces cerevisiae]
            Length = 376

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 0.038, P = 0.037
 Identities = 23/50 (46%), Positives = 31/50 (62%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSF-FSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S  S  SSS+ I+    +SF FSS SS+S SS +S  SS++S FS+   S
Sbjct:    79 SLVSHTSSSTSIASISFTSFSFSSDSSTSSSSSASSDSSSSSSFSISSTS 128

 Score = 80 (28.2 bits), Expect = 0.080, P = 0.077
 Identities = 24/47 (51%), Positives = 29/47 (61%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFS--SXSSSSVSSXSSXFSSNTSXFSL 86
             S +S  SSSS  SD  SSS FS  S S++S SS SS  +S +S  SL
Sbjct:   102 SDSSTSSSSSASSDSSSSSSFSISSTSATSESSTSSTQTSTSSSSSL 148

 Score = 74 (26.0 bits), Expect = 0.35, P = 0.30
 Identities = 28/57 (49%), Positives = 31/57 (54%), Frame = -3

Query:   220 SXTSXXSSSSXI--SDXVSSSFFSSXS-SSSVSSXS--SXFSSNTSXFSLDIXSLSF 65
             S  S  SSSS I  S  VSSS   S S +SS SS S  S  SS+TS  S+   S SF
Sbjct:    44 SSVSRVSSSSSILSSSMVSSSSADSSSLTSSTSSRSLVSHTSSSTSIASISFTSFSF 100

 Score = 67 (23.6 bits), Expect = 2.0, P = 0.87
 Identities = 20/48 (41%), Positives = 24/48 (50%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  S SS  S   +SS  SS SS S+SS S+   S+TS       S S
Sbjct:    99 SFSSDSSTSSSSSASSDSSSSSSFSISSTSATSESSTSSTQTSTSSSS 146

 Score = 66 (23.2 bits), Expect = 2.6, P = 0.93
 Identities = 26/65 (40%), Positives = 32/65 (49%), Frame = -3

Query:   220 SXTSXXSSS-SXISDXVSSSFFSSXSSSSVSSXSSXFS-SNTSXFSLDIXSLSFXETYKC 47
             S TS  S S +  S    SS  SS S+SS SS SS FS S+TS  S    S +   T   
Sbjct:    86 SSTSIASISFTSFSFSSDSSTSSSSSASSDSSSSSSFSISSTSATSESSTSSTQTSTSSS 145

Query:    46 DNIFS 32
              ++ S
Sbjct:   146 SSLSS 150

 Score = 61 (21.5 bits), Expect = 9.0, P = 1.0
 Identities = 19/43 (44%), Positives = 25/43 (58%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             ++  SS S +S   SSS  SS   SS S+ SS  +S+TS  SL
Sbjct:    40 STARSSVSRVSS--SSSILSSSMVSSSSADSSSLTSSTSSRSL 80


>gnl|PID|d1014448 (D89048) serine repeat antigen [Plasmodium falciparum]
            Length = 241

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.084, P = 0.081
 Identities = 22/39 (56%), Positives = 23/39 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS 110
             P S +S  SSSS  S   SSS  SS SSSS SS SS  S
Sbjct:   183 PISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSES 221

 Score = 75 (26.4 bits), Expect = 0.14, P = 0.13
 Identities = 22/39 (56%), Positives = 24/39 (61%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL 71
             ISD  SSS  SS SSSS SS SS  SS++S  S    SL
Sbjct:   184 ISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESL 222

 Score = 73 (25.7 bits), Expect = 0.23, P = 0.21
 Identities = 20/39 (51%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S +S  SSSS  S   SSS  SS SSSS SS S    +N
Sbjct:   187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESLPAN 225

 Score = 72 (25.3 bits), Expect = 0.30, P = 0.26
 Identities = 21/35 (60%), Positives = 22/35 (62%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             SSSS  S   SSS  SS SSSS SS SS  SS+ S
Sbjct:   187 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSES 221

 Score = 72 (25.3 bits), Expect = 0.30, P = 0.26
 Identities = 21/37 (56%), Positives = 22/37 (59%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S  SSSS  S   SSS  SS SSSS SS SS  SS +
Sbjct:   185 SDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSES 221

 Score = 72 (25.3 bits), Expect = 0.30, P = 0.26
 Identities = 21/39 (53%), Positives = 23/39 (58%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             T   S SS  S   SSS  SS SSSS SS SS  SS++S
Sbjct:   181 TEPISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219

 Score = 72 (25.3 bits), Expect = 0.30, P = 0.26
 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             P S +S  SSSS  S   SSS  SS SSSS SS SS  S +
Sbjct:   183 PISDSSSSSSSSSSSSSSSSS--SSSSSSSSSSSSSSSSES 221

 Score = 71 (25.0 bits), Expect = 0.39, P = 0.32
 Identities = 21/38 (55%), Positives = 23/38 (60%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             S S  S   SSS  SS SSSS SS SS  SS++S  SL
Sbjct:   185 SDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESL 222

 Score = 66 (23.2 bits), Expect = 1.4, P = 0.75
 Identities = 22/40 (55%), Positives = 24/40 (60%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             ISD  SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:   184 ISDSSSSS--SSSSSSSSSSSSSSSSSSSSSSSSSSSSES 221

 Score = 65 (22.9 bits), Expect = 1.8, P = 0.83
 Identities = 23/59 (38%), Positives = 30/59 (50%), Frame = -3

Query:   229 LPXSXTSXXSSSSX-----ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             LP + T+    SS       ++ +S S  SS SSSS SS SS  SS++S  S    S S
Sbjct:   161 LPSNGTTGEQGSSTGTVRGDTEPISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 219


>prf||1921322A polyserin [Homo sapiens]
            Length = 115

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.089, P = 0.086
 Identities = 21/39 (53%), Positives = 22/39 (56%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  SSSS  S   SSS  SS SSSS SS S    S TS
Sbjct:    50 SSSGSSSSSSSSSSSSSSSSSSSSSSPSSSSGGKGSETS 88

 Score = 68 (23.9 bits), Expect = 0.19, P = 0.17
 Identities = 24/54 (44%), Positives = 27/54 (50%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             +S  SSSS  S   SSS  SS SSSS SS S    S TS    D+   S  E +
Sbjct:    50 SSSGSSSSSSSSSSSSSSSSSSSSSSPSSSSGGKGSETSS---DLFEGSNEEAH 100

 Score = 61 (21.5 bits), Expect = 1.0, P = 0.64
 Identities = 20/41 (48%), Positives = 22/41 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +   S S   S   SSS  SS SSSS SS SS  SS +S
Sbjct:    38 SGSGKGSGSGGGSSSGSSSSSSSSSSSSSSSSSSSSSSPSS 78

 Score = 60 (21.1 bits), Expect = 1.3, P = 0.73
 Identities = 19/35 (54%), Positives = 19/35 (54%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS 107
             S   SSS  S   SSS  SS SSSS SS S   SS
Sbjct:    46 SGGGSSSGSSSSSSSSSSSSSSSSSSSSSSPSSSS 80

 Score = 55 (19.4 bits), Expect = 5.3, P = 1.0
 Identities = 17/34 (50%), Positives = 19/34 (55%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S    S   SSS  SS SSSS SS SS  S ++S
Sbjct:    46 SGGGSSSGSSSSSSSSSSSSSSSSSSSSSSPSSS 79


>gi|552180 (M21323) parasite protein [Plasmodium falciparum]
           Length = 353

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.093, P = 0.089
 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             P S +S  SSSS  S   SSS  SS SSSS SS SS  S +
Sbjct:   180 PISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSES 220

 Score = 76 (26.8 bits), Expect = 0.20, P = 0.18
 Identities = 23/42 (54%), Positives = 25/42 (59%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             P S +S  SSSS  S   SSS  SS SSSS SS SS  SS +
Sbjct:   180 PISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS-SSES 220

 Score = 76 (26.8 bits), Expect = 0.20, P = 0.18
 Identities = 25/47 (53%), Positives = 28/47 (59%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             P S +S  SSSS      SSS  SS SSSS SS SS  SS++S  SL
Sbjct:   180 PISDSSSSSSSSS-----SSSSSSSSSSSSSSSSSSSSSSSSSSESL 221

 Score = 74 (26.0 bits), Expect = 0.33, P = 0.28
 Identities = 21/35 (60%), Positives = 23/35 (65%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             SSSS  S   SSS  SS SSSS SS SS  SS++S
Sbjct:   184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

 Score = 73 (25.7 bits), Expect = 0.42, P = 0.34
 Identities = 20/39 (51%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S +S  SSSS  S   SSS  SS SSSS SS S    +N
Sbjct:   186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESLPAN 224

 Score = 73 (25.7 bits), Expect = 0.42, P = 0.34
 Identities = 22/40 (55%), Positives = 24/40 (60%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             ISD  SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:   181 ISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSES 220

 Score = 72 (25.3 bits), Expect = 0.54, P = 0.41
 Identities = 21/39 (53%), Positives = 23/39 (58%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             T   S SS  S   SSS  SS SSSS SS SS  SS++S
Sbjct:   178 TEPISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 216

 Score = 68 (23.9 bits), Expect = 1.5, P = 0.77
 Identities = 20/37 (54%), Positives = 22/37 (59%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S S  S   SSS  SS SSSS SS SS  SS++S  S
Sbjct:   182 SDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

 Score = 65 (22.9 bits), Expect = 3.1, P = 0.95
 Identities = 20/38 (52%), Positives = 22/38 (57%), Frame = -3

Query:   184 SDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL 71
             S   SSS  SS SSSS SS SS  SS++S  S    SL
Sbjct:   184 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESL 221


>pir||A54512 serine-repeat antigen (clone 366) - Plasmodium falciparum (strain
            FCR3) (fragment) >gnl|PID|e8903 (X06427) SERA protein [Plasmodium
            falciparum]
            Length = 357

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.095, P = 0.090
 Identities = 22/41 (53%), Positives = 24/41 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             P S +S  SSSS  S   SSS  SS SSSS SS SS  S +
Sbjct:   182 PISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSES 222

 Score = 76 (26.8 bits), Expect = 0.20, P = 0.18
 Identities = 23/42 (54%), Positives = 25/42 (59%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             P S +S  SSSS  S   SSS  SS SSSS SS SS  SS +
Sbjct:   182 PISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS-SSES 222

 Score = 76 (26.8 bits), Expect = 0.20, P = 0.18
 Identities = 25/47 (53%), Positives = 28/47 (59%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             P S +S  SSSS      SSS  SS SSSS SS SS  SS++S  SL
Sbjct:   182 PISDSSSSSSSSS-----SSSSSSSSSSSSSSSSSSSSSSSSSSESL 223

 Score = 74 (26.0 bits), Expect = 0.33, P = 0.28
 Identities = 21/35 (60%), Positives = 23/35 (65%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             SSSS  S   SSS  SS SSSS SS SS  SS++S
Sbjct:   186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

 Score = 73 (25.7 bits), Expect = 0.42, P = 0.35
 Identities = 20/39 (51%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S +S  SSSS  S   SSS  SS SSSS SS S    +N
Sbjct:   188 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESLPAN 226

 Score = 73 (25.7 bits), Expect = 0.42, P = 0.35
 Identities = 22/40 (55%), Positives = 24/40 (60%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             ISD  SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:   183 ISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSES 222

 Score = 72 (25.3 bits), Expect = 0.54, P = 0.42
 Identities = 21/39 (53%), Positives = 23/39 (58%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             T   S SS  S   SSS  SS SSSS SS SS  SS++S
Sbjct:   180 TEPISDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 218

 Score = 68 (23.9 bits), Expect = 1.5, P = 0.77
 Identities = 20/37 (54%), Positives = 22/37 (59%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S S  S   SSS  SS SSSS SS SS  SS++S  S
Sbjct:   184 SDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

 Score = 65 (22.9 bits), Expect = 3.1, P = 0.96
 Identities = 20/38 (52%), Positives = 22/38 (57%), Frame = -3

Query:   184 SDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL 71
             S   SSS  SS SSSS SS SS  SS++S  S    SL
Sbjct:   186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSESL 223


>gi|160687 (J03983) serine rich protein (SERP I) [Plasmodium falciparum]
           Length = 984

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.098, P = 0.093
 Identities = 23/47 (48%), Positives = 28/47 (59%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             LP + T+   SSS  S   S+S  SS SSSS SS SS  SS++S  S
Sbjct:   173 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS 219

 Score = 80 (28.2 bits), Expect = 0.26, P = 0.23
 Identities = 25/48 (52%), Positives = 29/48 (60%), Frame = -3

Query:   229 LPXSXT----SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             LP + T    S  SSSS  S+  SSS  SS SSSS SS SS  SS++S
Sbjct:   173 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSS 220

 Score = 77 (27.1 bits), Expect = 0.55, P = 0.42
 Identities = 22/40 (55%), Positives = 24/40 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S +S  SSSS  S   SSS  SS SSSS SS SS  SS +
Sbjct:   183 SSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSES 222

 Score = 76 (26.8 bits), Expect = 0.70, P = 0.50
 Identities = 22/39 (56%), Positives = 24/39 (61%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  SSSS  S   SSS  SS SSSS SS SS  SS+ S
Sbjct:   184 SSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSES 222

 Score = 72 (25.3 bits), Expect = 1.9, P = 0.84
 Identities = 20/39 (51%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S +S  SSSS  S   SSS  SS SSSS SS S    +N
Sbjct:   188 SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSESLPAN 226

 Score = 67 (23.6 bits), Expect = 6.4, P = 1.0
 Identities = 24/58 (41%), Positives = 30/58 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             LP + T+   SSS  S   S+S  SS SSSS SS SS  SS++S  S         E+
Sbjct:   173 LPSNGTTGEQSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSS--------SES 222


>gi|212879 (K02113) Gallus gallus vitellogenin [Gallus gallus]
           Length = 247

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.11, P = 0.11
 Identities = 23/44 (52%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSSS  S   SSS  SS SS+S SS SS  SS++S  S
Sbjct:    99 SKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRS 142

 Score = 74 (26.0 bits), Expect = 0.19, P = 0.17
 Identities = 23/44 (52%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S   SSS  S   SSS  SS SSSS SS SS  SS+ S  S
Sbjct:   128 SSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSS 171

 Score = 73 (25.7 bits), Expect = 0.24, P = 0.22
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSSS  S+  SSS  S  SSSS  S SS  SS++S  S
Sbjct:   112 SSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSS 155

 Score = 72 (25.3 bits), Expect = 0.31, P = 0.27
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  S   SS   SS SSSS +S SS  SS +S  S
Sbjct:    96 SNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSS 139

 Score = 72 (25.3 bits), Expect = 0.31, P = 0.27
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  S+  SSS SS SS  SS +   S    S S
Sbjct:   103 SSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSS 153

 Score = 71 (25.0 bits), Expect = 0.40, P = 0.33
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSS   S   SSS  SS SSSS S  SS  SS++S  S
Sbjct:   132 SSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKS 175

 Score = 71 (25.0 bits), Expect = 0.40, P = 0.33
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SS S  S   SSS  SS SSSS  S SS  SS++S  S
Sbjct:   133 SKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSS 176

 Score = 71 (25.0 bits), Expect = 0.40, P = 0.33
 Identities = 23/51 (45%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  +   SSS   S SSSS S  SS  SS++S  S    S S
Sbjct:   113 SRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKS 163

 Score = 70 (24.6 bits), Expect = 0.52, P = 0.41
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS      SSS  SS SS S SS  S  SS++S  S    S S
Sbjct:   115 SSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSS 165

 Score = 69 (24.3 bits), Expect = 0.67, P = 0.49
 Identities = 23/51 (45%), Positives = 25/51 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS      SSS  SS S SS SS  S  SS+ S  S    S S
Sbjct:   102 SSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSS 152

 Score = 69 (24.3 bits), Expect = 0.67, P = 0.49
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S SS  S   SSS   S SSS  SS SS  SS++S  S    S S
Sbjct:   120 SSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSS 170

 Score = 68 (23.9 bits), Expect = 0.86, P = 0.58
 Identities = 21/39 (53%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S  S  SS S  S   SSS  SS SSSS SS SS  SS+
Sbjct:   139 SSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSS 177

 Score = 68 (23.9 bits), Expect = 0.86, P = 0.58
 Identities = 21/44 (47%), Positives = 23/44 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S   SSS  S   SSS  SS SSSS S+  S  SS+ S  S
Sbjct:    95 SSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSS 138

 Score = 68 (23.9 bits), Expect = 0.86, P = 0.58
 Identities = 23/51 (45%), Positives = 24/51 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S     S SS  S   SSS  SS SSS  SS SS  SSN+   S    S S
Sbjct:    87 SSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSS 137

 Score = 67 (23.6 bits), Expect = 1.1, P = 0.67
 Identities = 21/44 (47%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             + +   SS S  S   SSS  SS SSSS SS SS  SS+ S  S
Sbjct:    86 NSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSS 129

 Score = 67 (23.6 bits), Expect = 1.1, P = 0.67
 Identities = 22/49 (44%), Positives = 26/49 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +S  S+SS  S   SSS  SS  SSS SS SS  S ++S  S    S S
Sbjct:    92 SSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSS 140

 Score = 67 (23.6 bits), Expect = 1.1, P = 0.67
 Identities = 22/51 (43%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSS+  S   SS   SS S S  SS SS  SS++S  S    S S
Sbjct:   116 SSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSS 166

 Score = 65 (22.9 bits), Expect = 1.8, P = 0.84
 Identities = 20/44 (45%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S+SS  S   SS+     SSSS SS SS  SS++S  S
Sbjct:    79 SRSSKSSNSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSS 122

 Score = 64 (22.5 bits), Expect = 2.4, P = 0.91
 Identities = 24/51 (47%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SS   SS SSSS +S SS  SS +S  S    S S
Sbjct:    96 SNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSS--RSRS 144

 Score = 64 (22.5 bits), Expect = 2.4, P = 0.91
 Identities = 24/52 (46%), Positives = 29/52 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSS-SFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S+SS  S   SS S   S SSSS SS SS  SS++S  S +  S S
Sbjct:    79 SRSSKSSNSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSS 130

 Score = 63 (22.2 bits), Expect = 3.0, P = 0.95
 Identities = 19/38 (50%), Positives = 22/38 (57%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             +S  SSSS  S   SSS  SS  SSS SS SS   S++
Sbjct:   145 SSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSSHHSHS 182

 Score = 63 (22.2 bits), Expect = 3.0, P = 0.95
 Identities = 23/51 (45%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSS   +    SS  SS SSSS SS SS  SS++S  S    S S
Sbjct:    85 SNSSKRSSSKSSNSSKRSS--SSSSSSSSSSRSSSSSSSSSSNSKSSSSSS 133

 Score = 63 (22.2 bits), Expect = 3.0, P = 0.95
 Identities = 24/64 (37%), Positives = 32/64 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  S+SS  S   SS+     SSSS SS SS  SS++S  S    S S   + K  +
Sbjct:    79 SRSSKSSNSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSS-NSKSSSSSSKSSS 137

Query:    40 IFSK 29
               S+
Sbjct:   138 SSSR 141

 Score = 62 (21.8 bits), Expect = 3.9, P = 0.98
 Identities = 22/42 (52%), Positives = 23/42 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSX-FSSNTS 98
             S  S  SS S  S   SSS  SS SSSS SS SS   SS+ S
Sbjct:   139 SSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSSHHS 180

 Score = 59 (20.8 bits), Expect = 8.4, P = 1.0
 Identities = 19/44 (43%), Positives = 23/44 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             + +S  SS S  S   SSS  S+ S  S SS SS  SS+ S  S
Sbjct:    75 ASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSS 118

 Score = 59 (20.8 bits), Expect = 8.4, P = 1.0
 Identities = 20/45 (44%), Positives = 24/45 (53%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SSSS  S   +SS  SS  SS+ S  SS  SS++S  S    S S
Sbjct:    76 SSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSS 120


>sp|P53301|YG46_YEAST HYPOTHETICAL 52.8 KD PROTEIN IN BUB1-HIP1 INTERGENIC
            REGION >pir||S64507 probable membrane protein YGR189c - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e243566 (Z72974) ORF YGR189c
            [Saccharomyces cerevisiae] >gnl|PID|e252633 (X99074) G7553
            [Saccharomyces cerevisiae]
            Length = 507

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.12, P = 0.11
 Identities = 23/51 (45%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T   S+SS +S  VSS+  SS SS+  SS SS  SS++S  S    S S
Sbjct:   309 SSTVSSSASSTVSSSVSSTVSSSASSTVSSSVSSTVSSSSSVSSSSSTSPS 359

 Score = 78 (27.5 bits), Expect = 0.19, P = 0.18
 Identities = 22/51 (43%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T   S+SS +S  VSS+  SS S SS SS S   S+ TS  +L   S++
Sbjct:   325 SSTVSSSASSTVSSSVSSTVSSSSSVSSSSSTSPSSSTATSSKTLASSSVT 375

 Score = 77 (27.1 bits), Expect = 0.25, P = 0.22
 Identities = 21/47 (44%), Positives = 26/47 (55%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +  S TS  + SS  S  VSSS  S+ SSS+ S+ SS  SS  S  S
Sbjct:   302 ISSSSTSSSTVSSSASSTVSSSVSSTVSSSASSTVSSSVSSTVSSSS 348

 Score = 75 (26.4 bits), Expect = 0.41, P = 0.34
 Identities = 21/51 (41%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  +SSS +S   SS+  SS SS+  SS SS  SS+ S       S+S
Sbjct:   301 SISSSSTSSSTVSSSASSTVSSSVSSTVSSSASSTVSSSVSSTVSSSSSVS 351

 Score = 71 (25.0 bits), Expect = 1.1, P = 0.67
 Identities = 26/69 (37%), Positives = 34/69 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL----SFXETY 53
             S T   S+SS +S  VSS+  SS S SS SS S   S+ TS  +L   S+    S     
Sbjct:   325 SSTVSSSASSTVSSSVSSTVSSSSSVSSSSSTSPSSSTATSSKTLASSSVTTSSSISSFE 384

Query:    52 KCDNIFSKE 26
             K  +  SK+
Sbjct:   385 KQSSSSSKK 393


>sp|P38190|YBF3_YEAST VERY HYPOTHETICAL 13.2 KD PROTEIN IN PTC3-SEC17
            INTERGENIC REGION >pir||S45788 probable membrane protein YBL053w -
            yeast (Saccharomyces cerevisiae) >gi|536079 (Z35814) ORF YBL053w
            [Saccharomyces cerevisiae]
            Length = 124

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 0.15, P = 0.14
 Identities = 26/60 (43%), Positives = 32/60 (53%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             L P S +S   SSS +S   SSSF S   SSS+SS     SS++S       SL+F  TY
Sbjct:    50 LFPSSSSSL--SSSYVSS--SSSFSSDICSSSMSSSRVKSSSSSSS------SLAFSPTY 99

 Score = 65 (22.9 bits), Expect = 0.41, P = 0.33
 Identities = 20/45 (44%), Positives = 23/45 (51%), Frame = -3

Query:   184 SDXVSSSFFSSXSS-SSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             S  +SSS+ SS SS SS    SS  SS     S    SL+F  TY
Sbjct:    55 SSSLSSSYVSSSSSFSSDICSSSMSSSRVKSSSSSSSSLAFSPTY 99

 Score = 64 (22.5 bits), Expect = 0.55, P = 0.42
 Identities = 22/52 (42%), Positives = 25/52 (48%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSS-XFSSNTSXFSLDIXSLS 68
             S +   SSSS  SD  SSS  SS   SS SS SS  FS   +  S    + S
Sbjct:    59 SSSYVSSSSSFSSDICSSSMSSSRVKSSSSSSSSLAFSPTYNSVSTSFSTSS 110

 Score = 60 (21.1 bits), Expect = 1.6, P = 0.81
 Identities = 21/49 (42%), Positives = 26/49 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSS-----XFSSNTSXFS 89
             S +   SSSS  SD  SSS  SS   SS SS SS      ++S ++ FS
Sbjct:    59 SSSYVSSSSSFSSDICSSSMSSSRVKSSSSSSSSLAFSPTYNSVSTSFS 107

 Score = 55 (19.4 bits), Expect = 6.5, P = 1.0
 Identities = 14/29 (48%), Positives = 18/29 (62%), Frame = -3

Query:   142 SSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             SS SS SS + S++S FS DI S S   +
Sbjct:    53 SSSSSLSSSYVSSSSSFSSDICSSSMSSS 81


>pir||S59634 endo-1,4-beta-xylanase (EC 3.2.1.8) xynF precursor - Pseudomonas
            fluorescens >gi|758227 (Z48928) endo-beta-1,4-xylanase [Pseudomonas
            fluorescens]
            Length = 606

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.15, P = 0.14
 Identities = 25/51 (49%), Positives = 29/51 (56%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             P S  S  SSSS IS   SSS  SS SSSS+SS S   SS +S  S  + +
Sbjct:    41 PASTPSSASSSSIIS---SSSLSSSLSSSSLSSSSLSSSSASSVSSSSVAA 88

 Score = 78 (27.5 bits), Expect = 0.24, P = 0.22
 Identities = 26/46 (56%), Positives = 28/46 (60%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             P S  S  SSSS IS   SSS  SS SSSS+SS SS  SS+ S  S
Sbjct:    41 PASTPSSASSSSIIS---SSSLSSSLSSSSLSS-SSLSSSSASSVS 82

 Score = 70 (24.6 bits), Expect = 1.7, P = 0.83
 Identities = 19/47 (40%), Positives = 25/47 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             +S   SSS  S  +SSS  SS S+SSVSS S   S       +D+ +
Sbjct:    55 SSSSLSSSLSSSSLSSSSLSSSSASSVSSSSVAASEGNVVIEVDMAN 101

 Score = 63 (22.2 bits), Expect = 9.8, P = 1.0
 Identities = 23/49 (46%), Positives = 26/49 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             T   SSS   S   S+   SS SSSS+ S SS  SS+ S  SL   SLS
Sbjct:    29 TPTTSSSPQSSSPASTP--SSASSSSIISSSS-LSSSLSSSSLSSSSLS 74


>gi|1103869 (U39815) surface coat glycoprotein TES-120 precursor [Toxocara
            canis]
            Length = 176

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.21, P = 0.19
 Identities = 20/55 (36%), Positives = 30/55 (54%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             ++  S +S  S+SS  +   SSS  +S SS+S SS S+  SS+ +  S    S S
Sbjct:    20 MMSSSSSSSPSTSSSSASTSSSSASTSSSSASTSSSSASTSSSPASTSSSSASTS 74

 Score = 69 (24.3 bits), Expect = 0.36, P = 0.30
 Identities = 19/45 (42%), Positives = 27/45 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             S +S  +SSS  S   SS+  SS S+S+ SS +S  SS+ S  S+
Sbjct:    32 SSSSASTSSSSASTSSSSASTSSSSASTSSSPASTSSSSASTSSM 76

 Score = 66 (23.2 bits), Expect = 0.78, P = 0.54
 Identities = 19/53 (35%), Positives = 27/53 (50%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             P   +S  SSS   S   +S+  SS S+SS S+ +S  S++TS       S S
Sbjct:    18 PQMMSSSSSSSPSTSSSSASTSSSSASTSSSSASTSSSSASTSSSPASTSSSS 70

 Score = 63 (22.2 bits), Expect = 1.7, P = 0.82
 Identities = 18/49 (36%), Positives = 28/49 (57%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSX---SSXFSSNTSXFS 89
             P + +S  S+SS  +   SSS  +S SS+S SS    +S  S++TS  +
Sbjct:    29 PSTSSSSASTSSSSASTSSSSASTSSSSASTSSSPASTSSSSASTSSMA 77

 Score = 63 (22.2 bits), Expect = 1.7, P = 0.82
 Identities = 18/51 (35%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + TS  S+S+  S   +SS  +S SSSS S+ S   S++T+       S+S
Sbjct:    43 ASTSSSSASTSSSSASTSSSPASTSSSSASTSSMAGSTSTAAGPTSSSSVS 93

 Score = 59 (20.8 bits), Expect = 4.8, P = 0.99
 Identities = 15/41 (36%), Positives = 23/41 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  S  SSS+  S   +S+  S  S+SS S+ +S  + +TS
Sbjct:    41 SSASTSSSSASTSSSSASTSSSPASTSSSSASTSSMAGSTS 81


>sp|P53189|YGC8_YEAST HYPOTHETICAL 56.4 KD PROTEIN IN RPL32-CWH41 INTERGENIC
            REGION PRECURSOR >pir||S64030 probable membrane protein YGL028c -
            yeast (Saccharomyces cerevisiae) >gnl|PID|e243854 (Z72550) ORF
            YGL028c [Saccharomyces cerevisiae]
            Length = 542

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.21, P = 0.19
 Identities = 20/40 (50%), Positives = 24/40 (60%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS 107
             P S ++  S+SS  S   SSS  SS SSS+ SS SS  SS
Sbjct:   219 PTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSS 258

 Score = 76 (26.8 bits), Expect = 0.35, P = 0.29
 Identities = 20/38 (52%), Positives = 24/38 (63%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +  S+SS  S   SSS  SS SSS+ SS SS  SS+TS
Sbjct:   220 TSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTS 257

 Score = 74 (26.0 bits), Expect = 0.57, P = 0.43
 Identities = 24/55 (43%), Positives = 30/55 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S  S  S+++  S   SSS  SS SSS+ SS SS  SS+TS  S    + S  ET
Sbjct:   209 SQESTESTNTPTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSS-STSSSTSSTQET 262

 Score = 63 (22.2 bits), Expect = 8.6, P = 1.0
 Identities = 24/61 (39%), Positives = 29/61 (47%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN----------TSXFSLDIX 77
             P S ++  S+SS  S   SSS  SS SSS+ SS SS  SS           +S  S  I 
Sbjct:   219 PTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSSTSSTQETAATTSEGSSSSSAAIT 278

Query:    76 S 74
             S
Sbjct:   279 S 279


>pir||S51892 probable membrane protein YOL105c - yeast (Saccharomyces
            cerevisiae) >gi|663247 (Z48149) similarity with H. polymorpha
            hypothetical protein in LEU2 region [Saccharomyces cerevisiae]
            >gnl|PID|e252294 (Z74847) ORF YOL105c [Saccharomyces cerevisiae]
            Length = 556

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.22, P = 0.20
 Identities = 24/64 (37%), Positives = 33/64 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXF-SLDIXSLSFXETYKCD 44
             S T+  ++SS  S   SS+  SS SS++ S+ SS  SS TS   S    S +   T    
Sbjct:   197 SSTTSSTTSSTTSSTTSSTTSSSTSSTTSSTTSSTTSSTTSSTTSSTTSSTTSSTTSSTT 256

Query:    43 NIFS 32
             +IFS
Sbjct:   257 SIFS 260

 Score = 74 (26.0 bits), Expect = 0.59, P = 0.44
 Identities = 20/55 (36%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + T+  S+SS  S   SS+  S+ SS++ SS SS  SS TS  +    S +   T
Sbjct:   189 TSTTSSSTSSTTSSTTSSTTSSTTSSTTSSSTSSTTSSTTSSTTSSTTSSTTSST 243

 Score = 73 (25.7 bits), Expect = 0.75, P = 0.53
 Identities = 21/61 (34%), Positives = 32/61 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S T+  ++SS  S   SS+  S+ SS++ S+ SS  SS TS  +    S+ F  T    +
Sbjct:   209 SSTTSSTTSSSTSSTTSSTTSSTTSSTTSSTTSSTTSSTTSSTTSSTTSI-FSVTSSSSS 267

Query:    40 I 38
             I
Sbjct:   268 I 268

 Score = 70 (24.6 bits), Expect = 1.6, P = 0.79
 Identities = 19/55 (34%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S ++  ++SS  S   SS+  S+ SSS+ S+ SS  SS TS  +    S +   T
Sbjct:   193 SSSTSSTTSSTTSSTTSSTTSSTTSSSTSSTTSSTTSSTTSSTTSSTTSSTTSST 247


>sp|P40954|CHI3_CANAL CHITINASE 3 PRECURSOR >gi|571429 (U15801) chitinase
            [Candida albicans]
            Length = 567

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.22, P = 0.20
 Identities = 25/69 (36%), Positives = 38/69 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIX-SLSFXETYKCD 44
             S T+  +SSS  S   SS+  SS +SS +S+ S+  +S+TS  S  I  S S  +T    
Sbjct:   362 SSTTSSTSSSSTSSSTSSTTSSSTTSSQISTTSTAPTSSTSLSSSTISTSASTSDTTSVT 421

Query:    43 NIFSKECPMV 14
             +  S+  P+V
Sbjct:   422 S--SETTPVV 429

 Score = 77 (27.1 bits), Expect = 0.29, P = 0.25
 Identities = 22/50 (44%), Positives = 29/50 (58%), Frame = -3

Query:   220 SXTSXXSS-SSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S TS  S+ SS IS   SS+  S+ SSS+ SS SS  SS+T+   +   S
Sbjct:   345 SKTSTTSTTSSSISSTTSSTTSSTSSSSTSSSTSSTTSSSTTSSQISTTS 394

 Score = 71 (25.0 bits), Expect = 1.3, P = 0.72
 Identities = 18/44 (40%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             + TS   SSS  S   S +  +S +SSS+SS +S  +S+TS  S
Sbjct:   329 TTTSTTISSSSSSSKTSKTSTTSTTSSSISSTTSSTTSSTSSSS 372

 Score = 71 (25.0 bits), Expect = 1.3, P = 0.72
 Identities = 20/55 (36%), Positives = 32/55 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S TS  +SSS  S  +S++  +  SS+S+SS +   S++TS    D  S++  ET
Sbjct:   375 SSTSSTTSSSTTSSQISTTSTAPTSSTSLSSSTISTSASTS----DTTSVTSSET 425

 Score = 67 (23.6 bits), Expect = 3.4, P = 0.97
 Identities = 16/44 (36%), Positives = 26/44 (59%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +  S +S  +S +  +   SSS  S+ SS++ S+ SS  SS+TS
Sbjct:   335 ISSSSSSSKTSKTSTTSTTSSSISSTTSSTTSSTSSSSTSSSTS 378

 Score = 65 (22.9 bits), Expect = 5.5, P = 1.0
 Identities = 20/51 (39%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   ++SS  S   SSS  SS SS++ SS +S   S TS       SLS
Sbjct:   354 SSSISSTTSSTTSSTSSSSTSSSTSSTTSSSTTSSQISTTSTAPTSSTSLS 404


>sp|P31569|YCF2_OENVI HYPOTHETICAL PROTEIN (ORF 2280) >pir||S29796 hypothetical
            protein 2280 - evening primrose chloroplast (fragment) >gi|14332
            (X64615) ORF2280 gene product [Oenothera berteriana]
            Length = 630

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 0.25, Sum P(2) = 0.22
 Identities = 15/52 (28%), Positives = 26/52 (50%), Frame = +3

Query:    57 VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             +  + +  + +E  + LDE+  E +E EEE  EE++      E  E+ E  E
Sbjct:   441 LEAQQEDELLEEEDEELDEEEDELDEEEEEPKEEEDELHEEEEEEEEEEEEE 492

 Score = 58 (20.4 bits), Expect = 1.0, Sum P(2) = 0.64
 Identities = 16/41 (39%), Positives = 21/41 (51%), Frame = +3

Query:    90 ENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             E  D LDE+  E +E E+E  EE+   E   E  E+ E  E
Sbjct:   459 EEEDELDEEEEEPKEEEDELHEEEEEEEEEEE--EEDELQE 497

 Score = 58 (20.4 bits), Expect = 1.0, Sum P(2) = 0.64
 Identities = 14/47 (29%), Positives = 26/47 (55%), Frame = +3

Query:    84 SKENXDVLDEKXXEXEETEEEXLEEKNX-XETXSEIXEDXEXXEVXE 221
             +++  ++L+E+  E +E E+E  EE+    E   E+ E+ E  E  E
Sbjct:   443 AQQEDELLEEEDEELDEEEDELDEEEEEPKEEEDELHEEEEEEEEEE 489

 Score = 56 (19.7 bits), Expect = 1.6, Sum P(2) = 0.80
 Identities = 15/36 (41%), Positives = 19/36 (52%), Frame = +3

Query:    90 ENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXED 197
             E  D LDE+  E +E E+E  EE+   E   E  ED
Sbjct:   459 EEEDELDEEEEEPKEEEDELHEEEEEEEEEEE-EED 493

 Score = 56 (19.7 bits), Expect = 1.6, Sum P(2) = 0.80
 Identities = 17/55 (30%), Positives = 28/55 (50%), Frame = +3

Query:    57 VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +  + +  + +E  + LDE+  E +E EEE  EE++  E   E  E+ E  E  E
Sbjct:   441 LEAQQEDELLEEEDEELDEEEDELDEEEEEPKEEED--ELHEE-EEEEEEEEEEE 492

 Score = 52 (18.3 bits), Expect = 4.1, Sum P(2) = 0.98
 Identities = 14/30 (46%), Positives = 17/30 (56%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLE-EKNXXE 173
             KE  D L E+  E EE EEE  E ++N  E
Sbjct:   472 KEEEDELHEEEEEEEEEEEEEDELQENDSE 501

 Score = 52 (18.3 bits), Expect = 4.1, Sum P(2) = 0.98
 Identities = 16/33 (48%), Positives = 16/33 (48%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSE 185
             KE  D L E   E EE EEE  EE    E  SE
Sbjct:   472 KEEEDELHE---EEEEEEEEEEEEDELQENDSE 501

 Score = 35 (12.3 bits), Expect = 0.25, Sum P(2) = 0.22
 Identities = 6/10 (60%), Positives = 7/10 (70%), Frame = +2

Query:     2 SPIGDHGTFF 31
             SP  +HGT F
Sbjct:    56 SPAKEHGTLF 65


>sp|P31568|YCF2_OENPI HYPOTHETICAL PROTEIN (ORF 2280) >pir||S29795 hypothetical
            protein 2280 - evening primrose (Oenothera picensis subsp.
            picensis) chloroplast (fragment) >gi|14335 (X64616) ORF2280 gene
            product [Oenothera odorata]
            Length = 721

  Plus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 0.26, Sum P(2) = 0.23
 Identities = 16/41 (39%), Positives = 21/41 (51%), Frame = +3

Query:    90 ENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             E  D LDE+  E +E E+E  EE+   E   E  E+ E  E
Sbjct:   548 EEEDELDEEEEEPKEEEDELHEEEEEEEEEEEEEEEDELQE 588

 Score = 64 (22.5 bits), Expect = 0.33, Sum P(2) = 0.28
 Identities = 15/52 (28%), Positives = 26/52 (50%), Frame = +3

Query:    57 VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             +  + +  + +E  + LDE+  E +E EEE  EE++      E  E+ E  E
Sbjct:   530 LEAQQEDELLEEEDEELDEEEDELDEEEEEPKEEEDELHEEEEEEEEEEEEE 581

 Score = 58 (20.4 bits), Expect = 1.4, Sum P(2) = 0.74
 Identities = 16/33 (48%), Positives = 17/33 (51%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSE 185
             KE  D L E+  E EE EEE  EE    E  SE
Sbjct:   561 KEEEDELHEEEEEEEEEEEEE-EEDELQENDSE 592

 Score = 58 (20.4 bits), Expect = 1.4, Sum P(2) = 0.74
 Identities = 14/47 (29%), Positives = 26/47 (55%), Frame = +3

Query:    84 SKENXDVLDEKXXEXEETEEEXLEEKNX-XETXSEIXEDXEXXEVXE 221
             +++  ++L+E+  E +E E+E  EE+    E   E+ E+ E  E  E
Sbjct:   532 AQQEDELLEEEDEELDEEEDELDEEEEEPKEEEDELHEEEEEEEEEE 578

 Score = 56 (19.7 bits), Expect = 2.2, Sum P(2) = 0.88
 Identities = 17/55 (30%), Positives = 28/55 (50%), Frame = +3

Query:    57 VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +  + +  + +E  + LDE+  E +E EEE  EE++  E   E  E+ E  E  E
Sbjct:   530 LEAQQEDELLEEEDEELDEEEDELDEEEEEPKEEED--ELHEE-EEEEEEEEEEE 581

 Score = 35 (12.3 bits), Expect = 0.26, Sum P(2) = 0.23
 Identities = 6/10 (60%), Positives = 7/10 (70%), Frame = +2

Query:     2 SPIGDHGTFF 31
             SP  +HGT F
Sbjct:    56 SPAKEHGTLF 65


>gi|2408006 (Z99161) hypothetical protein [Schizosaccharomyces pombe]
            Length = 536

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.27, P = 0.23
 Identities = 22/55 (40%), Positives = 28/55 (50%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +L  S  +  SSSS  S   SSSF S  SSS ++S  S  S  +S  S  + S S
Sbjct:    48 MLSSSSATAISSSSSSSPLSSSSFTSPASSSFITSLVSSSSQQSSSSSASLTSSS 102

 Score = 74 (26.0 bits), Expect = 0.56, P = 0.43
 Identities = 21/46 (45%), Positives = 27/46 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             P S +S  + SS  S  V+SS  S  SSSS+S  SS  SS++S  S
Sbjct:   114 PTSSSSSHALSSSSSSLVASSSSSGMSSSSLSHSSSVPSSSSSYHS 159

 Score = 73 (25.7 bits), Expect = 0.72, P = 0.51
 Identities = 22/58 (37%), Positives = 33/58 (56%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXV----SSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSF 65
             +P S +S  +S+S  S  V    SSS  SS S++++SS SS    ++S F+    S SF
Sbjct:    22 IPASSSSAAASTSLSSSSVIPSSSSSMLSSSSATAISSSSSSSPLSSSSFTSPASS-SF 79

 Score = 72 (25.3 bits), Expect = 0.92, P = 0.60
 Identities = 21/54 (38%), Positives = 27/54 (50%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +  S +S   SSS  +   SSSF +S  SSS    SS  +S TS  S  + S S
Sbjct:    57 ISSSSSSSPLSSSSFTSPASSSFITSLVSSSSQQSSSSSASLTSSSSATLTSSS 110

 Score = 68 (23.9 bits), Expect = 2.5, P = 0.92
 Identities = 20/49 (40%), Positives = 28/49 (57%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             TS  SSSS  S   S+S  SS S++  SS S+  +S++S  +L   S S
Sbjct:    81 TSLVSSSSQQSSSSSASLTSSSSATLTSSSSASPTSSSSSHALSSSSSS 129

 Score = 68 (23.9 bits), Expect = 2.5, P = 0.92
 Identities = 18/51 (35%), Positives = 29/51 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SSS+ ++   S+S  SS SS ++SS SS   +++S   +   SLS
Sbjct:    95 SASLTSSSSATLTSSSSASPTSSSSSHALSSSSSSLVASSSSSGMSSSSLS 145

 Score = 67 (23.6 bits), Expect = 3.2, P = 0.96
 Identities = 20/52 (38%), Positives = 27/52 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSF 65
             S     SSS+  S  +SSS     SSSS+ S SS  + ++S  S  + S SF
Sbjct:    20 SSIPASSSSAAASTSLSSSSVIPSSSSSMLSSSSATAISSSSSSSPLSSSSF 71

 Score = 67 (23.6 bits), Expect = 3.2, P = 0.96
 Identities = 25/66 (37%), Positives = 34/66 (51%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS--LS----- 68
             P S +S  + SS  S  V+SS  S  SSSS+S  SS  SS++S  S  + +  LS     
Sbjct:   114 PTSSSSSHALSSSSSSLVASSSSSGMSSSSLSHSSSVPSSSSSYHSSSMTTSGLSSSASI 173

Query:    67 FXETYK 50
                TY+
Sbjct:   174 VSSTYR 179

 Score = 66 (23.2 bits), Expect = 4.1, P = 0.98
 Identities = 22/55 (40%), Positives = 28/55 (50%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +L  S  +  SSSS  S   SSSF S  SSS ++S  S  S  +S  S    SL+
Sbjct:    48 MLSSSSATAISSSSSSSPLSSSSFTSPASSSFITSLVSSSSQQSSSSS---ASLT 99

 Score = 65 (22.9 bits), Expect = 5.2, P = 0.99
 Identities = 22/52 (42%), Positives = 27/52 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSV-SSXSSXFSSNTSXFSLDIXSLS 68
             S T   SSS+  +   SS   SS SSS V SS SS  SS++   S  + S S
Sbjct:   103 SATLTSSSSASPTSSSSSHALSSSSSSLVASSSSSGMSSSSLSHSSSVPSSS 154

 Score = 64 (22.5 bits), Expect = 6.6, P = 1.0
 Identities = 22/49 (44%), Positives = 30/49 (61%), Frame = -3

Query:   226 PXSXTSXXS--SSSXISDXVSSSFF-SSXSSSSVSSXSSXFSSNTSXFS 89
             P S +S  S  SSS I+  VSSS   SS SS+S++S SS   +++S  S
Sbjct:    65 PLSSSSFTSPASSSFITSLVSSSSQQSSSSSASLTSSSSATLTSSSSAS 113

 Score = 64 (22.5 bits), Expect = 6.6, P = 1.0
 Identities = 20/51 (39%), Positives = 24/51 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SSSS      SSS  +S SSS +SS S   SS+    S    S S
Sbjct:   111 SASPTSSSSSHALSSSSSSLVASSSSSGMSSSSLSHSSSVPSSSSSYHSSS 161

 Score = 64 (22.5 bits), Expect = 6.6, P = 1.0
 Identities = 22/54 (40%), Positives = 27/54 (50%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             L  S     SSSS +S   S++  SS SSSS  S SS  S  +S F   + S S
Sbjct:    35 LSSSSVIPSSSSSMLSSS-SATAISSSSSSSPLSSSSFTSPASSSFITSLVSSS 87

 Score = 63 (22.2 bits), Expect = 8.5, P = 1.0
 Identities = 20/54 (37%), Positives = 28/54 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             L  S +   SSSS      SS+  +S SS+S +S SS  + ++S  SL   S S
Sbjct:    83 LVSSSSQQSSSSSASLTSSSSATLTSSSSASPTSSSSSHALSSSSSSLVASSSS 136


>sp|P34735|YLU2_PICAN HYPOTHETICAL PROTEIN IN LEU2 3'REGION >pir||S43455
            hypothetical protein (LEU2 3' region) - yeast (Hansenula
            polymorpha) (fragment) >gi|392894 (U00889) unidentified reading
            frame [Hansenula polymorpha]
            Length = 373

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.27, P = 0.24
 Identities = 24/67 (35%), Positives = 33/67 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SSS+  S   SSS  SS  SS+ SS +S   S +S  +  I S SF ++    +
Sbjct:   134 SSSSLSSSSTSSSSKQSSSPQSSTMSSTDSSPTSSSLSASSTTTSSISSFSFSQSSSSSS 193

Query:    40 IFSKECP 20
               S   P
Sbjct:   194 TTSSSTP 200

 Score = 68 (23.9 bits), Expect = 1.6, P = 0.79
 Identities = 23/55 (41%), Positives = 27/55 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + TS  S++S  S  +SSS  SS S  S S  SS  SS  S  S    SLS   T
Sbjct:   123 TSTSSTSTTSSSSSSLSSSSTSSSSKQSSSPQSSTMSSTDS--SPTSSSLSASST 175

 Score = 65 (22.9 bits), Expect = 3.3, P = 0.96
 Identities = 23/56 (41%), Positives = 26/56 (46%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSX---SSXFSSNTSXFSLDIXSLSFXET 56
             +S  SSSS  S    SS  SS  SS  SS    SS  +S+ S FS    S S   T
Sbjct:   140 SSSTSSSSKQSSSPQSSTMSSTDSSPTSSSLSASSTTTSSISSFSFSQSSSSSSTT 195

 Score = 63 (22.2 bits), Expect = 5.4, P = 1.0
 Identities = 16/38 (42%), Positives = 23/38 (60%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             +S  S+SS  +  +SS  FS  SSSS ++ SS  SS +
Sbjct:   167 SSSLSASSTTTSSISSFSFSQSSSSSSTTSSSTPSSES 204

 Score = 63 (22.2 bits), Expect = 5.4, P = 1.0
 Identities = 18/42 (42%), Positives = 23/42 (54%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +S  SS S   D  S+S  S+ SSSS S  SS  SS++   S
Sbjct:   110 SSAQSSHSSTDDATSTSSTSTTSSSSSSLSSSSTSSSSKQSS 151

 Score = 61 (21.5 bits), Expect = 8.9, P = 1.0
 Identities = 19/41 (46%), Positives = 23/41 (56%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFS--SXSSSSVSSXSSXFSSNTS 98
             +S  SS S   D  S+S  S  S SSSS+SS S+  SS  S
Sbjct:   110 SSAQSSHSSTDDATSTSSTSTTSSSSSSLSSSSTSSSSKQS 150


>gi|436923 (U01849) ORF1 [Trypanosoma brucei]
           Length = 146

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.30, P = 0.26
 Identities = 15/41 (36%), Positives = 19/41 (46%), Frame = -2

Query:   212 FXXFXIFTYF*XCFXXIFFFKXFFFCFFXLXXLLI*YIXIF 90
             F  F  F YF  CF  + FF  FF  FF L    + ++  F
Sbjct:    77 FGLFGFFLYFLLCF--VLFFDLFFMLFFVLGGFFV-FVFFF 114

 Score = 57 (20.1 bits), Expect = 5.6, P = 1.0
 Identities = 19/58 (32%), Positives = 23/58 (39%), Frame = -2

Query:   212 FXXFXIFTYF*XCFXXIF--FFKXFF-------FCFFXLXXLLI*YIXIFLRYXXLIL 66
             F  F  F YF  CF   F  FF  FF       F FF    L +  + + L    L+L
Sbjct:    77 FGLFGFFLYFLLCFVLFFDLFFMLFFVLGGFFVFVFFFCLCLFLFVVVVILLVWLLLL 134


>sp|P53832|YN23_YEAST HYPOTHETICAL 52.3 KD PROTEIN IN MRPL10-ERG24 INTERGENIC
            REGION PRECURSOR >pir||S63257 probable membrane protein YNL283c -
            yeast (Saccharomyces cerevisiae) >gnl|PID|e239724 (Z71559) ORF
            YNL283c [Saccharomyces cerevisiae]
            Length = 503

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.32, P = 0.27
 Identities = 21/44 (47%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S T   SSSS  S   SSS  ++ SSSS SS S+  +S TS  S
Sbjct:   160 SATHSSSSSSTTSTTTSSSETTTSSSSSSSSSSTSTTSTTSTTS 203

 Score = 74 (26.0 bits), Expect = 0.52, P = 0.40
 Identities = 20/51 (39%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS  S++S  S   S+S   S +SSS S+ SS  +S+T   S    S S
Sbjct:   191 SSTSTTSTTSTTSSTTSTSSSPSTTSSSTSASSSSETSSTQATSSSTTSTS 241

 Score = 71 (25.0 bits), Expect = 1.1, P = 0.66
 Identities = 21/44 (47%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S TS  +SSS  +   SSS  SS SS+S +S +S  SS TS  S
Sbjct:   169 STTSTTTSSSETTTSSSSS--SSSSSTSTTSTTSTTSSTTSTSS 210

 Score = 70 (24.6 bits), Expect = 1.4, P = 0.75
 Identities = 18/44 (40%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             + TS  SSSS  S   +S+  ++ S++S SS  S  SS+TS  S
Sbjct:   180 TTTSSSSSSSSSSTSTTSTTSTTSSTTSTSSSPSTTSSSTSASS 223

 Score = 65 (22.9 bits), Expect = 4.8, P = 0.99
 Identities = 19/44 (43%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S TS  +S+S  S   +SS  S+ SSS  SS  +  SS TS  S
Sbjct:   200 STTSSTTSTSS-SPSTTSSSTSASSSSETSSTQATSSSTTSTSS 242

 Score = 65 (22.9 bits), Expect = 4.8, P = 0.99
 Identities = 18/55 (32%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  S+S+  +   +SS  S+ SS S +S S+  SS++   S    S S   T
Sbjct:   186 SSSSSSSTSTTSTTSTTSSTTSTSSSPSTTSSSTSASSSSETSSTQATSSSTTST 240

 Score = 64 (22.5 bits), Expect = 6.2, P = 1.0
 Identities = 23/55 (41%), Positives = 27/55 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S T   SSSS  S   SSS  ++ SSSS SS S+  +S TS  S      S   T
Sbjct:   160 SATHSSSSSSTTSTTTSSSETTTSSSSSSSSSSTSTTSTTSTTS------STTST 208

 Score = 63 (22.2 bits), Expect = 7.9, P = 1.0
 Identities = 15/41 (36%), Positives = 24/41 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S ++  SSS+ +S   S+   +  S+SS ++ SS  SS TS
Sbjct:   132 STSTTSSSSTSVSSKTSTKLDTKTSTSSSATHSSSSSSTTS 172

 Score = 63 (22.2 bits), Expect = 7.9, P = 1.0
 Identities = 18/49 (36%), Positives = 28/49 (57%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S TS  SS S  S   S+S  SS +SS+ ++ SS  S+++S  +  + S
Sbjct:   204 STTSTSSSPSTTSSSTSASS-SSETSSTQATSSSTTSTSSSTSTATVTS 251


>gnl|PID|d1014671 (D89547) vitellogenin I [Gallus gallus] >gnl|PID|d1012771
            (D83747) vitellogenin I [Gallus gallus]
            Length = 1912

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 0.33, P = 0.28
 Identities = 25/51 (49%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  SD  SSS  SS S SS SS SS  SS++   S    S S
Sbjct:  1155 SSSSSSSSSSSSSDSSSSSRSSSSSDSSSSSSSSSSSSSSKSKSSSRSSKS 1205

 Score = 75 (26.4 bits), Expect = 1.8, P = 0.84
 Identities = 24/59 (40%), Positives = 28/59 (47%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK 50
             P   +S   SSS  S   SSS  SS SS S SS  S  SS++S  S    S S   + K
Sbjct:  1146 PFGDSSSSGSSSSSSSSSSSSSDSSSSSRSSSSSDSSSSSSSSSSSSSSKSKSSSRSSK 1204

 Score = 74 (26.0 bits), Expect = 2.3, P = 0.90
 Identities = 26/64 (40%), Positives = 31/64 (48%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S +S  SS S  S   SSS  SS SSSS SS SS  S ++S  S    S S   +    +
Sbjct:  1160 SSSSSSSSDSSSSSRSSSSSDSSSSSSSSSSSSSSKSKSSSRSSKSNRSSSSSNSKDSSS 1219

Query:    40 IFSK 29
               SK
Sbjct:  1220 SSSK 1223

 Score = 72 (25.3 bits), Expect = 3.8, P = 0.98
 Identities = 26/55 (47%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS----SNTSXFSLDIXSLS 68
             S +S  S SS  SD  SSS  SS SSSS S  SS  S    S++S  S D  S S
Sbjct:  1167 SDSSSSSRSSSSSDSSSSSSSSSSSSSSKSKSSSRSSKSNRSSSSSNSKDSSSSS 1221


>pir||S67570 hypothetical protein YDL037c - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e237295 (Z71781) unknown [Saccharomyces cerevisiae]
            >gnl|PID|e252990 (Z74085) ORF YDL037c [Saccharomyces cerevisiae]
            Length = 328

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.38, P = 0.31
 Identities = 20/55 (36%), Positives = 30/55 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + +S  SSS+  S   SSS  SS ++SS ++ SS  SS+T+  S    S +   T
Sbjct:   187 TSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSST 241

 Score = 73 (25.7 bits), Expect = 0.38, P = 0.31
 Identities = 20/55 (36%), Positives = 30/55 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + +S  SSS+  S   SSS  SS ++SS ++ SS  SS+T+  S    S +   T
Sbjct:   192 TSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSST 246

 Score = 72 (25.3 bits), Expect = 0.48, P = 0.38
 Identities = 20/55 (36%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S T+  SS++  S   SS+  SS +SSS +S S+  SS TS  +    + S   T
Sbjct:   183 SSTTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTT 237

 Score = 71 (25.0 bits), Expect = 0.62, P = 0.46
 Identities = 20/55 (36%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + +S  SSS+  S   SSS  SS ++SS ++ SS  SS+T+  S    S     T
Sbjct:   197 TSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTKTSTT 251

 Score = 71 (25.0 bits), Expect = 0.62, P = 0.46
 Identities = 22/63 (34%), Positives = 33/63 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             + +S  SSS+  S   SSS  SS ++SS ++ SS  SS+T+  S    S +   T K  +
Sbjct:   202 TSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTK-TSTTTSSTVKSSS 260

Query:    40 IFS 32
               S
Sbjct:   261 TTS 263

 Score = 70 (24.6 bits), Expect = 0.80, P = 0.55
 Identities = 19/55 (34%), Positives = 30/55 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + ++  SSS+  S   SSS  SS ++SS ++ SS  SS+T+  S    S +   T
Sbjct:   182 TSSTTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSST 236

 Score = 70 (24.6 bits), Expect = 0.80, P = 0.55
 Identities = 19/59 (32%), Positives = 30/59 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCD 44
             + +S  SSS+  S   SSS  SS ++SS ++ SS  SS+T   +    ++    T   D
Sbjct:   207 TSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTKTSTTTSSTVKSSSTTSID 265

 Score = 69 (24.3 bits), Expect = 1.0, P = 0.64
 Identities = 19/55 (34%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S T+  S+++  S   SS+  SS +SSS +S S+  SS TS  +    + S   T
Sbjct:   178 SSTTTSSTTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTT 232

 Score = 68 (23.9 bits), Expect = 1.3, P = 0.73
 Identities = 19/55 (34%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S ++  SS++  S   SS+  SS +SSS +S S+  SS TS  +    + S   T
Sbjct:   188 SSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTT 242

 Score = 67 (23.6 bits), Expect = 1.7, P = 0.81
 Identities = 18/55 (32%), Positives = 30/55 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + ++  SS++  S   SSS  SS ++SS ++ SS  SS+T+  S    S +   T
Sbjct:   177 TSSTTTSSTTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSST 231

 Score = 67 (23.6 bits), Expect = 1.7, P = 0.81
 Identities = 18/58 (31%), Positives = 30/58 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             +  S T+  S+++  +   SS+  SS +SSS +S S+  SS TS  +    + S   T
Sbjct:   170 ITTSSTTTSSTTTSSTTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTT 227

 Score = 63 (22.2 bits), Expect = 4.6, P = 0.99
 Identities = 19/60 (31%), Positives = 30/60 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S ++  SS++  S   SS+  SS +SSS +S S+  S+ TS       + S   T   D+
Sbjct:   213 SSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTKTSTTTSSTVKSSSTTSIDFTTSVDS 272

 Score = 62 (21.8 bits), Expect = 5.9, P = 1.0
 Identities = 18/53 (33%), Positives = 28/53 (52%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             TS  ++SS  +   ++S  SS +SSS +S S+  SS TS  +    + S   T
Sbjct:   172 TSSTTTSSTTTSSTTTS--SSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTT 222

 Score = 61 (21.5 bits), Expect = 7.5, P = 1.0
 Identities = 20/62 (32%), Positives = 33/62 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXF----SLDI-XSLSFXET 56
             + +S  SSS+  S   SSS  SS + +S ++ S+  SS+T+      S+D   S S  + 
Sbjct:   222 TSSSTTSSSTTSSSTTSSSTTSSSTKTSTTTSSTVKSSSTTSIDFTTSVDSHTSSSVADI 281

Query:    55 YK 50
             Y+
Sbjct:   282 YR 283

 Score = 60 (21.1 bits), Expect = 9.7, P = 1.0
 Identities = 19/54 (35%), Positives = 27/54 (50%), Frame = -3

Query:   214 TSXXSSSSXISD-XVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             T   SSS   S    SS+  SS ++SS ++ SS  SS+T+  S    S +   T
Sbjct:   158 TKASSSSITTSSITTSSTTTSSTTTSSTTTSSSTTSSSTTSSSTTSSSTTSSST 211

 Score = 60 (21.1 bits), Expect = 9.7, P = 1.0
 Identities = 18/55 (32%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +   SS +  S   SS+  SS ++SS ++ SS  SS+T+  S    S +   T
Sbjct:   162 SSSITTSSITTSSTTTSSTTTSSTTTSSSTTSSSTTSSSTTSSSTTSSSTTSSST 216


>gi|347502 (L22173) putative [Saccharomyces cerevisiae] >bbs|138411 (S66130)
           UTR2 [Saccharomyces cerevisiae, Peptide, 347 aa] [Saccharomyces
           cerevisiae]
           Length = 347

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.41, P = 0.34
 Identities = 20/44 (45%), Positives = 27/44 (61%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S ++  SSS   SD  SS+  SS +SS+ SS SS  SS++S  S
Sbjct:   240 SSSTATSSSKTSSDHSSSTKKSSKTSSTASSSSSSSSSSSSSSS 283

 Score = 64 (22.5 bits), Expect = 3.8, P = 0.98
 Identities = 22/57 (38%), Positives = 30/57 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD--IXSLSFXET 56
             + +S  SS    S   SS   S+ SSSS SS SS  SS+T+  + D  + S+S   T
Sbjct:   245 TSSSKTSSDHSSSTKKSSKTSSTASSSSSSSSSSSSSSSTATKNGDKVVSSVSSSVT 301

 Score = 62 (21.8 bits), Expect = 6.3, P = 1.0
 Identities = 18/44 (40%), Positives = 21/44 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S T+  SSSS  S   SSS  +      VSS SS  +S T   S
Sbjct:   265 SSTASSSSSSSSSSSSSSSTATKNGDKVVSSVSSSVTSQTQTTS 308


>sp|P32623|UTR2_YEAST UTR2 PROTEIN (UNKNOWN TRANSCRIPT 2 PROTEIN)
            Length = 347

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.41, P = 0.34
 Identities = 20/44 (45%), Positives = 27/44 (61%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S ++  SSS   SD  SS+  SS +SS+ SS SS  SS++S  S
Sbjct:   240 SSSTATSSSKTSSDHSSSTKKSSKTSSTASSSSSSSSSSSSSSS 283

 Score = 64 (22.5 bits), Expect = 3.8, P = 0.98
 Identities = 22/57 (38%), Positives = 30/57 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD--IXSLSFXET 56
             + +S  SS    S   SS   S+ SSSS SS SS  SS+T+  + D  + S+S   T
Sbjct:   245 TSSSKTSSDHSSSTKKSSKTSSTASSSSSSSSSSSSSSSTATKNGDKVVSSVSSSVT 301

 Score = 62 (21.8 bits), Expect = 6.3, P = 1.0
 Identities = 18/44 (40%), Positives = 21/44 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S T+  SSSS  S   SSS  +      VSS SS  +S T   S
Sbjct:   265 SSTASSSSSSSSSSSSSSSTATKNGDKVVSSVSSSVTSQTQTTS 308


>sp|P53269|YG31_YEAST HYPOTHETICAL 27.2 KD PROTEIN IN CLB6-SPT6 INTERGENIC
            REGION >pir||S64423 probable membrane protein YGR115c - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e243487 (Z72899) ORF YGR115c
            [Saccharomyces cerevisiae]
            Length = 259

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.43, P = 0.35
 Identities = 23/49 (46%), Positives = 30/49 (61%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFS--SNTSXFSLD--IXSLSF 65
             SSS ++   S +F +S SSSS+SS SS  S  S+ S  SL   + SLSF
Sbjct:   182 SSSSLTMKPSCTFLASSSSSSISSSSSEESKTSSPSSSSLGALVSSLSF 230


>gnl|PID|d1021604 (AB002306) KIAA0308 [Homo sapiens]
            Length = 1297

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.45, P = 0.36
 Identities = 26/51 (50%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   S S  SS SSSS SS SS  SS+TS  S    S S
Sbjct:   561 SRSSSSSSSSSCSHSRSGS--SSSSSSSCSSASSSSSSSTSSSSSSSSSSS 609

 Score = 69 (24.3 bits), Expect = 5.3, P = 0.99
 Identities = 21/41 (51%), Positives = 24/41 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  S S   S   SSS  SS SSSS SS SS  SS++S
Sbjct:   567 SSSSSCSHSRSGSSSSSSSSCSSASSSSSSSTSSSSSSSSS 607

 Score = 67 (23.6 bits), Expect = 8.6, P = 1.0
 Identities = 22/60 (36%), Positives = 30/60 (50%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNIFS 32
             S  SSSS  S   SSS  S+ SSSS SS SS  S +    +    S +  + Y  +++ S
Sbjct:   579 SSSSSSSSCSSASSSSSSSTSSSSSSSSSSSEESDSDEEEAQKRESTTHMKAYDEESVAS 638


>gnl|PID|d1014442 (D89042) serine repeat antigen [Plasmodium falciparum]
            Length = 260

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.56, P = 0.43
 Identities = 19/30 (63%), Positives = 21/30 (70%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             ISD  SSS  SS SSSS SS SS  SS++S
Sbjct:   192 ISDSSSSSSSSSSSSSSSSSSSSSSSSSSS 221

 Score = 68 (23.9 bits), Expect = 0.93, P = 0.61
 Identities = 21/34 (61%), Positives = 23/34 (67%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             ISD  SSS  SS SSSS SS SS  SS++S  SL
Sbjct:   192 ISDSSSSSSSSSSSSSSSSSSSSSSSSSSSE-SL 224

 Score = 64 (22.5 bits), Expect = 2.6, P = 0.92
 Identities = 18/33 (54%), Positives = 19/33 (57%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSS 128
             P S +S  SSSS  S   SSS  SS SSSS  S
Sbjct:   191 PISDSSSSSSSSSSSSSSSSSSSSSSSSSSSES 223

 Score = 64 (22.5 bits), Expect = 2.6, P = 0.92
 Identities = 18/33 (54%), Positives = 19/33 (57%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             SSSS  S   SSS  SS SSSS SS S    +N
Sbjct:   195 SSSSSSSSSSSSSSSSSSSSSSSSSSSESLPAN 227

 Score = 64 (22.5 bits), Expect = 2.6, P = 0.92
 Identities = 20/35 (57%), Positives = 21/35 (60%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXS 122
             P S +S  SSSS  S   SSS  SS SSSS SS S
Sbjct:   191 PISDSSSSSSSSSSSSSSSSS--SSSSSSSSSSES 223

 Score = 63 (22.2 bits), Expect = 3.3, P = 0.96
 Identities = 21/52 (40%), Positives = 28/52 (53%), Frame = -3

Query:   229 LPXSXTSXXSSSSX-----ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             LP + T+    SS       ++ +S S  SS SSSS SS SS  SS++S  S
Sbjct:   169 LPSNGTTGEQGSSTGTVRGDTEPISDSSSSSSSSSSSSSSSSSSSSSSSSSS 220

 Score = 61 (21.5 bits), Expect = 5.4, P = 1.0
 Identities = 18/31 (58%), Positives = 18/31 (58%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSS 119
             S  SSSS  S   SSS  SS SSSS SS  S
Sbjct:   193 SDSSSSSSSSSSSSSSSSSSSSSSSSSSSES 223

 Score = 59 (20.8 bits), Expect = 9.0, P = 1.0
 Identities = 19/32 (59%), Positives = 21/32 (65%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTS-- 98
             ISD  SSS  SS SSSS SS SS  SS++S  
Sbjct:   192 ISDSSSSSSSSSSSSSSSSSSSSSSSSSSSES 223

 Score = 59 (20.8 bits), Expect = 9.0, P = 1.0
 Identities = 19/33 (57%), Positives = 21/33 (63%), Frame = -3

Query:   187 ISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             ISD  SSS   S SSSS SS SS  SS++S  S
Sbjct:   192 ISDSSSSS---SSSSSSSSSSSSSSSSSSSSSS 221


>pir||E64441 hypothetical protein MJ1134 - Methanococcus jannaschii >gi|1591768
            (U67556) M. jannaschii predicted coding region MJ1134
            [Methanococcus jannaschii]
            Length = 226

  Plus Strand HSPs:

 Score = 52 (18.3 bits), Expect = 0.58, Sum P(2) = 0.44
 Identities = 10/30 (33%), Positives = 18/30 (60%), Frame = +3

Query:   108 DEKXXEXEETEEEXLEEKNXXETXSEIXED 197
             ++K  E EE  EE +EE +  +  +E+ +D
Sbjct:   144 EKKTNEVEEIIEELIEEDDISDIIAELLDD 173

 Score = 33 (11.6 bits), Expect = 0.58, Sum P(2) = 0.44
 Identities = 7/25 (28%), Positives = 13/25 (52%), Frame = +1

Query:     1 QSNRRPWDIL*KICYHIYMFLQRIR 75
             + N  PWD+   I      ++Q+I+
Sbjct:    21 KKNLNPWDV--NIAEIADYYIQKIK 43


>gi|2232272 (AF005405) B2-aldehyde-forming enzyme [Schizophyllum commune]
            Length = 200

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.60, P = 0.45
 Identities = 22/41 (53%), Positives = 22/41 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S TS  SSSS  S   SSS  SS SSSS    SS  SS  S
Sbjct:   124 SSTSEWSSSSSSSSSESSSS-SSSSSSSAEPTSSSASSTAS 163

 Score = 65 (22.9 bits), Expect = 1.3, P = 0.72
 Identities = 22/52 (42%), Positives = 28/52 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS-NTSXFSLDIXSLS 68
             S TS  SSSS  S   SSS  SS SSS+  + SS  S+ ++S  S    + S
Sbjct:   124 SSTSEWSSSSSSSSSESSSSSSSSSSSAEPTSSSASSTASSSAASASATATS 175

 Score = 63 (22.2 bits), Expect = 2.2, P = 0.88
 Identities = 24/55 (43%), Positives = 27/55 (49%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSS--XFSSNTSXFSLDIXSLSFXET 56
             TS  SS+S  S   SSS   S SSSS SS S+    SS +S  S    S S   T
Sbjct:   120 TSTWSSTSEWSSSSSSSSSESSSSSSSSSSSAEPTSSSASSTASSSAASASATAT 174

 Score = 61 (21.5 bits), Expect = 3.6, P = 0.97
 Identities = 18/43 (41%), Positives = 24/43 (55%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             P + ++  S+S   S   SSS  SS SSSS SS +   SS+ S
Sbjct:   117 PETTSTWSSTSEWSSSSSSSSSESSSSSSSSSSSAEPTSSSAS 159

 Score = 61 (21.5 bits), Expect = 3.6, P = 0.97
 Identities = 18/50 (36%), Positives = 28/50 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL 71
             S +S  SSSS  S   +SS  SS +SSS +S S+  +S  +   +++  L
Sbjct:   138 SESSSSSSSSSSSAEPTSSSASSTASSSAASASATATSGGTIEQMNLLVL 187

 Score = 58 (20.4 bits), Expect = 7.7, P = 1.0
 Identities = 17/50 (34%), Positives = 28/50 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL 71
             S +S  SSSS  S   +    SS SS++ SS +S  ++ TS  +++  +L
Sbjct:   135 SSSSESSSSSSSSSSSAEPTSSSASSTASSSAASASATATSGGTIEQMNL 184


>pir||S30839 UTR2 protein - yeast (Saccharomyces cerevisiae) >gi|603639
            (U18779) Utr2p [Saccharomyces cerevisiae]
            Length = 467

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.61, P = 0.45
 Identities = 20/44 (45%), Positives = 27/44 (61%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S ++  SSS   SD  SS+  SS +SS+ SS SS  SS++S  S
Sbjct:   360 SSSTATSSSKTSSDHSSSTKKSSKTSSTASSSSSSSSSSSSSSS 403

 Score = 64 (22.5 bits), Expect = 5.6, P = 1.0
 Identities = 22/57 (38%), Positives = 30/57 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD--IXSLSFXET 56
             + +S  SS    S   SS   S+ SSSS SS SS  SS+T+  + D  + S+S   T
Sbjct:   365 TSSSKTSSDHSSSTKKSSKTSSTASSSSSSSSSSSSSSSTATKNGDKVVSSVSSSVT 421

 Score = 62 (21.8 bits), Expect = 9.2, P = 1.0
 Identities = 18/44 (40%), Positives = 21/44 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S T+  SSSS  S   SSS  +      VSS SS  +S T   S
Sbjct:   385 SSTASSSSSSSSSSSSSSSTATKNGDKVVSSVSSSVTSQTQTTS 428


>gi|1684843 (U77717) pinin [Bos taurus]
            Length = 703

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.61, P = 0.46
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +   SSSS  S   SSS  SS SS S SS +S  SS+TS  S
Sbjct:   586 SRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRTSSSSSSTSGSS 629

 Score = 73 (25.7 bits), Expect = 0.99, P = 0.63
 Identities = 24/50 (48%), Positives = 27/50 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS-XFSLDIXS 74
             S +   SSSS  S   SSS  SS SS S SS +S  SS+TS   S D  S
Sbjct:   586 SRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRTSSSSSSTSGSSSRDSSS 635

 Score = 72 (25.3 bits), Expect = 1.3, P = 0.72
 Identities = 22/51 (43%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSS   S   SSS  +S SSSS S  SS  SS+++  S +  S S
Sbjct:   597 SSSSTSSSSGSSSSSGSSSSRTSSSSSSTSGSSSRDSSSSTTSSSESRSRS 647

 Score = 69 (24.3 bits), Expect = 2.7, P = 0.93
 Identities = 19/41 (46%), Positives = 22/41 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  SSSS  S    SS  S  SSS  SS SS  S ++S
Sbjct:   590 SSSSSSSSSSSTSSSSGSSSSSGSSSSRTSSSSSSTSGSSS 630

 Score = 66 (23.2 bits), Expect = 5.6, P = 1.0
 Identities = 22/51 (43%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SS+S  S   SSS  SS  +SS SS +S  SS  S  S    S S
Sbjct:   593 SSSSSSSSTSSSSGSSSSSGSSSSRTSSSSSSTSGSSSRDSSSSTTSSSES 643


>pir||I53073 fetal troponin T 2 - rat (fragment) >gi|440819 (U04979) fetal
            troponin T 2 [Rattus norvegicus]
            Length = 56

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 0.63, P = 0.47
 Identities = 14/50 (28%), Positives = 26/50 (52%), Frame = +3

Query:    81 ISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXGR 230
             +S E  + ++E+  E EE +EE ++E+   +  +   E+ E  E  E  R
Sbjct:     1 MSDEETEQVEEQYEEEEEAQEEEVQEEEEVQEDAVAEEEREEDEEEEKPR 50


>sp|P10476|GUNA_PSEFL ENDOGLUCANASE A PRECURSOR (ENDO-1,4-BETA-GLUCANASE)
            (CELLULASE) (EGA) >pir||S03818 carboxymethylcellulase (EC 3.2.1.-)
            precursor - Pseudomonas fluorescens subsp. cellulosa >gi|45504
            (X12570) CMCase (AA 1-962) [Pseudomonas fluorescens]
            Length = 962

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.68, P = 0.49
 Identities = 23/53 (43%), Positives = 29/53 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSV--SSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSS  +S   SSS   S SSSS+  SS SS   S++S  S  + S S
Sbjct:   610 SSSSSSSSSVPVSSSSSSSIIPSSSSSSIQPSSSSSSMPSSSSSSSSVVASSS 662

 Score = 67 (23.6 bits), Expect = 6.2, P = 1.0
 Identities = 20/44 (45%), Positives = 23/44 (52%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDI 80
             S  SSSS I    SSS   S SSSS+ S SS  SS  +  S  +
Sbjct:   622 SSSSSSSIIPSSSSSSIQPSSSSSSMPSSSSSSSSVVASSSSSV 665


>sp|P53882|YNR6_YEAST HYPOTHETICAL 67.4 KD PROTEIN IN RPS3-PSD1 INTERGENIC
            REGION >pir||S63131 probable membrane protein YNL176c - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e239549 (Z71452) ORF YNL176c
            [Saccharomyces cerevisiae]
            Length = 636

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 0.69, P = 0.50
 Identities = 27/67 (40%), Positives = 37/67 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXS-SSSVSSXSSXFSSNTSXFSLDIXS---LSFXETY 53
             S TS  SSSS I+   SS   ++ + SSS +S SS +SS +S  SL + S   LS   +Y
Sbjct:   125 SSTSPMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSLSSSY 184

Query:    52 KCDNIFS 32
                 +FS
Sbjct:   185 SDTKLFS 191

 Score = 71 (25.0 bits), Expect = 1.4, P = 0.76
 Identities = 24/62 (38%), Positives = 31/62 (50%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN--TSXFSLDIXSLSFXETYKCDNI 38
             S   S S  S  VS S  S  +SSSVSS SS   SN  +S  S D  + ++  TY   ++
Sbjct:   279 SSKLSPSASSSTVSISTISVPTSSSVSSSSSKVPSNRPSSSSSSDDTTSAYSSTYTFQSL 338

Query:    37 FS 32
              S
Sbjct:   339 QS 340

 Score = 69 (24.3 bits), Expect = 2.4, P = 0.91
 Identities = 28/72 (38%), Positives = 37/72 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSS-SSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCD 44
             S TS  SS +  +  +SSS  S  SS SS+SS SS   S++   SL   S S  + +  D
Sbjct:   135 SITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSLS-SSYSDTKLFSFD 193

Query:    43 N---IFSKECPMV 14
             +   IFS   P V
Sbjct:   194 SRSSIFSPSTPTV 206


>gnl|PID|e312887 (Z72946) ORF YGR159c [Saccharomyces cerevisiae]
            Length = 188

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.69, P = 0.50
 Identities = 20/44 (45%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +   SSSS  S+  S S   S SSSS SS  S  SS++S  S
Sbjct:    31 SSSESSSSSSSSSESESESESESESSSSSSSSDSESSSSSSSDS 74

 Score = 66 (23.2 bits), Expect = 0.89, P = 0.59
 Identities = 26/57 (45%), Positives = 29/57 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK 50
             S +S  SSSS  S   S S   S S SS SS SS   S++S  S D  S S  ET K
Sbjct:    29 SSSSSESSSSSSSSSESESESESESESSSSSSSSDSESSSSSSS-D--SESEAETKK 82

 Score = 57 (20.1 bits), Expect = 9.0, P = 1.0
 Identities = 21/48 (43%), Positives = 22/48 (45%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXE 59
             SSSS  S   SSS  S   S S S  SS  SS+ S  S    S S  E
Sbjct:    30 SSSSESSSSSSSSSESESESESESESSSSSSSSDSESSSSSSSDSESE 77


>gi|459202 (U07055) vitellogenin 1 [Fundulus heteroclitus]
           Length = 1704

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.78, P = 0.54
 Identities = 26/54 (48%), Positives = 28/54 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             L     S  SSSS  S   SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:  1116 LAARTNSSSSSSSRRSRSSSSSSSSSSSSSSSSSSSSRRSSSSSSSSSSSSSRS 1169

 Score = 71 (25.0 bits), Expect = 4.3, P = 0.99
 Identities = 21/38 (55%), Positives = 22/38 (57%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  SSSS  S   SSS  SS  SSS SS SS  SS +S
Sbjct:  1133 SSSSSSSSSSSSSSSSSSSSRRSSSSSSSSSSSSSRSS 1170

 Score = 70 (24.6 bits), Expect = 5.5, P = 1.0
 Identities = 21/38 (55%), Positives = 22/38 (57%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS 107
             S +S  SSSS  S   SSS   S SSSS SS SS  SS
Sbjct:  1133 SSSSSSSSSSSSSSSSSSSSRRSSSSSSSSSSSSSRSS 1170


>sp|P40472|SIM1_YEAST SIM1 PROTEIN >pir||S49886 probable membrane protein
            YIL123w - yeast (Saccharomyces cerevisiae) >gi|599994 (Z46833)
            unknown [Saccharomyces cerevisiae] >gi|763223 (Z47047) unknown
            [Saccharomyces cerevisiae]
            Length = 475

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.79, P = 0.55
 Identities = 20/51 (39%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S T   +SS+  S   S+S  S+ SSSS SS SS  SS +     D+   S
Sbjct:   162 SATKSSTSSTSPSTSTSTSTSSTSSSSSSSSSSSSSSSGSGSIYGDLADFS 212

 Score = 72 (25.3 bits), Expect = 0.79, P = 0.55
 Identities = 26/78 (33%), Positives = 35/78 (44%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS-----FXE- 59
             S T   +SS+  S   S+S  S+ SSSS SS SS  SS +     D+   S     F + 
Sbjct:   162 SATKSSTSSTSPSTSTSTSTSSTSSSSSSSSSSSSSSSGSGSIYGDLADFSGPSEKFQDG 221

Query:    58 TYKCDNIFSKECPMVAYW 5
             T  CD   S +  +   W
Sbjct:   222 TIPCDKFPSGQGVISIDW 239


>gnl|PID|e332357 (Z98254) 114E2.b [Drosophila melanogaster]
            Length = 582

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.80, P = 0.55
 Identities = 21/41 (51%), Positives = 26/41 (63%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  SSSS +S  +S+SF    SSSS SS SS  SS++S  S
Sbjct:   497 SPSSSSSGVS--LSTSFMGGSSSSSSSSSSSSSSSSSSSSS 535

 Score = 64 (22.5 bits), Expect = 7.3, P = 1.0
 Identities = 19/39 (48%), Positives = 21/39 (53%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS 110
             P S +S  S S+      SSS  SS SSSS SS SS  S
Sbjct:   498 PSSSSSGVSLSTSFMGGSSSSSSSSSSSSSSSSSSSSSS 536


>pir||S61993 probable membrane protein YOR009w - yeast (Saccharomyces
            cerevisiae) >gi|1151005 (U43491) hypothetical protein UNB487
            [Saccharomyces cerevisiae] >gnl|PID|e251944 (Z74917) ORF YOR009w
            [Saccharomyces cerevisiae]
            Length = 487

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.82, P = 0.56
 Identities = 20/51 (39%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SSS  +S  V+SS   + SSS+V+S S+  SS  S  S  + S S
Sbjct:   245 SSSVAPSSSEVVSSSVASSTSEATSSSAVTSSSAVSSSTESVSSSSVSSSS 295

 Score = 71 (25.0 bits), Expect = 1.0, P = 0.65
 Identities = 19/54 (35%), Positives = 29/54 (53%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +  S T+  S+++  S+  SSS  SS SSS   S S   SS+ +  S ++ S S
Sbjct:   110 MDASLTTSSSAATSSSEVASSSIASSTSSSVAPSSSEVVSSSVAPSSSEVVSSS 163

 Score = 70 (24.6 bits), Expect = 1.3, P = 0.74
 Identities = 25/50 (50%), Positives = 31/50 (62%), Frame = -3

Query:   220 SXTSXXSSSSXI--SDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSL 71
             S TS  +SSS +  S  VSSS   S SSSSVSS SS  SS+ +  S  + S+
Sbjct:   262 SSTSEATSSSAVTSSSAVSSST-ESVSSSSVSS-SSAVSSSEAVSSSPVSSV 311

 Score = 62 (21.8 bits), Expect = 9.7, P = 1.0
 Identities = 18/51 (35%), Positives = 25/51 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SSS  +S  V+SS     SSS   S S   SS+ +  S ++ S S
Sbjct:   161 SSSVAPSSSEVVSSSVASSSSEVASSSVAPSSSEVVSSSVASSSSEVASSS 211


>pir||C61615 sericin MG-2 - greater wax moth (fragments)
            Length = 286

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 0.84, P = 0.57
 Identities = 21/51 (41%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SS+S  +   SSS  S+  S S SS SS  SS++S  S    S S
Sbjct:   234 SSSSSSSSASNQASATSSSSVSADGSESESSSSSSSSSSSSSESSSSSSWS 284

 Score = 65 (22.9 bits), Expect = 2.3, P = 0.90
 Identities = 21/39 (53%), Positives = 24/39 (61%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSV-SSXSSXFSS 107
             S TS  S S+  S+  SSS  SS SSSS  SS SS +SS
Sbjct:   247 SATSSSSVSADGSESESSSSSSSSSSSSSESSSSSSWSS 285

 Score = 65 (22.9 bits), Expect = 2.3, P = 0.90
 Identities = 21/44 (47%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  +   SSS  S   SSS  SS SSS+ SS SS  SS+T+  S
Sbjct:    31 SSNNSSGSSSNNSSGSSSSNNSSGSSSNNSSGSSSNSSSTNNSS 74

 Score = 64 (22.5 bits), Expect = 2.9, P = 0.95
 Identities = 22/41 (53%), Positives = 25/41 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S TS  S S+  S+  SSS  SS SSSS SS SS  SS +S
Sbjct:   247 SATSSSSVSADGSESESSS--SSSSSSSSSSESSSSSSWSS 285

 Score = 63 (22.2 bits), Expect = 3.8, P = 0.98
 Identities = 21/51 (41%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S ++  S SS  +   SSS  +S S SS  + S   SSN+S  S  I SLS
Sbjct:   104 SSSNNTSGSSRNNSSGSSSSNNSSSGSSAGNSSGSSSSNSSGSS-GIGSLS 153

 Score = 62 (21.8 bits), Expect = 4.8, P = 0.99
 Identities = 18/41 (43%), Positives = 24/41 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  +SS   S+  S S  S+ SS S S+ SS  SSN+S
Sbjct:    28 SGSSSNNSSGSSSNNSSGSSSSNNSSGSSSNNSSGSSSNSS 68

 Score = 60 (21.1 bits), Expect = 8.0, P = 1.0
 Identities = 19/44 (43%), Positives = 23/44 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  +SS   S   SS   S+ SS S S+ SS  SSN S  S
Sbjct:     3 SGSSSNNSSGSSSSNNSSGSSSNNSSGSSSNNSSGSSSNNSSGS 46

 Score = 60 (21.1 bits), Expect = 8.0, P = 1.0
 Identities = 19/44 (43%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSSS  S   SS+  S  SS+S S+ +S  SS+T+  S
Sbjct:    40 SNNSSGSSSSNNSSGSSSNNSSGSSSNSSSTNNSSGSSSTNNSS 83


>sp|P40442|YIQ9_YEAST HYPOTHETICAL 99.7 KD PROTEIN IN SDL1 5'REGION PRECURSOR
            >pir||S50358 hypothetical protein YIL169c - yeast (Saccharomyces
            cerevisiae) >gi|600808 (Z46921) unknown [Saccharomyces cerevisiae]
            >gi|604006 (Z47047) unknown [Saccharomyces cerevisiae]
            Length = 995

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.90, P = 0.59
 Identities = 21/49 (42%), Positives = 27/49 (55%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +S   SSS +SD  SS   SS S+S VSS  S  +S+TS  S  +   S
Sbjct:    93 SSVSQSSSSVSDVSSSVSQSSSSASDVSSSVSQSASSTSDVSSSVSQSS 141

 Score = 69 (24.3 bits), Expect = 3.9, P = 0.98
 Identities = 20/45 (44%), Positives = 25/45 (55%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDI 80
             +S   SSS  SD  SS   SS S+S VSS  S  +S+TS  S  +
Sbjct:   191 SSVSQSSSSASDVSSSVSQSSSSASDVSSSVSQSASSTSDVSSSV 235

 Score = 69 (24.3 bits), Expect = 3.9, P = 0.98
 Identities = 25/54 (46%), Positives = 30/54 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXV---SSSFFSSX---SSSSVSSXSSXFSSNTSXFSLDIXS 74
             S T   SS+S +S  V   SSS  SS    SSSSVS  SS  S ++S  S D+ S
Sbjct:    68 SITQSASSTSGVSSSVGPSSSSVVSSSVSQSSSSVSDVSSSVSQSSSSAS-DVSS 121

 Score = 68 (23.9 bits), Expect = 5.0, P = 0.99
 Identities = 20/49 (40%), Positives = 26/49 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +S   SSS  SD  SS   S+ S+S VSS  S  +S+TS  S  +   S
Sbjct:   149 SSVSQSSSSASDVSSSVSQSASSASDVSSSVSQSASSTSDVSSSVSQSS 197

 Score = 67 (23.6 bits), Expect = 6.4, P = 1.0
 Identities = 22/52 (42%), Positives = 27/52 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVS-SSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SS+S +S  VS SS  +S  SSSVS  SS  S  +S  S    S S
Sbjct:   122 SVSQSASSTSDVSSSVSQSSSSASDVSSSVSQSSSSASDVSSSVSQSASSAS 173

 Score = 67 (23.6 bits), Expect = 6.4, P = 1.0
 Identities = 22/52 (42%), Positives = 27/52 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVS-SSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +   SS+S +S  VS SS  +S  SSSVS  SS  S  +S  S    S S
Sbjct:   178 SVSQSASSTSDVSSSVSQSSSSASDVSSSVSQSSSSASDVSSSVSQSASSTS 229

 Score = 66 (23.2 bits), Expect = 8.2, P = 1.0
 Identities = 20/49 (40%), Positives = 25/49 (51%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             +S   SSS  SD  SS   S+ S+S VSS  S  SS+ S  S  +   S
Sbjct:   107 SSVSQSSSSASDVSSSVSQSASSTSDVSSSVSQSSSSASDVSSSVSQSS 155


>sp|P28284|ICP0_HSV2H TRANS-ACTING TRANSCRIPTIONAL PROTEIN ICP0 (VMW118
            PROTEIN) >pir||EDBEXD immediate-early protein RL2 - human
            herpesvirus 2 (strain HG52) >gnl|PID|e304156 (Z86099) RL2 [human
            herpesvirus 2]
            Length = 825

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 0.93, P = 0.61
 Identities = 21/51 (41%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + +S  SSSS  S   SSS  SS S+SS S+ SS  SS+       + S S
Sbjct:   589 ASSSSASSSSASSSSASSSSASSSSASSSSASSSSASSSAGGAGGSVASAS 639

 Score = 71 (25.0 bits), Expect = 2.0, P = 0.86
 Identities = 19/44 (43%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +  +  SSSS  S   SSS  SS S+SS S+ SS  SS+++  S
Sbjct:   584 AAVAAASSSSASSSSASSSSASSSSASSSSASSSSASSSSASSS 627

 Score = 66 (23.2 bits), Expect = 6.7, P = 1.0
 Identities = 19/45 (42%), Positives = 25/45 (55%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SS + ++   SSS  SS +SSS +S SS  SS+ S  S    S S
Sbjct:   581 SSQAAVAAASSSSASSSSASSSSASSSSASSSSASSSSASSSSAS 625


>gnl|PID|e304193 (Z86099) RL2 [human herpesvirus 2]
            Length = 826

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 0.94, P = 0.61
 Identities = 21/51 (41%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + +S  SSSS  S   SSS  SS S+SS S+ SS  SS+       + S S
Sbjct:   590 ASSSSASSSSASSSSASSSSASSSSASSSSASSSSASSSAGGAGGSVASAS 640

 Score = 71 (25.0 bits), Expect = 2.0, P = 0.86
 Identities = 19/44 (43%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +  +  SSSS  S   SSS  SS S+SS S+ SS  SS+++  S
Sbjct:   585 AAVAAASSSSASSSSASSSSASSSSASSSSASSSSASSSSASSS 628

 Score = 66 (23.2 bits), Expect = 6.7, P = 1.0
 Identities = 19/45 (42%), Positives = 25/45 (55%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SS + ++   SSS  SS +SSS +S SS  SS+ S  S    S S
Sbjct:   582 SSQAAVAAASSSSASSSSASSSSASSSSASSSSASSSSASSSSAS 626


>sp|P42835|EGT2_YEAST EGT2 PROTEIN PRECURSOR (EARLY G1 TRANSCRIPT 2)
            >pir||S55862 probable membrane protein YNL327w - yeast
            (Saccharomyces cerevisiae) >gi|633659 (Z46259) N0320 gene product
            [Saccharomyces cerevisiae] >gnl|PID|e239572 (Z71603) ORF YNL327w
            [Saccharomyces cerevisiae]
            Length = 1041

  Minus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 0.95, P = 0.61
 Identities = 25/56 (44%), Positives = 32/56 (57%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             + TS  +S S +S   SSS  +S SS S+S+ SS   SN S F+    SLS  ETY
Sbjct:   366 ASTSADASMSAVSTVSSSSEQASSSSISLSAPSS---SN-STFTTPSSSLSATETY 417


>pir||S46404 vitellogenin - yellow fever mosquito >gi|472308 (U02548)
            vitellogenin [Aedes aegypti]
            Length = 2139

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.99, P = 0.63
 Identities = 28/77 (36%), Positives = 41/77 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSS-SFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY--- 53
             S +S  S S    +  SS S  SS SSSS SS SS +SS++S  S +  S+S  E Y   
Sbjct:   495 SSSSSSSESKEHRNGTSSYSSSSSSSSSSSSSESSSYSSSSSSSS-ESYSISSEEYYYQP 553

Query:    52 -KCDNIFSKECPMVAYWT 2
                +  ++ E P + ++T
Sbjct:   554 TPANFSYAPEAPFLPFFT 571

 Score = 77 (27.1 bits), Expect = 1.3, P = 0.72
 Identities = 25/64 (39%), Positives = 30/64 (46%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL--DIXSLSFXETYKC 47
             S +S  SSSS  S   SSS  SS  S S+SS    +    + FS   +   L F   YK 
Sbjct:   516 SSSSSSSSSSSESSSYSSSSSSSSESYSISSEEYYYQPTPANFSYAPEAPFLPFFTGYKG 575

Query:    46 DNIF 35
              NIF
Sbjct:   576 YNIF 579


>pir||A56657 PfEMP2/MESA protein (clone 9025/15) - Plasmodium falciparum
            (fragment) >bbs|122453 (S52457) PfEMP2, MESA, PP330=large antigenic
            protein {repeating structure} [Plasmodium falciparum, Malayan Camp
            isolate, Peptide Partial, 126 aa] [Plasmodium falciparum]
            Length = 126

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 0.99, P = 0.63
 Identities = 17/47 (36%), Positives = 26/47 (55%), Frame = +3

Query:    87 KENXDVLD-EKXXEXEETEE-EXLEEKNXXETXSEIXEDXEXXEVXE 221
             KE  +V + E+  E EE +E E ++EK+      EI ++ E  EV E
Sbjct:     1 KEKEEVKEKEEVKEKEEVKEKEEVKEKDTESKDKEIEQEKEKEEVKE 47


>gi|1513292 (U66523) ORFveg113; similar to lysozyme C, Swiss-Prot Accession
            Number P37712 [Dictyostelium discoideum]
            Length = 199

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 0.99, P = 0.63
 Identities = 21/41 (51%), Positives = 24/41 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             + +S  SSSS  S   SSS  SS SSS  SS SS  SS+ S
Sbjct:   126 TSSSGSSSSSSGSSSSSSSGSSSGSSSGSSSGSSSGSSSGS 166

 Score = 64 (22.5 bits), Expect = 1.7, P = 0.81
 Identities = 22/41 (53%), Positives = 23/41 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S TS   SSS  S   SSS  SS SSS  SS SS  SS+ S
Sbjct:   124 SGTSSSGSSSSSSGSSSSS--SSGSSSGSSSGSSSGSSSGS 162

 Score = 62 (21.8 bits), Expect = 2.7, P = 0.94
 Identities = 21/44 (47%), Positives = 23/44 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +   SSSS  S   SSS  SS SSS  SS S   SS+ S  S
Sbjct:   134 SSSGSSSSSSSGSSSGSSSGSSSGSSSGSSSGSGSGSSSGSGSS 177

 Score = 61 (21.5 bits), Expect = 3.6, P = 0.97
 Identities = 20/41 (48%), Positives = 21/41 (51%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S   SSS  S   SSS  S  SSSS S  SS  SS +S  S
Sbjct:   118 SQCGSSSGTSSSGSSSSSSGSSSSSSSGSSSGSSSGSSSGS 158

 Score = 60 (21.1 bits), Expect = 4.6, P = 0.99
 Identities = 19/41 (46%), Positives = 22/41 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  S SS  S   SSS  SS SSS   S SS  S ++S
Sbjct:   138 SSSSSSSGSSSGSSSGSSSGSSSGSSSGSGSGSSSGSGSSS 178

 Score = 59 (20.8 bits), Expect = 6.0, P = 1.0
 Identities = 19/39 (48%), Positives = 21/39 (53%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  S SS  S   SSS  SS SSS  SS SS  S + S
Sbjct:   132 SSSSSGSSSSSSSGSSSGSSSGSSSGSSSGSSSGSGSGS 170


>gi|790835 (L41842) vitellogenin [Aedes aegypti]
           Length = 2148

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.99, P = 0.63
 Identities = 28/77 (36%), Positives = 41/77 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSS-SFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY--- 53
             S +S  S S    +  SS S  SS SSSS SS SS +SS++S  S +  S+S  E Y   
Sbjct:   504 SSSSSSSESKEHRNGTSSYSSSSSSSSSSSSSESSSYSSSSSSSS-ESYSISSEEYYYQP 562

Query:    52 -KCDNIFSKECPMVAYWT 2
                +  ++ E P + ++T
Sbjct:   563 TPANFSYAPEAPFLPFFT 580

 Score = 77 (27.1 bits), Expect = 1.3, P = 0.72
 Identities = 25/64 (39%), Positives = 30/64 (46%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL--DIXSLSFXETYKC 47
             S +S  SSSS  S   SSS  SS  S S+SS    +    + FS   +   L F   YK 
Sbjct:   525 SSSSSSSSSSSESSSYSSSSSSSSESYSISSEEYYYQPTPANFSYAPEAPFLPFFTGYKG 584

Query:    46 DNIF 35
              NIF
Sbjct:   585 YNIF 588


>pir||D61615 sericin MG-1 - greater wax moth (fragment)
            Length = 115

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.0, P = 0.64
 Identities = 19/39 (48%), Positives = 20/39 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S  S  SSSS  S+   SS  SS SS S    SS  SSN
Sbjct:    77 SSGSSGSSSSSSSNGSGSSSGSSQSSGSQGGSSSTSSSN 115

 Score = 60 (21.1 bits), Expect = 1.3, P = 0.73
 Identities = 21/44 (47%), Positives = 22/44 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SS S  S   S S  SS SSSS SS  S  SS +S  S
Sbjct:    59 SSGSSGSSGSSGSSGSSGSSGSSGSSSSSSSNGSGSSSGSSQSS 102

 Score = 59 (20.8 bits), Expect = 1.8, P = 0.83
 Identities = 20/41 (48%), Positives = 21/41 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  S  SS S  S   S S  SS SSSS  S SS  SS +S
Sbjct:    62 SSGSSGSSGSSGSSGSSGSSGSSSSSSSNGSGSSSGSSQSS 102

 Score = 55 (19.4 bits), Expect = 5.3, P = 1.0
 Identities = 21/44 (47%), Positives = 22/44 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S SS  S    SS  S  S SS SS SS  SSN S  S
Sbjct:    54 SGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSSSS--SSNGSGSS 95

 Score = 54 (19.0 bits), Expect = 7.0, P = 1.0
 Identities = 18/44 (40%), Positives = 21/44 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S SS  S   SSS  +   SSS SS SS     +S  S
Sbjct:    69 SGSSGSSGSSGSSGSSSSSSSNGSGSSSGSSQSSGSQGGSSSTS 112


>pir||S03386 antigen (clone 22) - Plasmodium falciparum (fragment) >gi|829215
            (X06426) cDNA22 antigen (1 is 3rd base in codon); pid:g61584
            [Plasmodium falciparum]
            Length = 98

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.0, P = 0.64
 Identities = 16/41 (39%), Positives = 18/41 (43%), Frame = +3

Query:    51 LYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXE 173
             LY S K      K N D LD    E + TEE  +E K   E
Sbjct:    48 LYASRKSSKAC-KNNVDDLDSDVEEADVTEESAVETKKDEE 87


>gi|643117 (X80879) orf3 gene product [unidentified]
           Length = 77

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.0, P = 0.64
 Identities = 17/49 (34%), Positives = 21/49 (42%), Frame = -3

Query:   157 SSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK-CDNIFSKECPMV 14
             S  SSSS S  SS F  N     +   SL    TY  C   F ++C  +
Sbjct:    27 SIYSSSSPSLDSSSFRMNIWVHQMQYFSLDLEHTYTVCPGSFLRQCKTI 75


>sp|P14328|SP96_DICDI SPORE COAT PROTEIN SP96 >pir||S07638 spore coat protein
            SP96 precursor - slime mold (Dictyostelium discoideum) >gi|295736
            (X16491) spore coat protein sp96 [Dictyostelium discoideum]
            Length = 600

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 1.1, P = 0.65
 Identities = 23/51 (45%), Positives = 25/51 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  S   SSS  S   SSS  SS S SS +S SS  SS+ S  S    S S
Sbjct:   472 SAASSSPSSSAASSSPSSSASSSSSPSSSASSSSAPSSSASSSSAPSSSAS 522

 Score = 70 (24.6 bits), Expect = 1.7, P = 0.82
 Identities = 21/41 (51%), Positives = 22/41 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  S   SSS  S   SSS  SS  SSS SS SS  SS +S
Sbjct:   463 SAASSSPSSSAASSSPSSSAASSSPSSSASSSSSPSSSASS 503

 Score = 69 (24.3 bits), Expect = 2.2, P = 0.89
 Identities = 21/44 (47%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  +SSS  S   SSS  SS +SSS SS +S  SS +S  S
Sbjct:   459 SPSSSAASSSPSSSAASSSPSSSAASSSPSSSASSSSSPSSSAS 502

 Score = 69 (24.3 bits), Expect = 2.2, P = 0.89
 Identities = 22/55 (40%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             + +S  SSS+  S   SSS  SS + SS +S SS  SS+ S  S    S S   T
Sbjct:   482 AASSSPSSSASSSSSPSSSASSSSAPSSSASSSSAPSSSASSSSASSSSASSAAT 536

 Score = 68 (23.9 bits), Expect = 2.8, P = 0.94
 Identities = 21/55 (38%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S +S  SSSS  S   SSS   S S+SS S+ SS  SS  +  +  I + +   T
Sbjct:   496 SPSSSASSSSAPSSSASSSSAPSSSASSSSASSSSASSAATTAATTIATTAATTT 550

 Score = 65 (22.9 bits), Expect = 5.9, P = 1.0
 Identities = 20/42 (47%), Positives = 24/42 (57%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +S  SSSS  S   SSS  SS +SSS +  SS  SS+ S  S
Sbjct:   489 SSASSSSSPSSSASSSSAPSSSASSSSAPSSSASSSSASSSS 530

 Score = 63 (22.2 bits), Expect = 9.7, P = 1.0
 Identities = 20/41 (48%), Positives = 23/41 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  +SSS  S   SSS  SS SSSS  S S+  SS  S
Sbjct:   468 SPSSSAASSSPSSSAASSSPSSSASSSSSPSSSASSSSAPS 508

 Score = 63 (22.2 bits), Expect = 9.7, P = 1.0
 Identities = 21/51 (41%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  +SSS  S   SSS  SS +SSS +  SS  SS+    S    S S
Sbjct:   477 SPSSSAASSSPSSSASSSSSPSSSASSSSAPSSSASSSSAPSSSASSSSAS 527


>gi|1684847 (U77718) pinin [Homo sapiens]
            Length = 743

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 1.1, P = 0.65
 Identities = 22/41 (53%), Positives = 23/41 (56%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  SSSS  S   SSS  SS S SS S  SS  SS+TS  S
Sbjct:   603 SSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSS 643

 Score = 72 (25.3 bits), Expect = 1.4, P = 0.74
 Identities = 24/51 (47%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS  S SS  S   SSS  SS SSSS S  SS  SS+++  S +  S S
Sbjct:   612 SSTSSSSGSSSSSGS-SSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRS 661

 Score = 71 (25.0 bits), Expect = 1.7, P = 0.82
 Identities = 21/44 (47%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +   SSSS  S   SSS  SS SS S SS SS  SS+++  S
Sbjct:   599 SRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGS 642

 Score = 71 (25.0 bits), Expect = 1.7, P = 0.82
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS   S SS S SS SS  S ++S  S    S S
Sbjct:   604 SSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSS 654

 Score = 68 (23.9 bits), Expect = 3.6, P = 0.97
 Identities = 22/51 (43%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSS+  S   SSS  SS S SS SS SS   S++   S    S S
Sbjct:   605 SSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSSS 655

 Score = 68 (23.9 bits), Expect = 3.6, P = 0.97
 Identities = 22/51 (43%), Positives = 25/51 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S+SS      SS   SS SSSS SS +S  SS  S  S    S S
Sbjct:   607 SSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSSSES 657

 Score = 66 (23.2 bits), Expect = 5.9, P = 1.0
 Identities = 20/42 (47%), Positives = 22/42 (52%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             T   S SS  S   SSS  SS  SSS S  SS  SS++S  S
Sbjct:   597 TKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSS 638


>pir||A35419 neutrophil protein - pig (fragment) >gi|164673 (M55701) neutrophil
            protein [Sus scrofa]
            Length = 284

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.1, P = 0.66
 Identities = 20/39 (51%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S +   SSSS  S   SSS  SS SS S SS SS  SS+
Sbjct:   140 SRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSS 178

 Score = 64 (22.5 bits), Expect = 2.9, P = 0.95
 Identities = 20/42 (47%), Positives = 22/42 (52%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             TS   S S  S   SSS  SS S SS SS SS   S++S  S
Sbjct:   137 TSKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSS 178

 Score = 60 (21.1 bits), Expect = 7.9, P = 1.0
 Identities = 21/59 (35%), Positives = 28/59 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCD 44
             S TS  S SS  S   SS   SS SS  V++ +   SS+T+  S +  S S    +  D
Sbjct:   153 SSTSSSSGSSSSSGSSSSRSSSSSSSDQVAAAARDSSSSTTSSS-ESRSRSRGRAHNRD 210


>gi|552181 (M21324) parasite protein [Plasmodium falciparum]
           Length = 133

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 1.2, P = 0.69
 Identities = 21/47 (44%), Positives = 26/47 (55%), Frame = -3

Query:   229 LPXSXTSXXSSSSXIS---DXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             LP + T+    SS  +   D  S S  SS SSSS SS SS  SS++S
Sbjct:    56 LPSNGTTGEQGSSTGTVRGDTESISDSSSSSSSSSSSSSSSSSSSSS 102


>sp|P54867|SLG1_YEAST SLG1 PROTEIN PRECURSOR >pir||S61992 SLG1 protein - yeast
            (Saccharomyces cerevisiae) >gi|1072110 (U39481) Slglp
            [Saccharomyces cerevisiae] >gi|1151004 (U43491) hypothetical
            protein UNF378 [Saccharomyces cerevisiae] >gnl|PID|e252318 (Z74916)
            ORF YOR008c [Saccharomyces cerevisiae]
            Length = 378

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 1.2, P = 0.71
 Identities = 19/44 (43%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +   S SS  S   SSS  SS +SS+ S+ SS  SS TS  +
Sbjct:   115 SNSISSSDSSTESTSASSSTTSSTTSSTTSTTSSTTSSTTSSMA 158

 Score = 66 (23.2 bits), Expect = 2.6, P = 0.93
 Identities = 24/66 (36%), Positives = 35/66 (53%), Frame = -3

Query:   220 SXTSXXSSSSXI-----SDXVSSSFFSSXSSSSVSSXSSXFS-----SNTSXFSLDIXSL 71
             S TS  +SSS +     S   ++S  +S SSS+V+S SS  S     S+TS  S D  S+
Sbjct:   152 STTSSMASSSTVQNSPESTQAAASISTSQSSSTVTSESSLTSDTLATSSTSSQSQDATSI 211

Query:    70 SFXETY 53
              +  T+
Sbjct:   212 IYSTTF 217

 Score = 64 (22.5 bits), Expect = 4.3, P = 0.99
 Identities = 16/40 (40%), Positives = 24/40 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S T   S+SS  +   +SS  S+ SS++ S+ SS  SS+T
Sbjct:   123 SSTESTSASSSTTSSTTSSTTSTTSSTTSSTTSSMASSST 162


>gi|2565091 (U80761) CTG26 alternate open reading frame [Homo sapiens]
            Length = 124

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 1.3, P = 0.72
 Identities = 24/55 (43%), Positives = 28/55 (50%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSX-FSLDIXSLS 68
             L P   T+  SS S  S  VSS F  S   SS+S  +S FSS+ S  FS    S S
Sbjct:    42 LRPLEATASFSSLS--SPEVSSVF--SLRRSSLSFSTSGFSSSFSASFSFSFSSFS 93


>sp|P53308|YG4U_YEAST HYPOTHETICAL 11.9 KD PROTEIN IN DIE2-SMI1 INTERGENIC
            REGION >pir||S57692 probable membrane protein YGR228w - yeast
            (Saccharomyces cerevisiae) >gi|886921 (X87941) ORF 114
            [Saccharomyces cerevisiae] >gnl|PID|e243664 (Z73013) ORF YGR228w
            [Saccharomyces cerevisiae]
            Length = 114

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 1.3, P = 0.73
 Identities = 21/64 (32%), Positives = 29/64 (45%), Frame = -3

Query:   193 SXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNIFSKECPMV 14
             S +    SSSFF+   + S S+ S  FSS    FS    SLS   +     I    CP +
Sbjct:    36 SSVCLFTSSSFFADSVTCSFSTCS--FSSTFGCFSSSFLSLSCLMSTLSALISCSACPRL 93

Query:    13 AYWT 2
             + +T
Sbjct:    94 SVFT 97


>sp|P02845|VIT2_CHICK VITELLOGENIN II PRECURSOR (CONTAINS: LIPOVITELLIN;
            PHOSVITIN) >pir||VJCH2 vitellogenin II precursor - chicken
            >gi|63887 (X13607) vitellogenin [Gallus gallus]
            Length = 1850

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 1.4, P = 0.75
 Identities = 23/44 (52%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSSS  S   SSS  SS SS+S SS SS  SS++S  S
Sbjct:  1190 SKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRS 1233

 Score = 74 (26.0 bits), Expect = 2.3, P = 0.90
 Identities = 23/44 (52%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S   SSS  S   SSS  SS SSSS SS SS  SS+ S  S
Sbjct:  1219 SSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSS 1262

 Score = 73 (25.7 bits), Expect = 2.9, P = 0.94
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSSS  S+  SSS  S  SSSS  S SS  SS++S  S
Sbjct:  1203 SSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSS 1246

 Score = 72 (25.3 bits), Expect = 3.7, P = 0.97
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  S   SS   SS SSSS +S SS  SS +S  S
Sbjct:  1187 SNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSS 1230

 Score = 72 (25.3 bits), Expect = 3.7, P = 0.97
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  S+  SSS SS SS  SS +   S    S S
Sbjct:  1194 SSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSS 1244

 Score = 71 (25.0 bits), Expect = 4.7, P = 0.99
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSS   S   SSS  SS SSSS S  SS  SS++S  S
Sbjct:  1223 SSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKS 1266

 Score = 71 (25.0 bits), Expect = 4.7, P = 0.99
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SS S  S   SSS  SS SSSS  S SS  SS++S  S
Sbjct:  1224 SKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSS 1267

 Score = 71 (25.0 bits), Expect = 4.7, P = 0.99
 Identities = 23/51 (45%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  +   SSS   S SSSS S  SS  SS++S  S    S S
Sbjct:  1204 SRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKS 1254

 Score = 70 (24.6 bits), Expect = 6.0, P = 1.0
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS      SSS  SS SS S SS  S  SS++S  S    S S
Sbjct:  1206 SSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSS 1256

 Score = 69 (24.3 bits), Expect = 7.7, P = 1.0
 Identities = 23/51 (45%), Positives = 25/51 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS      SSS  SS S SS SS  S  SS+ S  S    S S
Sbjct:  1193 SSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSS 1243

 Score = 69 (24.3 bits), Expect = 7.7, P = 1.0
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S SS  S   SSS   S SSS  SS SS  SS++S  S    S S
Sbjct:  1211 SSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSS 1261

 Score = 68 (23.9 bits), Expect = 9.8, P = 1.0
 Identities = 21/39 (53%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S  S  SS S  S   SSS  SS SSSS SS SS  SS+
Sbjct:  1230 SSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSS 1268

 Score = 68 (23.9 bits), Expect = 9.8, P = 1.0
 Identities = 21/44 (47%), Positives = 23/44 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S   SSS  S   SSS  SS SSSS S+  S  SS+ S  S
Sbjct:  1186 SSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSS 1229

 Score = 68 (23.9 bits), Expect = 9.8, P = 1.0
 Identities = 23/51 (45%), Positives = 24/51 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S     S SS  S   SSS  SS SSS  SS SS  SSN+   S    S S
Sbjct:  1178 SSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSS 1228


>pir||I50441 vitellogenin - chicken >gi|212881 (M18060) vitellogenin [Gallus
            gallus]
            Length = 1852

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 1.4, P = 0.75
 Identities = 23/44 (52%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSSS  S   SSS  SS SS+S SS SS  SS++S  S
Sbjct:  1192 SKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRS 1235

 Score = 74 (26.0 bits), Expect = 2.3, P = 0.90
 Identities = 23/44 (52%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S   SSS  S   SSS  SS SSSS SS SS  SS+ S  S
Sbjct:  1221 SSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSS 1264

 Score = 73 (25.7 bits), Expect = 2.9, P = 0.94
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSSS  S+  SSS  S  SSSS  S SS  SS++S  S
Sbjct:  1205 SSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSS 1248

 Score = 72 (25.3 bits), Expect = 3.7, P = 0.97
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  S   SS   SS SSSS +S SS  SS +S  S
Sbjct:  1189 SNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSS 1232

 Score = 72 (25.3 bits), Expect = 3.7, P = 0.97
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  S   SSS  S+  SSS SS SS  SS +   S    S S
Sbjct:  1196 SSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSS 1246

 Score = 71 (25.0 bits), Expect = 4.7, P = 0.99
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SSS   S   SSS  SS SSSS S  SS  SS++S  S
Sbjct:  1225 SSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKS 1268

 Score = 71 (25.0 bits), Expect = 4.7, P = 0.99
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SS S  S   SSS  SS SSSS  S SS  SS++S  S
Sbjct:  1226 SKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSS 1269

 Score = 71 (25.0 bits), Expect = 4.7, P = 0.99
 Identities = 23/51 (45%), Positives = 27/51 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS  +   SSS   S SSSS S  SS  SS++S  S    S S
Sbjct:  1206 SRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKS 1256

 Score = 70 (24.6 bits), Expect = 6.0, P = 1.0
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS      SSS  SS SS S SS  S  SS++S  S    S S
Sbjct:  1208 SSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSS 1258

 Score = 69 (24.3 bits), Expect = 7.7, P = 1.0
 Identities = 23/51 (45%), Positives = 25/51 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  SSSS      SSS  SS S SS SS  S  SS+ S  S    S S
Sbjct:  1195 SSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSS 1245

 Score = 69 (24.3 bits), Expect = 7.7, P = 1.0
 Identities = 23/51 (45%), Positives = 26/51 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +S  S SS  S   SSS   S SSS  SS SS  SS++S  S    S S
Sbjct:  1213 SSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSS 1263

 Score = 68 (23.9 bits), Expect = 9.8, P = 1.0
 Identities = 21/39 (53%), Positives = 22/39 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S  S  SS S  S   SSS  SS SSSS SS SS  SS+
Sbjct:  1232 SSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSS 1270

 Score = 68 (23.9 bits), Expect = 9.8, P = 1.0
 Identities = 21/44 (47%), Positives = 23/44 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S   SSS  S   SSS  SS SSSS S+  S  SS+ S  S
Sbjct:  1188 SSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSS 1231

 Score = 68 (23.9 bits), Expect = 9.8, P = 1.0
 Identities = 23/51 (45%), Positives = 24/51 (47%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S     S SS  S   SSS  SS SSS  SS SS  SSN+   S    S S
Sbjct:  1180 SSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSS 1230


>gi|726397 (U23173) K07E1.1 gene product [Caenorhabditis elegans]
           Length = 221

  Minus Strand HSPs:

 Score = 51 (18.0 bits), Expect = 1.4, Sum P(2) = 0.75
 Identities = 13/25 (52%), Positives = 14/25 (56%), Frame = -2

Query:   197 IFTYF*XCFXXIFFFKXFFFCFFXL 123
             I T+F  C   IFFF   FF FF L
Sbjct:    29 IETFF--CEFSIFFFLNLFFPFFPL 51

 Score = 30 (10.6 bits), Expect = 1.4, Sum P(2) = 0.75
 Identities = 6/13 (46%), Positives = 8/13 (61%), Frame = -2

Query:   104 YIXIFLRYXXLIL 66
             ++ IF  Y  LIL
Sbjct:   180 WVRIFCEYGDLIL 192


>pir||S28974 vitellogenin precursor - silver lamprey >gi|213312 (M88749)
            vitellogenin [Ichthyomyzon unicuspus]
            Length = 1823

  Minus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 2.2, P = 0.89
 Identities = 21/35 (60%), Positives = 22/35 (62%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             SSSS  SD  SSS  SS SSSS SS SS  S + S
Sbjct:  1254 SSSSSSSDSSSSSSSSSSSSSSSSSSSSSSSESKS 1288

 Score = 74 (26.0 bits), Expect = 2.2, P = 0.89
 Identities = 23/55 (41%), Positives = 28/55 (50%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL-DIXSLSF 65
             P    S  SSSS  S   SSS  SS SSSS SS SS  S +    ++ D+   +F
Sbjct:  1248 PRPARSSSSSSSSDSSSSSSSSSSSSSSSSSSSSSSSESKSLEWLAVKDVNQSAF 1302

 Score = 71 (25.0 bits), Expect = 4.6, P = 0.99
 Identities = 22/35 (62%), Positives = 23/35 (65%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             SSSS  SD  SSS  SS SSSS SS SS  SS+ S
Sbjct:  1254 SSSSSSSDSSSSS--SSSSSSSSSSSSSSSSSSES 1286

 Score = 71 (25.0 bits), Expect = 4.6, P = 0.99
 Identities = 24/40 (60%), Positives = 26/40 (65%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             SSSS  SD  SSS  SS SSSS SS SS  SS+ S  SL+
Sbjct:  1254 SSSSSSSDSSSSS--SSSSSSSSSSSSSSSSSSESK-SLE 1290

 Score = 62 (21.8 bits), Expect = 1.4, Sum P(2) = 0.75
 Identities = 18/36 (50%), Positives = 22/36 (61%), Frame = -3

Query:   172 SSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSF 65
             SSS   S SSSS SS SS  SS++S  S +  SL +
Sbjct:  1256 SSSSSDSSSSSSSSSSSSSSSSSSSSSSSESKSLEW 1291

 Score = 61 (21.5 bits), Expect = 7.0, Sum P(2) = 1.0
 Identities = 18/32 (56%), Positives = 20/32 (62%), Frame = -3

Query:   184 SDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S   SSS  SS SSSS SS SS  SS++S  S
Sbjct:  1253 SSSSSSSSDSSSSSSSSSSSSSSSSSSSSSSS 1284

 Score = 60 (21.1 bits), Expect = 2.2, Sum P(2) = 0.89
 Identities = 19/35 (54%), Positives = 21/35 (60%), Frame = -3

Query:   172 SSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SSS  SS SSSS SS SS  SS++S  S    S S
Sbjct:  1254 SSSSSSSDSSSSSSSSSSSSSSSSSSSSSSSESKS 1288

 Score = 57 (20.1 bits), Expect = 4.5, Sum P(2) = 0.99
 Identities = 15/36 (41%), Positives = 22/36 (61%), Frame = -3

Query:   157 SSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK 50
             +S SSSS SS SS  SS++S   + + + SF +  K
Sbjct:  1322 ASSSSSSSSSSSSSSSSSSSDSDMTVSAESFEKHSK 1357

 Score = 39 (13.7 bits), Expect = 1.4, Sum P(2) = 0.75
 Identities = 10/20 (50%), Positives = 11/20 (55%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSS 167
             P S +S  SSSS  S   SS
Sbjct:  1129 PGSSSSSSSSSSSSSSSSSS 1148

 Score = 33 (11.6 bits), Expect = 5.6, Sum P(2) = 1.0
 Identities = 8/14 (57%), Positives = 9/14 (64%), Frame = -3

Query:   220 SXTSXXSSSSXISD 179
             S +S  SSSS  SD
Sbjct:  1136 SSSSSSSSSSSSSD 1149

 Score = 31 (10.9 bits), Expect = 8.8, Sum P(2) = 1.0
 Identities = 8/16 (50%), Positives = 9/16 (56%), Frame = -3

Query:   214 TSXXSSSSXISDXVSS 167
             +S  SSSS  SD   S
Sbjct:  1179 SSSSSSSSSSSDSSKS 1194


>gi|1684845 (U77716) pinin [Canis familiaris]
            Length = 773

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 1.4, P = 0.76
 Identities = 22/41 (53%), Positives = 23/41 (56%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  SSSS  S   SSS  SS S SS S  SS  SS+TS  S
Sbjct:   633 SSSSSSSSSSSTSSSSGGSSSSGSSSSRSSSSSSSSTSGSS 673

 Score = 68 (23.9 bits), Expect = 3.8, P = 0.98
 Identities = 21/44 (47%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSS   S   SSS  SS SSSS +S SS   S++S  S
Sbjct:   640 SSSSTSSSSGGSSSSGSSSSRSSSSSSSSTSGSSRRDSSSSTTS 683

 Score = 67 (23.6 bits), Expect = 4.9, P = 0.99
 Identities = 20/44 (45%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +   SSSS  S   SSS   S SS S SS SS  SS+++  S
Sbjct:   629 SRSRSSSSSSSSSSSTSSSSGGSSSSGSSSSRSSSSSSSSTSGS 672


>gnl|PID|e348088 (Z78059) C34B4.2 [Caenorhabditis elegans]
            Length = 1353

  Minus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 1.6, Sum P(2) = 0.79
 Identities = 17/47 (36%), Positives = 24/47 (51%), Frame = -3

Query:   220 SXTSXXSSS--SXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             S     SSS  S   D  +SSF SS SS + ++ S   +S+ S F +
Sbjct:   228 SAAQSPSSSLFSDFDDACTSSFASSLSSPTFATSSESGTSSLSSFDM 274

 Score = 50 (17.6 bits), Expect = 9.9, Sum P(2) = 1.0
 Identities = 13/38 (34%), Positives = 21/38 (55%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSF-FSSXSSSSVSSXSSXFSSN 104
             T   SS +  +  + ++F + S SSS  SS SS  +S+
Sbjct:   431 TKAASSGNSTAGPIRATFGYQSASSSECSSTSSSSASS 468

 Score = 40 (14.1 bits), Expect = 1.6, Sum P(2) = 0.79
 Identities = 7/20 (35%), Positives = 13/20 (65%), Frame = -1

Query:    60 KHINVITYFLKNVPWSPIGL 1
             K++N ITY++ N  +  I +
Sbjct:  1036 KYVNEITYYICNTDFCNIDI 1055


>gnl|PID|d1012542 (D83268) vitellogenin [Athalia rosae]
            Length = 150

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 1.6, P = 0.79
 Identities = 17/34 (50%), Positives = 20/34 (58%), Frame = -3

Query:   154 SXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             S SSSS SS SS  S ++S  S +  SLS  E Y
Sbjct:    45 SSSSSSSSSSSSSSSDSSSSSSSESDSLSSSEEY 78

 Score = 61 (21.5 bits), Expect = 2.1, P = 0.87
 Identities = 18/33 (54%), Positives = 19/33 (57%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S SS  S   SSS  SS SSSS SS S   SS+
Sbjct:    43 SDSSSSSSSSSSSSSSSDSSSSSSSESDSLSSS 75

 Score = 57 (20.1 bits), Expect = 5.9, P = 1.0
 Identities = 17/32 (53%), Positives = 18/32 (56%), Frame = -3

Query:   184 SDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             SD  SSS  SS SSSS  S SS  S + S  S
Sbjct:    43 SDSSSSSSSSSSSSSSSDSSSSSSSESDSLSS 74

 Score = 55 (19.4 bits), Expect = 10., P = 1.0
 Identities = 17/38 (44%), Positives = 20/38 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS 107
             S +S  SSSS  SD  SSS   S  S S+SS    + S
Sbjct:    47 SSSSSSSSSSSSSDSSSSS---SSESDSLSSSEEYWQS 81


>sp|Q04503|DP87_DICDI PRESPORE PROTEIN DP87 PRECURSOR >gnl|PID|d1003589
            (D13973) Dp87 protein [Dictyostelium discoideum]
            Length = 555

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 1.6, P = 0.79
 Identities = 21/43 (48%), Positives = 25/43 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             P S +S   SS+  S   SSS  SS +SS+ SS SS  SS TS
Sbjct:   514 PSSASSSAPSSAS-SSAPSSSASSSAASSAASSESSESSSATS 555

 Score = 64 (22.5 bits), Expect = 6.9, P = 1.0
 Identities = 19/44 (43%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  +SS   S   SSS  SS SSS+ SS SS   S+++  S
Sbjct:   494 SAASSAASSEPSSSAASSSAPSSASSSAPSSASSSAPSSSASSS 537


>gi|392799 (U00691) G5/D6 ORF [Dictyostelium discoideum ]
           Length = 197

  Plus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 1.6, P = 0.80
 Identities = 20/54 (37%), Positives = 27/54 (50%), Frame = +3

Query:    60 SXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             S K +  I+K   +  +E+  E EE EEE  EE+    T SE  E+ E   V E
Sbjct:    38 SYKKRNIINKLPEEEEEEEEEEEEEEEEEEQEEEVEKPTISE-EEEEETPAVSE 90


>pir||S61704 probable transcription factor YPL230w - yeast (Saccharomyces
            cerevisiae) >gi|1181258 (X94561) transcription factor
            [Saccharomyces cerevisiae] >gnl|PID|e246942 (Z73586) ORF YPL230w
            [Saccharomyces cerevisiae]
            Length = 391

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.7, P = 0.81
 Identities = 21/54 (38%), Positives = 30/54 (55%), Frame = -3

Query:   172 SSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNIFSKECPMVA 11
             +SS     SSSS+SS SS  SS+++       S S+ + Y+  NI S   PM+A
Sbjct:   103 TSSHQRKPSSSSLSSSSSASSSSSAS-----SSTSYSDPYRKTNINSGNMPMMA 151


>sp|P32323|AGA1_YEAST A-AGGLUTININ ATTACHMENT SUBUNIT PRECURSOR >pir||A41258
            a-agglutinin core protein AGA1 - yeast (Saccharomyces cerevisiae)
            >gi|170964 (M60590) a-agglutinin core subunit [Saccharomyces
            cerevisiae] >gnl|PID|e239834 (Z71659) ORF YNR044w [Saccharomyces
            cerevisiae]
            Length = 725

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 1.7, P = 0.81
 Identities = 18/44 (40%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S TS  SSS+  S   +S+  SS S+S  S  +S  S++TS +S
Sbjct:   250 SSTSTSSSSTSTSPSSTSTSSSSTSTSPSSKSTSASSTSTSSYS 293

 Score = 70 (24.6 bits), Expect = 2.2, P = 0.88
 Identities = 19/51 (37%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + TS  S+S+  S   +SS  +S SSSS S+  S  S+++S  S    S S
Sbjct:   217 TSTSSSSTSTSPSSTSTSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSSTS 267

 Score = 69 (24.3 bits), Expect = 2.8, P = 0.94
 Identities = 21/58 (36%), Positives = 31/58 (53%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFS-SXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             P S ++  SS+S  S   S+S  S S SSSS S+  S  S+++S  S    S S  ++
Sbjct:   193 PSSTSTSPSSTSTSSSSTSTSSSSTSTSSSSTSTSPSSTSTSSSLTSTSSSSTSTSQS 250

 Score = 68 (23.9 bits), Expect = 3.5, P = 0.97
 Identities = 19/47 (40%), Positives = 27/47 (57%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             L  + TS  S+S+  S   +SS  +S SSSS S+ SS  S++ S  S
Sbjct:   186 LSSTSTSPSSTSTSPSSTSTSSSSTSTSSSSTSTSSSSTSTSPSSTS 232

 Score = 68 (23.9 bits), Expect = 3.5, P = 0.97
 Identities = 20/51 (39%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS  SSS+  S   +S+  SS S+SS  + +S  S++TS  S    S S
Sbjct:   208 SSTSTSSSSTSTSSSSTSTSPSSTSTSSSLTSTSSSSTSTSQSSTSTSSSS 258

 Score = 68 (23.9 bits), Expect = 3.5, P = 0.97
 Identities = 22/60 (36%), Positives = 31/60 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD--IXSLSFXET 56
             L  + TS  S+S+  S   +SS  +S SSSS S+ SS  S++ S  S    + S S   T
Sbjct:   186 LSSTSTSPSSTSTSPSSTSTSSSSTSTSSSSTSTSSSSTSTSPSSTSTSSSLTSTSSSST 245

 Score = 66 (23.2 bits), Expect = 5.8, P = 1.0
 Identities = 19/51 (37%), Positives = 28/51 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + TS  S+S+  S   +S   +S SSSS S+ SS  S+++S  S    S S
Sbjct:   182 TTTSLSSTSTSPSSTSTSPSSTSTSSSSTSTSSSSTSTSSSSTSTSPSSTS 232

 Score = 66 (23.2 bits), Expect = 5.8, P = 1.0
 Identities = 22/55 (40%), Positives = 29/55 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S TS  SSS+  S   S+S  SS +S+S SS S+  SS ++  S    S S   T
Sbjct:   236 SLTSTSSSSTSTSQS-STSTSSSSTSTSPSSTSTSSSSTSTSPSSKSTSASSTST 289

 Score = 65 (22.9 bits), Expect = 7.4, P = 1.0
 Identities = 19/42 (45%), Positives = 26/42 (61%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS-SNTSXFS 89
             S  S+SS ++   SSS  +S SS+S SS S+  S S+TS  S
Sbjct:   229 SSTSTSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSSTSTSS 270

 Score = 64 (22.5 bits), Expect = 9.4, P = 1.0
 Identities = 18/44 (40%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  +SSS  S   SS+  SS S+S+  S  S  +S+TS  S
Sbjct:   248 SQSSTSTSSSSTSTSPSSTSTSSSSTSTSPSSKSTSASSTSTSS 291

 Score = 64 (22.5 bits), Expect = 9.4, P = 1.0
 Identities = 20/52 (38%), Positives = 28/52 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSS-SVSSXSSXFSSNTSXFSLDIXSLS 68
             S TS  S S+  S  ++SS  +  S+S S +S SS F+ +TS     I S S
Sbjct:   285 SSTSTSSYSTSTSPSLTSSSPTLASTSPSSTSISSTFTDSTSSLGSSIASSS 336

 Score = 64 (22.5 bits), Expect = 9.4, P = 1.0
 Identities = 22/55 (40%), Positives = 28/55 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S TS  SSS+  S   SSS  +S SS+S S  S+  SS+ +  S    S S   T
Sbjct:   201 SSTSTSSSSTSTS---SSSTSTSSSSTSTSPSSTSTSSSLTSTSSSSTSTSQSST 252

 Score = 64 (22.5 bits), Expect = 9.4, P = 1.0
 Identities = 20/57 (35%), Positives = 29/57 (50%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             P S ++  SS+S  S   S+S  S+ +S S +S SS  +S +S  S    S S   T
Sbjct:   200 PSSTSTSSSSTSTSSSSTSTSSSSTSTSPSSTSTSSSLTSTSS--SSTSTSQSSTST 254

 Score = 64 (22.5 bits), Expect = 9.4, P = 1.0
 Identities = 21/58 (36%), Positives = 29/58 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSS--XFSSNTSXFSLDIXSLSFXETY 53
             S TS  SSS+  S    S+  SS S+SS S+ +S    SS+ +  S    S S   T+
Sbjct:   264 SSTSTSSSSTSTSPSSKSTSASSTSTSSYSTSTSPSLTSSSPTLASTSPSSTSISSTF 321


>gi|2105341 (U86945) similar to variola A38R and vaccinia A36R [Molluscum
            contagiosum virus subtype 1]
            Length = 401

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.7, P = 0.82
 Identities = 20/48 (41%), Positives = 24/48 (50%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S   +SS +S  VSSS  SS SSS   S  + F S+ S  S    S S
Sbjct:   116 SASGASSSVSSSVSSSVSSSVSSSLSGSARAGFCSSASSSSSSADSNS 163


>gi|2580460 (U19729) Ylr391w-ap [Saccharomyces cerevisiae]
            Length = 238

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 1.7, P = 0.82
 Identities = 19/44 (43%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  S    +S  SS +SSS  + SS  SS+T   S
Sbjct:    96 SASSSASSSSKASSSTKAS--SSSASSSTKASSSSASSSTKASS 137

 Score = 62 (21.8 bits), Expect = 3.7, P = 0.98
 Identities = 17/41 (41%), Positives = 24/41 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S ++  SSSS  S   +SS  ++ SSS  SS  S  SS++S
Sbjct:   119 SSSTKASSSSASSSTKASSSSAAPSSSKASSTESSSSSSSS 159

 Score = 60 (21.1 bits), Expect = 6.1, P = 1.0
 Identities = 16/39 (41%), Positives = 25/39 (64%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             +S  SSS+  S   SSS  +S SS+S S+ +S  S+++S
Sbjct:    94 SSSASSSASSSSKASSSTKASSSSASSSTKASSSSASSS 132

 Score = 59 (20.8 bits), Expect = 7.9, P = 1.0
 Identities = 19/41 (46%), Positives = 23/41 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDX-VSSSFFSSXSSSSVSSXSSXFSSNT 101
             S T   SSS+  S    SS+  SS SSSS  + SS  SS+T
Sbjct:   131 SSTKASSSSAAPSSSKASSTESSSSSSSSTKAPSSEESSST 171


>gi|1226309 (U50312) B0222.1 gene product [Caenorhabditis elegans]
            Length = 285

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 1.8, P = 0.83
 Identities = 19/52 (36%), Positives = 25/52 (48%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S  SS S  S   S S FSS SSS  +S +S + S  + +S +     F  T
Sbjct:    36 SSSSSFSSSSSRSSGSSFSSSSSSRPTSGTSSYRSGNTQYSSNFRQNVFHTT 87

 Score = 64 (22.5 bits), Expect = 2.9, P = 0.95
 Identities = 21/44 (47%), Positives = 22/44 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  S    SSF SS SS   S  SS  S NT   S
Sbjct:    36 SSSSSFSSSSSRSS--GSSFSSSSSSRPTSGTSSYRSGNTQYSS 77


>sp|P18126|GUNB_PSEFL ENDOGLUCANASE B PRECURSOR (ENDO-1,4-BETA-GLUCANASE)
            (CELLULASE) (EGB) >pir||S10527 endoglucanase B precursor -
            Pseudomonas fluorescens >gi|45498 (X52615) precursor protein (AA
            -29 to 482) [Pseudomonas fluorescens]
            Length = 511

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 1.8, P = 0.84
 Identities = 19/34 (55%), Positives = 20/34 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSS 119
             S T   SSSS  S   SSS  SS +SSS SS SS
Sbjct:   226 SSTPLSSSSSSRSSVASSSSLSSATSSSASSVSS 259

 Score = 66 (23.2 bits), Expect = 3.8, P = 0.98
 Identities = 20/41 (48%), Positives = 22/41 (53%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             P S  S  SSSS +S    SS  SS  SSSV   SS  SS+
Sbjct:   135 PSSVASSSSSSSVVSSTPRSS--SSSVSSSVPGTSSSSSSS 173


>gi|529204 (U12964) serine-rich [Caenorhabditis elegans]
           Length = 164

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 1.9, P = 0.85
 Identities = 17/47 (36%), Positives = 26/47 (55%), Frame = -3

Query:   229 LPXSXT---SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             LP S T   S  SSSS  S  ++S++ S+    + SS +   S+N+S
Sbjct:    97 LPSSSTESYSTSSSSSSSSSDLNSAYSSTSEPQATSSSAPESSTNSS 143


>gi|695502 (Z48544) ZK945.10 [Caenorhabditis elegans]
           Length = 672

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 2.0, P = 0.86
 Identities = 18/43 (41%), Positives = 25/43 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             P + T+  SSSS      +SS  SS +SS+ SS S+  SS T+
Sbjct:   372 PSTSTTGPSSSSSTPSSTASSSVSSTASSTQSSTSTQQSSTTT 414


>sp|P17260|KRE1_YEAST KRE1 PROTEIN PRECURSOR >pir||A34677 secretory pathway
            protein KRE1 precursor - yeast (Saccharomyces cerevisiae) >gi|3856
            (X51729) precursor kre1 protein [Saccharomyces cerevisiae]
            >gi|633663 (Z46259) KRE1 gene product [Saccharomyces cerevisiae]
            >gnl|PID|e239570 (Z71598) ORF YNL322c [Saccharomyces cerevisiae]
            Length = 313

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 2.0, P = 0.87
 Identities = 20/51 (39%), Positives = 26/51 (50%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXE 59
             S  S++S  S  VSSS  SS SSSSV + +S  S+     +    S  F E
Sbjct:   145 SSTSATSSASSSVSSSVSSSGSSSSVKTTTSTGSAVAETGTRPDPSTDFTE 195


>pir||S02708 troponin T - fruit fly (Drosophila melanogaster)
            Length = 387

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 2.1, P = 0.88
 Identities = 17/49 (34%), Positives = 24/49 (48%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             +D   + +E  +  DE+  E EE EEE  EE+   E   E  E+ E  E
Sbjct:   337 EDDEEVEEEVVEEEDEEDEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEE 385

 Score = 66 (23.2 bits), Expect = 2.7, P = 0.93
 Identities = 16/41 (39%), Positives = 22/41 (53%), Frame = +3

Query:    99 DVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +V++E+  E EE EEE  EE+   E   E  E+ E  E  E
Sbjct:   345 EVVEEEDEEDEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEE 385


>sp|P20962|THYP_HUMAN PARATHYMOSIN >pir||A32264 parathymosin - human >gi|339699
            (M24398) parathymosin [Homo sapiens]
            Length = 102

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 2.1, P = 0.88
 Identities = 15/54 (27%), Positives = 25/54 (46%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             ++K    +   +V++E+    EE EEE  E+    +   E  ED E  E  + G
Sbjct:    25 EEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEE--EDEEEEEEDDEG 76

 Score = 56 (19.7 bits), Expect = 3.5, P = 0.97
 Identities = 15/46 (32%), Positives = 21/46 (45%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSE-IXEDXEXXEVXE 221
             KE  + ++EK    E  +E   EE+N  E   E   ED E  +  E
Sbjct:    18 KEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGE 63


>pir||S48660 troponin T 1, fast skeletal muscle, fetal - human (fragment)
            >gi|557024 (U14641) fetal troponin T 1 [Homo sapiens]
            Length = 67

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 2.1, P = 0.88
 Identities = 13/47 (27%), Positives = 21/47 (44%), Frame = +3

Query:    81 ISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +S E  + ++E+  E EE +EE  E         E+ ED    +  E
Sbjct:     1 MSDEEVEQVEEQYEEEEEAQEEAAEVHEEVHEPEEVQEDTAEEDAEE 47


>gnl|PID|e300478 (Z84818) GP80 [Bovine herpesvirus 4]
            Length = 273

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 2.1, P = 0.88
 Identities = 18/58 (31%), Positives = 30/58 (51%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             +P + TS  SS +      +++  SS S+++ SS S+  SS  S  S  + S S  +T
Sbjct:    72 VPSTATSSSSSPTSTPTATTTTATSSTSTNTTSSVSTTVSSTASQ-STTLTSTSTNQT 128


>sp|P53753|YN96_YEAST HYPOTHETICAL 121.1 KD PROTEIN IN BIO3-HXT17 INTERGENIC
            REGION PRECURSOR >pir||S63399 probable membrane protein YNR067c -
            yeast (Saccharomyces cerevisiae) >gnl|PID|e239600 (Z71682) ORF
            YNR067c [Saccharomyces cerevisiae]
            Length = 1117

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 2.1, P = 0.88
 Identities = 19/59 (32%), Positives = 30/59 (50%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             LL    ++  SSSS +S  + + + SS   +++SS SS   + TS  SL   + S   T
Sbjct:   332 LLSSLFSTVDSSSSPVSSTLDTIYVSSSMQATISSSSSSRQTKTSSSSLSTSTSSTATT 390


>sp|P19351|TRT_DROME TROPONIN T, SKELETAL MUSCLE (UPHELD PROTEIN) (INTENDED
            THORAX PROTEIN) >gi|8740 (X54504) drosophila troponin-T [Drosophila
            melanogaster]
            Length = 396

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 2.2, P = 0.89
 Identities = 17/49 (34%), Positives = 24/49 (48%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             +D   + +E  +  DE+  E EE EEE  EE+   E   E  E+ E  E
Sbjct:   346 EDDEEVEEEVVEEEDEEDEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEE 394

 Score = 66 (23.2 bits), Expect = 2.8, P = 0.94
 Identities = 16/41 (39%), Positives = 22/41 (53%), Frame = +3

Query:    99 DVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +V++E+  E EE EEE  EE+   E   E  E+ E  E  E
Sbjct:   354 EVVEEEDEEDEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEE 394


>pir||S13251 troponin T - fruit fly (Drosophila melanogaster)
            Length = 396

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 2.2, P = 0.89
 Identities = 17/49 (34%), Positives = 24/49 (48%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             +D   + +E  +  DE+  E EE EEE  EE+   E   E  E+ E  E
Sbjct:   346 EDDEEVEEEVVEEEDEEDEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEE 394

 Score = 66 (23.2 bits), Expect = 2.8, P = 0.94
 Identities = 16/41 (39%), Positives = 22/41 (53%), Frame = +3

Query:    99 DVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +V++E+  E EE EEE  EE+   E   E  E+ E  E  E
Sbjct:   354 EVVEEEDEEDEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEE 394


>sp|Q08193|YOD0_YEAST HYPOTHETICAL 51.9 KD PROTEIN IN MSE1-LAG2 INTERGENIC
            REGION PRECURSOR >pir||S66713 hypothetical protein YOL030w - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e251848 (Z74772) ORF YOL030w
            [Saccharomyces cerevisiae]
            Length = 484

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 2.2, P = 0.89
 Identities = 19/39 (48%), Positives = 23/39 (58%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             TS  SSSS  S   +SS   S SS+S +S SS  +S TS
Sbjct:   404 TSSSSSSSSSSSSSASSSSESSSSTSKASSSSPSASETS 442

 Score = 65 (22.9 bits), Expect = 4.6, P = 0.99
 Identities = 20/38 (52%), Positives = 22/38 (57%), Frame = -3

Query:   181 DXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             D  SSS  SS SSSS +S SS  SS+TS  S    S S
Sbjct:   402 DDTSSSSSSSSSSSSSASSSSESSSSTSKASSSSPSAS 439

 Score = 64 (22.5 bits), Expect = 5.9, P = 1.0
 Identities = 22/42 (52%), Positives = 24/42 (57%), Frame = -3

Query:   181 DXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             D  SSS  SS SSSS +S SS  SS+TS  S    S S  ET
Sbjct:   402 DDTSSSSSSSSSSSSSASSSSESSSSTSKASSSSPSAS--ET 441

 Score = 62 (21.8 bits), Expect = 9.6, P = 1.0
 Identities = 19/39 (48%), Positives = 22/39 (56%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             SSSS  S   SSS  SS  SSS +S +S  S + S  SL
Sbjct:   405 SSSSSSSSSSSSSASSSSESSSSTSKASSSSPSASETSL 443


>pir||I48694 probable transcription factor NFE2L1 - mouse >gi|473090 (X78709)
            NFE2-related factor 1 [Mus musculus]
            Length = 741

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 2.2, P = 0.89
 Identities = 24/70 (34%), Positives = 34/70 (48%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKC 47
             P S +S   SSS  S   SSS  SS SSS     +  +SS++   +LD+        Y+ 
Sbjct:   458 PSSLSSSEGSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSE--TLDLEEAEGAVGYQP 515

Query:    46 DNIFSKECPM 17
             +  +SK C M
Sbjct:   516 E--YSKFCRM 523

 Score = 69 (24.3 bits), Expect = 2.8, P = 0.94
 Identities = 22/53 (41%), Positives = 28/53 (52%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSX-FSLDIXSLSFXE 59
             +S   SS   S+  SSS  SS SSS+ SS SS FS   +  +S D  +L   E
Sbjct:   454 SSHSPSSLSSSEGSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEE 506


>gi|1794254 (U67916) dentin sialophosphoprotein precursor [Mus musculus]
            Length = 940

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 2.3, P = 0.90
 Identities = 25/52 (48%), Positives = 28/52 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS-SNTSXFSLDIXSLS 68
             S +S  SSSS  SD   SS  S  S SS SS SS  S S++S  S D  S S
Sbjct:   690 SDSSDSSSSSDSSDSSDSSDSSDSSGSSDSSDSSASSDSSSSSDSSDSSSSS 741

 Score = 70 (24.6 bits), Expect = 2.9, P = 0.94
 Identities = 24/46 (52%), Positives = 26/46 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS--SNTSXFS 89
             S +S  SSSS  SD  SSS  S  S SS SS SS  S  SN+S  S
Sbjct:   723 SASSDSSSSSDSSDSSSSSDSSDSSDSSDSSDSSESSDSSNSSDSS 768

 Score = 69 (24.3 bits), Expect = 3.7, P = 0.98
 Identities = 23/44 (52%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  SD   SS  SS S SS SS SS  SS++S  S
Sbjct:   675 SSSSDSSSSSNSSDSSDSSDSSSSSDSSDSSDSSD-SSDSSGSS 717

 Score = 69 (24.3 bits), Expect = 3.7, P = 0.98
 Identities = 23/44 (52%), Positives = 26/44 (59%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S SS  SD  SSS  S  SSSS SS SS  SS++S  S
Sbjct:   714 SGSSDSSDSSASSDSSSSSDSSDSSSSSDSSDSSD-SSDSSDSS 756

 Score = 67 (23.6 bits), Expect = 6.0, P = 1.0
 Identities = 21/46 (45%), Positives = 23/46 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             S +S  SS S  SD   SS  S  S SS SS S   SS+ S  S D
Sbjct:   646 SDSSDSSSCSDSSDSSDSSDSSDSSDSSDSSSSDSSSSSNSSDSSD 691

 Score = 66 (23.2 bits), Expect = 7.7, P = 1.0
 Identities = 21/44 (47%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSSS  SD  S S  S  S SS SS SS  S ++S  S
Sbjct:   637 SDSSDSSSSSDSSDSSSCSDSSDSSDSSDSSDSSDSSDSSSSDS 680

 Score = 66 (23.2 bits), Expect = 7.7, P = 1.0
 Identities = 22/44 (50%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S+SS  SD   SS  S  S SS SS SS  SSN+S  S
Sbjct:   756 SESSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSD-SSNSSDSS 798

 Score = 66 (23.2 bits), Expect = 7.7, P = 1.0
 Identities = 20/46 (43%), Positives = 23/46 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             S +S  S SS  SD   SS  SS  SSS S+ S    S+ S  S D
Sbjct:   655 SDSSDSSDSSDSSDSSDSSDSSSSDSSSSSNSSDSSDSSDSSSSSD 700

 Score = 65 (22.9 bits), Expect = 9.9, P = 1.0
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SS S  SD  SSS  S  S SS SS SS  SS++S  S
Sbjct:   666 SSDSSDSSDSSSSDSSSSSNSSDSSDSSDSSSSSD-SSDSSDSS 708

 Score = 65 (22.9 bits), Expect = 9.9, P = 1.0
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S SS  SD   SS  S  S SS SS SS  SSN+S  S
Sbjct:   774 SDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSD-SSNSSDSS 816

 Score = 65 (22.9 bits), Expect = 9.9, P = 1.0
 Identities = 22/44 (50%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S SS  SD   SS  S  S SS SS SS  SSN+S  S
Sbjct:   843 SDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSD-SSNSSDSS 885

 Score = 65 (22.9 bits), Expect = 9.9, P = 1.0
 Identities = 23/47 (48%), Positives = 25/47 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS-SNTSXFSLD 83
             S +S  S SS  SD   SS  S  SSSS SS SS  S S+ S  S D
Sbjct:   619 SDSSDSSDSSDSSDSSDSSDSSDSSSSSDSSDSSSCSDSSDSSDSSD 665

 Score = 65 (22.9 bits), Expect = 9.9, P = 1.0
 Identities = 24/50 (48%), Positives = 26/50 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFS-SNTSXFSLDIXS 74
             S +S  S SS  SD  SSS  S  SS S SS SS  S S+ S  S D  S
Sbjct:   628 SDSSDSSDSSDSSDSSSSSDSSDSSSCSDSSDSSDSSDSSDSSDSSDSSS 677


>gi|684938 (U20661) unknown [Dictyostelium discoideum]
           Length = 421

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 2.3, P = 0.90
 Identities = 22/47 (46%), Positives = 24/47 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDI 80
             S +S  SSSS  S   SSS  SS S SS SS S     N S  S D+
Sbjct:   181 SQSSYESSSSSESSSESSSSESSSSESSSSSESQSSEINYSSNSNDL 227


>gi|1255424 (U53154) C33G8.3 gene product [Caenorhabditis elegans]
            Length = 142

  Plus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 2.4, P = 0.91
 Identities = 17/66 (25%), Positives = 30/66 (45%), Frame = +3

Query:    24 HSLENMLSHLYVSX---KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXE 194
             H LE  L  +       KDK   +KE  +  ++K    ++ +EE  E+K+  +   +  +
Sbjct:    48 HKLEKKLDEIMEKVEKIKDKIEENKEKREKKNKKKGNKKDEDEEEEEDKDKKKKDKKKNK 107

Query:   195 DXEXXE 212
             D E  E
Sbjct:   108 DSEEEE 113


>pir||S53465 flocculation protein FLO1 precursor - yeast (Saccharomyces
            cerevisiae) >gi|694125 (L28920) 1890bp repeat elements added,
            composed of 14 repeats of 135bp repeat element from Watari, J. et
            al., Yeast 10, 211-225 (1994), Molecular cloning and analysis of
            the yeast flocculation gene FLO1 [Saccharomyces cerevisiae]
            Length = 1537

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 2.4, P = 0.91
 Identities = 21/46 (45%), Positives = 27/46 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             P + TS  SSS  IS  V+SS F+S    S S  SS  +++TS FS
Sbjct:  1112 PSNGTSVISSS-VISSSVTSSLFTSSPVISSSVISSSTTTSTSIFS 1156


>sp|Q09625|YS8A_CAEEL HYPOTHETICAL 84.3 KD PROTEIN ZK945.10 IN CHROMOSOME II
            Length = 796

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 2.4, P = 0.91
 Identities = 18/43 (41%), Positives = 25/43 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             P + T+  SSSS      +SS  SS +SS+ SS S+  SS T+
Sbjct:   496 PSTSTTGPSSSSSTPSSTASSSVSSTASSTQSSTSTQQSSTTT 538


>sp|P47178|YJ9O_YEAST HYPOTHETICAL 29.5 KD PROTEIN IN RPS7B-DAL5 INTERGENIC
            REGION PRECURSOR >pir||S57179 hypothetical protein YKL224c homolog
            YJR150c - yeast (Saccharomyces cerevisiae) >gi|1015901 (Z49650) ORF
            YJR150c [Saccharomyces cerevisiae]
            Length = 298

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 2.4, P = 0.91
 Identities = 17/49 (34%), Positives = 27/49 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S TS   +SS  ++  SSS  S+ +SS+ +S  +  SS +S  +  I S
Sbjct:   129 SSTSTSEASSAATESSSSSESSAETSSNAASTQATVSSESSSAASTIAS 177


>gi|2267235 (U69874) delayed anaerobic 1 [Saccharomyces cerevisiae]
            Length = 298

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 2.4, P = 0.91
 Identities = 17/49 (34%), Positives = 27/49 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXS 74
             S TS   +SS  ++  SSS  S+ +SS+ +S  +  SS +S  +  I S
Sbjct:   129 SSTSTSEASSAATESSSSSESSAETSSNAASTQATVSSESSSAASTIAS 177


>sp|P39738|FLID_BACSU FLAGELLAR HOOK-ASSOCIATED PROTEIN 2 (HAP2) (FILAMENT CAP
            PROTEIN) >pir||I40397 fliD protein - Bacillus subtilis >gi|499381
            (Z31376) FliD [Bacillus subtilis]
            Length = 498

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 11/38 (28%), Positives = 22/38 (57%), Frame = -3

Query:   154 SXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             + S+ SV + +   S+  S  ++++ SL+   TYK +N
Sbjct:    77 TSSNESVLTATGSVSAPNSSSTVEVASLATAATYKANN 114

 Score = 32 (11.3 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 5/10 (50%), Positives = 8/10 (80%), Frame = -1

Query:    54 INVITYFLKN 25
             +N +TY +KN
Sbjct:   246 VNGVTYSIKN 255


>gi|1762345 (U56901) flagellar hook-associated protein 2 [Bacillus subtilis]
            Length = 498

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 11/38 (28%), Positives = 22/38 (57%), Frame = -3

Query:   154 SXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             + S+ SV + +   S+  S  ++++ SL+   TYK +N
Sbjct:    77 TSSNESVLTATGSVSAPNSSSTVEVASLATAATYKANN 114

 Score = 32 (11.3 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 5/10 (50%), Positives = 8/10 (80%), Frame = -1

Query:    54 INVITYFLKN 25
             +N +TY +KN
Sbjct:   246 VNGVTYSIKN 255


>gi|1181373 (U42580) Ser-rich [Paramecium bursaria Chlorella virus 1]
            Length = 163

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 2.5, P = 0.91
 Identities = 20/41 (48%), Positives = 22/41 (53%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S   S S IS   SSS  SS SSS  SS SS  SS+ +  S
Sbjct:    92 SISKSLSLISSSESSSESSSESSSESSSESSTKSSSETSSS 132

 Score = 58 (20.4 bits), Expect = 5.4, P = 1.0
 Identities = 20/41 (48%), Positives = 24/41 (58%), Frame = -3

Query:   211 SXXSSSSXISDXVS---SSFFSSXSSSSVSSXSSXFSSNTS 98
             S  +SSS IS+  S   SS  SS S +SVS  SS  SS+ S
Sbjct:    28 SQVTSSSMISNSTSTCSSSVSSSLSIASVSMSSSDSSSSVS 68

 Score = 57 (20.1 bits), Expect = 6.9, P = 1.0
 Identities = 17/38 (44%), Positives = 18/38 (47%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  SSS   S+  S S   S S SS  S S   SS TS
Sbjct:    98 SLISSSESSSESSSESSSESSSESSTKSSSETSSSATS 135


>sp|P53880|YNR9_YEAST HYPOTHETICAL 17.6 KD PROTEIN IN NPR1-RPS3 INTERGENIC
            REGION >pir||S63134 probable membrane protein YNL179c - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e239552 (Z71455) ORF YNL179c
            [Saccharomyces cerevisiae]
            Length = 145

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 2.5, P = 0.92
 Identities = 13/33 (39%), Positives = 16/33 (48%), Frame = -2

Query:   188 YF*XCFXXIFFFKXFFFCFFXLXXLLI*YIXIF 90
             Y+  CF   F F  FFF FF    L+   I +F
Sbjct:    39 YWQSCFSFFFLFFLFFFFFFTFQFLVAFPILLF 71


>gi|1163086 (U43510) microfilarial sheath protein SHP3 [Brugia malayi]
            Length = 222

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 2.6, P = 0.92
 Identities = 17/59 (28%), Positives = 30/59 (50%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             ++P S +S  +S S  S   S++  S+ S S+ S  +S  SS TS  +  + + +   T
Sbjct:    20 IMPTSASSSTTSKSTTSVTTSTAS-STTSKSTTSVTTSTASSTTSKSTTSVTTSTASST 77


>sp|P38894|FLO5_YEAST FLOCCULATION PROTEIN FLO5 PRECURSOR (FLOCCULIN 5)
            >pir||S48992 flocculation protein homolog YHR211w - yeast
            (Saccharomyces cerevisiae) >gi|458919 (U00029) Yhr211wp
            [Saccharomyces cerevisiae]
            Length = 1075

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 2.6, P = 0.93
 Identities = 21/46 (45%), Positives = 27/46 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             P + TS  SSS  IS  V+SS  +S S  S S  SS  +++TS FS
Sbjct:   661 PSNGTSVISSS-VISSSVTSSLVTSSSFISSSVISSSTTTSTSIFS 705


>gi|2307004 (AF011923) tropomyosin-like protein [Echinococcus granulosus]
            Length = 149

  Plus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 2.6, P = 0.93
 Identities = 17/62 (27%), Positives = 29/62 (46%), Frame = +3

Query:    30 LENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLE-EKNXXETXSEIXEDXEX 206
             LE   S L  S +DK    +E   ++       E +E+E L+ E++  ET  ++ E  + 
Sbjct:    69 LERAESRLETSEEDKIVELEEELRIVGNNMKSLEVSEQESLQREESYEETIRDLTERLKT 128

Query:   207 XE 212
              E
Sbjct:   129 AE 130


>sp|P22865|US45_LACLA SECRETED 45 KD PROTEIN PRECURSOR >gi|149525 (M60178)
            secreted protein [Lactococcus lactis]
            Length = 461

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 2.6, P = 0.93
 Identities = 19/43 (44%), Positives = 25/43 (58%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             P   TS  +++S  S   SS+  S+ SSSS SS SS  SS+ S
Sbjct:   274 PQVSTSTDNTTSNASASNSSNSSSNSSSSSSSSSSSSSSSSNS 316

 Score = 64 (22.5 bits), Expect = 5.5, P = 1.0
 Identities = 18/39 (46%), Positives = 23/39 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSN 104
             S  +  S++S  +   SSS  SS SSSS SS SS  +SN
Sbjct:   279 STDNTTSNASASNSSNSSSNSSSSSSSSSSSSSSSSNSN 317

 Score = 63 (22.2 bits), Expect = 7.1, P = 1.0
 Identities = 19/41 (46%), Positives = 24/41 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  S  +SS+  S+  SSS  SS SSSS SS +S    NT+
Sbjct:   285 SNASASNSSNSSSNSSSSS--SSSSSSSSSSSNSNAGGNTN 323

 Score = 63 (22.2 bits), Expect = 7.1, P = 1.0
 Identities = 19/51 (37%), Positives = 30/51 (58%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             + TS  S+SS  +  VS+S  ++ S++S S+ S+  SSN+S  S    S S
Sbjct:   261 AATSSASASSSQAPQVSTSTDNTTSNASASNSSNS-SSNSSSSSSSSSSSS 310


>gi|2062609 (U85969) middle molecular weight neurofilament protein NF-M(1)
            [Xenopus laevis]
            Length = 897

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 2.7, Sum P(2) = 0.93
 Identities = 17/52 (32%), Positives = 23/52 (44%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +DK  + KE     +E     EE  EE  +E+   ET +E     E  EV E
Sbjct:   622 EDKGEVEKEEEAETEEAEGGDEEATEEAQDEEVVEETMTETKIVREKAEVQE 673

 Score = 31 (10.9 bits), Expect = 2.7, Sum P(2) = 0.93
 Identities = 5/8 (62%), Positives = 7/8 (87%), Frame = +3

Query:    21 GHSLENML 44
             GHS +NM+
Sbjct:   264 GHSSQNMI 271


>sp|P40552|YIB1_YEAST HYPOTHETICAL 26.3 KD PROTEIN IN PDR11-FAA3 INTERGENIC
            REGION >pir||S48444 probable membrane protein YIL011w - yeast
            (Saccharomyces cerevisiae) >gi|558391 (Z38113) orf, len: 269, CAI:
            0.52 similar to SRP1_YEAST P10863 SERINE-RICH PROTEIN 1 PRECURSOR
            [Saccharomyces cerevisiae] >gi|763335 (Z47047) unknown
            [Saccharomyces cerevisiae]
            Length = 269

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.7, P = 0.93
 Identities = 18/41 (43%), Positives = 23/41 (56%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S   S++  SD  S+S  SS +SSS S  SS  SS+ S  S
Sbjct:   128 SGSESATASSDASSASESSSAASSSASESSSAASSSASESS 168

 Score = 64 (22.5 bits), Expect = 2.7, P = 0.93
 Identities = 23/55 (41%), Positives = 26/55 (47%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK 50
             +S   SSS  S   S S  SS +SSS S  SS  SS+ S  S    S S  E  K
Sbjct:   140 SSASESSSAASSSASES--SSAASSSASESSSAASSSASESS-SAASSSASEAAK 191

 Score = 63 (22.2 bits), Expect = 3.5, P = 0.97
 Identities = 20/51 (39%), Positives = 25/51 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S  S  SS++  S   SSS  SS +S +  S SS  SS +S  S    S S
Sbjct:   162 SSASESSSAASSSASESSSAASSSASEAAKSSSSAKSSGSSAASSAASSAS 212

 Score = 62 (21.8 bits), Expect = 4.4, P = 0.99
 Identities = 18/41 (43%), Positives = 22/41 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             + +S   SSS  S   S S  SS +SSS S  SS  SS+ S
Sbjct:   149 ASSSASESSSAASSSASES--SSAASSSASESSSAASSSAS 187

 Score = 61 (21.5 bits), Expect = 5.7, P = 1.0
 Identities = 18/44 (40%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  S  SS++  S   SSS  SS +S S S+ SS  S ++S  S
Sbjct:   140 SSASESSSAASSSASESSSAASSSASESSSAASSSASESSSAAS 183

 Score = 59 (20.8 bits), Expect = 9.5, P = 1.0
 Identities = 17/41 (41%), Positives = 21/41 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S +S  +SSS      SSS   S  SS+ SS +S  SS  S
Sbjct:   176 SESSSAASSSASEAAKSSSSAKSSGSSAASSAASSASSKAS 216


>sp|P04550|THYP_RAT PARATHYMOSIN (ZINC-BINDING 11.5 KD PROTEIN) >pir||B31512
            parathymosin - rat >gi|55539 (X16481) 11.5 kDa Zn-binding protein
            [Rattus norvegicus]
            Length = 102

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 2.7, P = 0.93
 Identities = 15/40 (37%), Positives = 19/40 (47%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSE-IXEDXE 203
             KE  D ++EK    E  +E   EE+N  E   E   ED E
Sbjct:    18 KEKKDKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGE 57

 Score = 57 (20.1 bits), Expect = 2.7, P = 0.93
 Identities = 15/54 (27%), Positives = 25/54 (46%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             ++K    +   +V++E+    EE EEE  E+    +   E  ED E  E  + G
Sbjct:    25 EEKAGRKERKKEVVEEEENGAEEEEEETAEDGEDDDEGDE--EDEEEEEEEDEG 76


>prf||1514113A Zn binding protein [Rattus norvegicus]
            Length = 101

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 2.7, P = 0.93
 Identities = 15/40 (37%), Positives = 19/40 (47%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSE-IXEDXE 203
             KE  D ++EK    E  +E   EE+N  E   E   ED E
Sbjct:    17 KEKKDKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGE 56

 Score = 57 (20.1 bits), Expect = 2.7, P = 0.93
 Identities = 15/54 (27%), Positives = 25/54 (46%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             ++K    +   +V++E+    EE EEE  E+    +   E  ED E  E  + G
Sbjct:    24 EEKAGRKERKKEVVEEEENGAEEEEEETAEDGEDDDEGDE--EDEEEEEEEDEG 75


>sp|P08814|THYP_BOVIN PARATHYMOSIN
            Length = 101

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 2.7, P = 0.93
 Identities = 15/54 (27%), Positives = 25/54 (46%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             ++K    +   +V++E+    EE EEE  E+    +   E  ED E  E  + G
Sbjct:    24 EEKAGRKERKKEVVEEEENGAEEEEEETAEDGEEEDDGDE--EDEEEEEEEDEG 75

 Score = 53 (18.7 bits), Expect = 7.2, P = 1.0
 Identities = 14/40 (35%), Positives = 19/40 (47%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSE-IXEDXE 203
             KE  + ++EK    E  +E   EE+N  E   E   ED E
Sbjct:    17 KEKKEKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGE 56


>gi|587436 (X79855) troponin T [Homo sapiens]
           Length = 108

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 2.7, P = 0.93
 Identities = 14/58 (24%), Positives = 25/58 (43%), Frame = +3

Query:    54 YVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             Y   + +    +E  D  +++  + E  EE+   E    ET +E  E+ E  +  E G
Sbjct:    11 YEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDG 68


>gi|206033 (M33025) parathymosin [Rattus norvegicus] >gi|207324 (M20616)
           parathymosin precursor [Rattus norvegicus]
           Length = 80

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 2.7, P = 0.93
 Identities = 15/54 (27%), Positives = 25/54 (46%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             ++K    +   +V++E+    EE EEE  E+    +   E  ED E  E  + G
Sbjct:     3 EEKAGRKERKKEVVEEEENGAEEEEEETAEDGEDDDEGDE--EDEEEEEEEDEG 54


>sp|P38844|YHU3_YEAST HYPOTHETICAL 33.4 KD PROTEIN IN RPL44-DCD1 INTERGENIC
            REGION PRECURSOR >pir||S46760 hypothetical protein YHR143w - yeast
            (Saccharomyces cerevisiae) >gi|500656 (U10397) Yhr143wp
            [Saccharomyces cerevisiae]
            Length = 325

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 2.7, P = 0.94
 Identities = 19/41 (46%), Positives = 26/41 (63%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S   SSS  S+  SSSF +S SS+ +S  SS  SS++S F+
Sbjct:   168 SSQLSSSSSSETSSSSFSTSSSSAPLSLTSS--SSSSSSFA 206

 Score = 63 (22.2 bits), Expect = 4.5, P = 0.99
 Identities = 20/43 (46%), Positives = 26/43 (60%), Frame = -3

Query:   220 SXTSXXSS--SSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S T+  SS  SS  S   SSS FS+ SSS+  S +S  SS++S
Sbjct:   162 SSTAPFSSQLSSSSSSETSSSSFSTSSSSAPLSLTSSSSSSSS 204

 Score = 62 (21.8 bits), Expect = 5.8, P = 1.0
 Identities = 20/46 (43%), Positives = 25/46 (54%), Frame = -3

Query:   202 SSSSXISDXVS-SSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SSS+ +S     SS  SS SSS  SS S   SS+++  SL   S S
Sbjct:   156 SSSAFVSSTAPFSSQLSSSSSSETSSSSFSTSSSSAPLSLTSSSSS 201

 Score = 61 (21.5 bits), Expect = 7.4, P = 1.0
 Identities = 21/57 (36%), Positives = 28/57 (49%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVS--SXSSXFSSNTSXFSLDIXSLSFXET 56
             S T    SS  I    +SS  +  S+SS    + SS F S+T+ FS  + S S  ET
Sbjct:   123 SSTYDIESSQSIESSGTSSATAEPSASSGFRLTSSSAFVSSTAPFSSQLSSSSSSET 179

 Score = 60 (21.1 bits), Expect = 9.5, P = 1.0
 Identities = 21/52 (40%), Positives = 28/52 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSF 65
             S ++  SS++  S  +SSS  S  SSSS S+ SS  S+  S  S    S SF
Sbjct:   156 SSSAFVSSTAPFSSQLSSSSSSETSSSSFSTSSS--SAPLSLTSSSSSSSSF 205


>sp|P18709|VTA2_XENLA VITELLOGENIN A2 PRECURSOR (VTG A2) (CONTAINS:
            LIPOVITELLIN I; LIPOVITELLIN II; PHOSVITIN; PHOSVETTE I; PHOSVETTE
            II) >pir||S03124 vitellogenin A2 precursor - African clawed frog
            >gi|214878 (M18061) vitellogenin [Xenopus laevis]
            Length = 1807

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 2.8, P = 0.94
 Identities = 21/38 (55%), Positives = 24/38 (63%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             SS S  S   SSS  SS SSSS SS SS  SS++S +S
Sbjct:  1126 SSLSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSYS 1163

 Score = 73 (25.7 bits), Expect = 2.8, P = 0.94
 Identities = 20/40 (50%), Positives = 23/40 (57%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S +S  SSSS  S   SSS  SS SSS  SS SS +S  +
Sbjct:  1127 SLSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSYSKRS 1166

 Score = 72 (25.3 bits), Expect = 3.6, P = 0.97
 Identities = 22/38 (57%), Positives = 23/38 (60%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  SSSS  S   SSS  SS SSSS SS SS  SS+ S
Sbjct:  1126 SSLSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSYS 1163


>pir||S19652 cellodextrinase C - Pseudomonas fluorescens
            Length = 748

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 2.9, P = 0.94
 Identities = 20/39 (51%), Positives = 23/39 (58%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             TS   SSS +    SSS  S  SSS VSS SS  SS++S
Sbjct:   137 TSSSVSSSSVVSSSSSSRSSVSSSSVVSSSSSVVSSSSS 175

 Score = 66 (23.2 bits), Expect = 6.0, P = 1.0
 Identities = 20/38 (52%), Positives = 21/38 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS 107
             S +S  SSSS     VSSS   S SSS VSS SS   S
Sbjct:   142 SSSSVVSSSSSSRSSVSSSSVVSSSSSVVSSSSSSVVS 179

 Score = 65 (22.9 bits), Expect = 7.6, P = 1.0
 Identities = 20/45 (44%), Positives = 24/45 (53%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVS-SXSSXFSSNT 101
             ++P S +S  S  S  S  VSSS   S SSSSVS   +  F  NT
Sbjct:   247 VVPPSSSSSSSVPSSSSSSVSSSSVVSSSSSSVSVPGTGVFRVNT 291

 Score = 65 (22.9 bits), Expect = 7.6, P = 1.0
 Identities = 22/48 (45%), Positives = 27/48 (56%), Frame = -3

Query:   229 LPXSXTSXXSSSSXIS-DXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSL 86
             +  S     SSSS +     SSS   S SSSSVSS SS  SS++S  S+
Sbjct:   234 ISSSSVRSSSSSSVVPPSSSSSSSVPSSSSSSVSS-SSVVSSSSSSVSV 281

 Score = 65 (22.9 bits), Expect = 7.6, P = 1.0
 Identities = 22/53 (41%), Positives = 27/53 (50%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFF--SSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S +    SSS +    SSS    SS SSSSV S SS   S++S  S    S+S
Sbjct:   228 SSSPSSISSSSVRSSSSSSVVPPSSSSSSSVPSSSSSSVSSSSVVSSSSSSVS 280


>sp|P27033|GUNC_PSEFL ENDOGLUCANASE C PRECURSOR (ENDO-1,4-BETA-GLUCANASE)
            (CELLULASE) (EGC) (CELLODEXTRINASE C) >pir||S16849 cellodextrinase
            C - Pseudomonas fluorescens >gi|45502 (X61299) cellodextrinase C
            (CELC) [Pseudomonas fluorescens]
            Length = 748

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 2.9, P = 0.94
 Identities = 20/39 (51%), Positives = 23/39 (58%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             TS   SSS +    SSS  S  SSS VSS SS  SS++S
Sbjct:   137 TSSSVSSSSVVSSSSSSRSSVSSSSVVSSSSSVVSSSSS 175

 Score = 66 (23.2 bits), Expect = 6.0, P = 1.0
 Identities = 20/38 (52%), Positives = 21/38 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS 107
             S +S  SSSS     VSSS   S SSS VSS SS   S
Sbjct:   142 SSSSVVSSSSSSRSSVSSSSVVSSSSSVVSSSSSSVVS 179


>sp|Q01042|IE68_HSVSA IMMEDIATE-EARLY PROTEIN >pir||EDBEQ3 immediate-early
            protein - saimiriine herpesvirus 1 (strain 11) >gi|60394 (X64346)
            ORF 73; ECLF1 [Saimiriine herpesvirus 2] >bbs|76370 (S76368) ORF 5'
            of ECRF3 [herpesvirus saimiri HVS, host-squirrel monkey, Peptide,
            407 aa] [Saimiriine herpesvirus 2] >gi|331002 (M86409) first
            methionine codon in the ECLF1 ORF [Herpesvirus saimiri]
            Length = 407

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 2.9, P = 0.94
 Identities = 15/46 (32%), Positives = 23/46 (50%), Frame = +3

Query:    84 SKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             ++E  +  +E+  E  E EEE  EE+   E  +E  E+ E  E  E
Sbjct:   111 AEEAEEEAEEEEAEEAEAEEEEAEEEEAEEEEAEEAEEEEAEEAEE 156

 Score = 65 (22.9 bits), Expect = 3.7, P = 0.97
 Identities = 16/45 (35%), Positives = 20/45 (44%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +E  +  +E+  E EE EEE  EE    E   E  E  E  E  E
Sbjct:   161 EEAEEEAEEEAEEAEEAEEEAEEEAEEAEEAEEAEEAEEEAEEAE 205

 Score = 61 (21.5 bits), Expect = 10., P = 1.0
 Identities = 14/37 (37%), Positives = 17/37 (45%), Frame = +3

Query:   111 EKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             E+  E EE EEE  E +   E   E  E+ E  E  E
Sbjct:   189 EEAEEAEEAEEEAEEAEEEAEEAEEEAEEAEEAEEAE 225

 Score = 61 (21.5 bits), Expect = 10., P = 1.0
 Identities = 16/46 (34%), Positives = 21/46 (45%), Frame = +3

Query:    84 SKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             ++E  +  +E   E EE EEE  EE    E   E  E+ E  E  E
Sbjct:   194 AEEAEEEAEEAEEEAEEAEEEA-EEAEEAEEAEEAEEEAEEAEEEE 238


>prf||1804350B ECLF2 upstream ORF [saimirine herpesvirus 1]
            Length = 407

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 2.9, P = 0.94
 Identities = 15/46 (32%), Positives = 23/46 (50%), Frame = +3

Query:    84 SKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             ++E  +  +E+  E  E EEE  EE+   E  +E  E+ E  E  E
Sbjct:   111 AEEAEEEAEEEEAEEAEAEEEEAEEEEAEEEEAEEAEEEEAEEAEE 156

 Score = 65 (22.9 bits), Expect = 3.7, P = 0.97
 Identities = 16/45 (35%), Positives = 20/45 (44%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +E  +  +E+  E EE EEE  EE    E   E  E  E  E  E
Sbjct:   161 EEAEEEAEEEAEEAEEAEEEAEEEAEEAEEAEEAEEAEEEAEEAE 205

 Score = 61 (21.5 bits), Expect = 10., P = 1.0
 Identities = 14/37 (37%), Positives = 17/37 (45%), Frame = +3

Query:   111 EKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             E+  E EE EEE  E +   E   E  E+ E  E  E
Sbjct:   189 EEAEEAEEAEEEAEEAEEEAEEAEEEAEEAEEAEEAE 225

 Score = 61 (21.5 bits), Expect = 10., P = 1.0
 Identities = 16/46 (34%), Positives = 21/46 (45%), Frame = +3

Query:    84 SKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             ++E  +  +E   E EE EEE  EE    E   E  E+ E  E  E
Sbjct:   194 AEEAEEEAEEAEEEAEEAEEEA-EEAEEAEEAEEAEEEAEEAEEEE 238


>gi|313757 (Y00354) vitellogenin A2 precursor [Xenopus laevis]
           Length = 1869

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 2.9, P = 0.95
 Identities = 21/38 (55%), Positives = 24/38 (63%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             SS S  S   SSS  SS SSSS SS SS  SS++S +S
Sbjct:  1188 SSLSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSYS 1225

 Score = 73 (25.7 bits), Expect = 2.9, P = 0.95
 Identities = 20/40 (50%), Positives = 23/40 (57%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S +S  SSSS  S   SSS  SS SSS  SS SS +S  +
Sbjct:  1189 SLSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSYSKRS 1228

 Score = 72 (25.3 bits), Expect = 3.7, P = 0.98
 Identities = 22/38 (57%), Positives = 23/38 (60%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  SSSS  S   SSS  SS SSSS SS SS  SS+ S
Sbjct:  1188 SSLSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSYS 1225


>dbj||D89125_1 (D89125) unnamed protein product [Schizosaccharomyces pombe]
            Length = 284

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.9, P = 0.95
 Identities = 24/60 (40%), Positives = 31/60 (51%), Frame = -3

Query:   229 LPXSXTSX-XSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXF-SLDIXSLSFXET 56
             L  S TS   SSSS I     S   S+  S+S SS S   SS+TS   S  + ++   E+
Sbjct:   138 LSSSTTSGLTSSSSTIPSSTRSE--SNSESASTSSASKRSSSSTSLVQSNPVKTVVSLES 195

Query:    55 YK 50
             YK
Sbjct:   196 YK 197


>pir||S30385 G9a protein - human >gi|287865 (X69838) G9a [Homo sapiens]
            Length = 1001

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 3.1, P = 0.96
 Identities = 17/40 (42%), Positives = 20/40 (50%), Frame = +3

Query:    84 SKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXE 203
             SK   + L E+  E EE EEE  EE+   E   E  ED E
Sbjct:    78 SKSEVEALTEQLSEEEEEEEEEEEEEEEEEEEEEEEEDEE 117


>pir||E48338 hypothetical protein orf71 - equine herpesvirus 4 (strain 405/76)
            (fragment) >gi|330934 (M89634) glycoprotein J [Equine herpesvirus
            type 4]
            Length = 116

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.1, P = 0.96
 Identities = 15/41 (36%), Positives = 25/41 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             + TS  +SSS  +   S+S   + SSS+VS+ ++  S+N S
Sbjct:    62 TTTSSQTSSSNSTQTPSTSQTPTTSSSTVSTTTTSNSTNES 102


>gi|406446 (U02192) Homology to surface protein antigen D90354 [Mycoplasma
           genitalium]
           Length = 117

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 3.2, P = 0.96
 Identities = 12/53 (22%), Positives = 26/53 (49%), Frame = -2

Query:   221 FXYFXXFXIFTYF*XCFXXIFFFKXF-FFCFFXLXXLLI*YIXIFLRYXXLIL 66
             F ++  F    +F  CF  + F+  F  + ++     +I +I + +R+  +IL
Sbjct:    60 FNWWIKFSFCRWFKNCFSRLLFYLRFKLWLWWFWFNFIIWFIKVIIRFIYIIL 112


>sp|Q10020|YSX1_CAEEL HYPOTHETICAL 14.2 KD PROTEIN T28D9.1 IN CHROMOSOME II
            >gi|861271 (U28738) coded for by C. elegans cDNA CEESG95R; coded
            for by C. elegans cDNA CEESG95RB; coded for by C. elegans cDNA
            CEESM72F [Caenorhabditis elegans]
            Length = 129

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 3.2, P = 0.96
 Identities = 18/43 (41%), Positives = 23/43 (53%), Frame = +3

Query:   102 VLDEKXXE-----XEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             V+DEK  E      EET+ E  EEKN  ET +E  +  +  E  E
Sbjct:    33 VIDEKTSEQNGEKTEETQAEATEEKN--ETEAEEADKDKAVENGE 75


>sp|P39712|YAG3_YEAST HYPOTHETICAL 138.1 KD PROTEIN IN FLO9-GDH3 INTERGENIC
            PRECURSOR >gi|758410 (U12980) FLO1 homolog [Saccharomyces
            cerevisiae]
            Length = 1322

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 3.3, P = 0.96
 Identities = 19/59 (32%), Positives = 32/59 (54%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNI 38
             +S  +S+S +S+   SS   + SS+S SS S   S++++  S  I S S   TY   ++
Sbjct:   934 SSTTTSASILSESSKSSVIPTSSSTSGSSESETGSASSASSSSSISSESPKSTYSSSSL 992


>gi|2252837 (AF013293) No definition line found [Arabidopsis thaliana]
            Length = 302

  Plus Strand HSPs:

 Score = 46 (16.2 bits), Expect = 3.3, Sum P(2) = 0.96
 Identities = 14/53 (26%), Positives = 27/53 (50%), Frame = +3

Query:    27 SLENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSE 185
             S+E +  +L  + +DK  IS E  D +D+   +  + + E LE  +  +T  +
Sbjct:   111 SVEKL--NLNAAEEDKYAISPEVEDPMDQS--DDYDKKSEALEPNSPVKTSGD 159

 Score = 35 (12.3 bits), Expect = 3.3, Sum P(2) = 0.96
 Identities = 4/8 (50%), Positives = 7/8 (87%), Frame = +1

Query:     7 NRRPWDIL 30
             N+ PWD++
Sbjct:    32 NQSPWDVI 39


>sp|P53935|YNJ1_YEAST HYPOTHETICAL 141.5 KD PROTEIN IN YPT53-RHO2 INTERGENIC
            REGION >pir||S52734 hypothetical protein YNL091w - yeast
            (Saccharomyces cerevisiae) >gi|758297 (X85811) ORF N2231
            [Saccharomyces cerevisiae] >gnl|PID|e239790 (Z71367) ORF YNL091w
            [Saccharomyces cerevisiae]
            Length = 1240

  Plus Strand HSPs:

 Score = 44 (15.5 bits), Expect = 3.4, Sum P(3) = 0.97
 Identities = 11/40 (27%), Positives = 23/40 (57%), Frame = +1

Query:   112 RRXXXQKKQKKKXLKKKMXXKQXQKXVKMXKXXK*XKXEE 231
             +R   +K++KK+  KK+   K+ ++  ++ K  +  K EE
Sbjct:   635 KRKKREKEEKKQ--KKREKEKEKKRLQQLAKEEEKRKREE 672

 Score = 35 (12.3 bits), Expect = 3.4, Sum P(3) = 0.97
 Identities = 7/19 (36%), Positives = 10/19 (52%), Frame = +3

Query:    18 MGHSLENMLSHLYVSXKDK 74
             M   +E + + LY   KDK
Sbjct:   147 MDQEMERIYNTLYAMDKDK 165

 Score = 33 (11.6 bits), Expect = 3.4, Sum P(3) = 0.97
 Identities = 6/13 (46%), Positives = 9/13 (69%), Frame = +1

Query:    67 RIRXXYLRKXMMY 105
             +I   Y++K MMY
Sbjct:   287 KIAEEYVQKMMMY 299


>gi|2258370 (AF007261) haem lyase [Reclinomonas americana]
            Length = 637

  Minus Strand HSPs:

 Score = 49 (17.2 bits), Expect = 3.4, Sum P(2) = 0.97
 Identities = 11/31 (35%), Positives = 17/31 (54%), Frame = -2

Query:   146 FFFCFFXLXXLLI*YIXIFLRYXXLILXRNI 54
             F FCF  L  L + +I + L+Y   I  ++I
Sbjct:   313 FIFCF--LFFLFLIFIYLILKYNKYIFSKDI 341

 Score = 39 (13.7 bits), Expect = 3.4, Sum P(2) = 0.97
 Identities = 11/31 (35%), Positives = 16/31 (51%), Frame = -1

Query:   231 FFRFLLLL--LLXHLHXFLXLFXXHFFLQXL 145
             FFR  +L+  L+     F  LF  + FLQ +
Sbjct:   120 FFRSTILIQSLINLFFLFFILFTSNPFLQII 150

 Score = 38 (13.4 bits), Expect = 4.3, Sum P(2) = 0.99
 Identities = 12/31 (38%), Positives = 14/31 (45%), Frame = -2

Query:   230 SSXFXYFXXFXIFTYF*XCFXXIFFFKXFFF 138
             SS F +F    I   F      I FFK FF+
Sbjct:     2 SSFFGHF--LIIIAIF---LLIIIFFKSFFY 27


>pir||S51959 hypothetical protein YAL063 - yeast (Saccharomyces cerevisiae)
            Length = 1367

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 3.4, P = 0.97
 Identities = 19/59 (32%), Positives = 32/59 (54%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNI 38
             +S  +S+S +S+   SS   + SS+S SS S   S++++  S  I S S   TY   ++
Sbjct:   979 SSTTTSASILSESSKSSVIPTSSSTSGSSESETGSASSASSSSSISSESPKSTYSSSSL 1037


>gi|2340062 (L49466) troponin T fast skeletal muscle isoform [Mus musculus]
            Length = 268

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 3.4, P = 0.97
 Identities = 14/50 (28%), Positives = 26/50 (52%), Frame = +3

Query:    81 ISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXGR 230
             +S E  + ++E+  E EE +EE ++E+   +  +   E+ E  E  E  R
Sbjct:     1 MSDEETEQVEEQYEEEEEAQEEEVQEEEEVQEDAVAEEEREEDEEEEKPR 50


>pir||A31512 parathymosin - bovine (fragments)
            Length = 90

  Plus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 3.5, P = 0.97
 Identities = 15/48 (31%), Positives = 22/48 (45%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSE-IXEDXEXXEVXEXG 227
             KE  + ++EK    E  +E   EE+N  E   E   ED E  +  + G
Sbjct:    17 KEKKEKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGEEEDDGDDG 64


>gi|1181469 (U42580) A306L [Paramecium bursaria Chlorella virus 1]
            Length = 86

  Plus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 3.5, P = 0.97
 Identities = 14/43 (32%), Positives = 20/43 (46%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEV 215
             K+N D+  +K  E    EEE +EE    E   E+  D    E+
Sbjct:     2 KQNKDIKKQKEEEYTYEEEEEIEEYPLHEDDPEVWFDYMSEEL 44


>gi|1052834 (M93360) ORF UL119 [Macaca mulatta cytomegalovirus]
            Length = 238

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 3.7, P = 0.98
 Identities = 20/48 (41%), Positives = 26/48 (54%), Frame = -3

Query:   226 PXS-XTSXXSSSSXISDXVSSSFFSSXSSSSVSSXS-SXFSSNTSXFS 89
             P S  TS  SSS+  S   SSS  +S +S +V+S S S   S+T   S
Sbjct:    48 PTSVTTSVASSSATASSVTSSSAAASTTSGTVTSTSKSSTDSSTQTTS 95


>pir||C30010 hypothetical ORF-6 protein - Sauroleishmania tarentolae
            mitochondrion (SGC6)
            Length = 245

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 3.9, P = 0.98
 Identities = 18/45 (40%), Positives = 22/45 (48%), Frame = -2

Query:   221 FXYFXXFXIFTY----F*XCFXXIFFFKXFFFC--FFXLXXLLI*Y 102
             F YF  F IF +    F  CF   FF K F F   FF +  +L+ Y
Sbjct:   176 FLYFDVFFIFVFLLILFIICFFG-FFLKDFLFLNIFFDMFSVLLIY 220


>sp|P53335|YG5W_YEAST HYPOTHETICAL 31.3 KD PROTEIN IN TAF145-YOR1 INTERGENIC
            REGION >pir||S64615 hypothetical protein YGR280c - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e243251 (Z73065) ORF YGR280c
            [Saccharomyces cerevisiae]
            Length = 271

  Plus Strand HSPs:

 Score = 48 (16.9 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 12/34 (35%), Positives = 16/34 (47%), Frame = +1

Query:   112 RRXXXQKKQKKKXLKKKMXXKQXQKXVKMXKXXK 213
             ++    KK KKK  K K   K+ +K  K  K  K
Sbjct:   178 KKHKKHKKDKKKDKKDKKEHKKHKKEEKRLKKEK 211

 Score = 31 (10.9 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 10/21 (47%), Positives = 11/21 (52%), Frame = +3

Query:    18 MGHSLENM---LSHLYVSXKD 71
             MG  L  M    SH+ VS KD
Sbjct:    42 MGLGLSPMNSNTSHIKVSIKD 62


>gi|1082159 (Z68121) T24D3.1 [Caenorhabditis elegans]
            Length = 211

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 3.9, P = 0.98
 Identities = 22/64 (34%), Positives = 32/64 (50%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSS-SVSSXSSXFSSNT-SXFSLDIXSLSFXETYKCDNI 38
             S  + S   S   + + FS+ S+S S S+ SS   SN+ +  S    + S  ET +  NI
Sbjct:    69 SSTTGSPNSSHFTTFTHFSTPSTSPSTSTQSSTTPSNSDNKKSFQCSNCSVTETIRWRNI 128

Query:    37 FSKE 26
              SKE
Sbjct:   129 RSKE 132


>gi|520471 (U08853) transcription factor LCR-F1 [Homo sapiens]
           Length = 447

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 4.2, P = 0.98
 Identities = 20/37 (54%), Positives = 21/37 (56%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             SS   S   SS   SS SSSS SS SS  SS +S FS
Sbjct:   158 SSHSPSSLSSSEGSSSSSSSSSSSSSSASSSASSSFS 194

 Score = 62 (21.8 bits), Expect = 8.7, P = 1.0
 Identities = 20/38 (52%), Positives = 21/38 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS 107
             S  S  S SS  S   SSS  SS SSSS S+ SS  SS
Sbjct:   155 SLDSSHSPSSLSSSEGSSSSSSSSSSSSSSASSSASSS 192


>gi|507164 (U04818) PITSLRE alpha 2-4 [Homo sapiens]
           Length = 562

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 4.3, P = 0.99
 Identities = 19/60 (31%), Positives = 27/60 (45%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+      SE  E+ E  E
Sbjct:    44 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 103

 Score = 65 (22.9 bits), Expect = 5.5, P = 1.0
 Identities = 21/64 (32%), Positives = 30/64 (46%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+    + SE  E+ E  E
Sbjct:    44 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEG---STSEESEEEEEEE 100

Query:   213 VXEXG 227
               E G
Sbjct:   101 EEETG 105


>sp|P36076|YKI8_YEAST HYPOTHETICAL 65.2 KD PROTEIN IN MIF2-CYT2 INTERGENIC
            REGION >pir||S37913 hypothetical protein YKL088w - yeast
            (Saccharomyces cerevisiae) >gi|486131 (Z28088) ORF YKL088w
            [Saccharomyces cerevisiae]
            Length = 571

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 4.4, P = 0.99
 Identities = 17/52 (32%), Positives = 25/52 (48%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             K++    +E  D  D+   + EE EE+  EE+   ET S+   D E  E  E
Sbjct:   514 KEQEQEEQEGADNEDDDDEDDEEDEEDEEEEEALNETASDESNDEEDEEDEE 565


>gi|1522691 (U63111) dentin phosphoprotein precursor [Rattus norvegicus]
            Length = 267

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 4.4, P = 0.99
 Identities = 21/44 (47%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  S SS  S+   SS  S  S SS SS SS  SSN+S  S
Sbjct:   133 SDSSDSSDSSDTSETSDSSDSSDTSDSSDSSDSSD-SSNSSDTS 175


>gi|2062611 (U85970) middle molecular weight neurofilament protein NF-M(2)
            [Xenopus laevis]
            Length = 913

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 4.4, Sum P(2) = 0.99
 Identities = 18/52 (34%), Positives = 22/52 (42%), Frame = +3

Query:    66 KDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +DK    KE     +E     EET EE   E+   ET +E     E  EV E
Sbjct:   633 EDKGEEEKEGEAEAEEAEGGEEETTEEAQAEEVVEETMTETKIVREKAEVQE 684

 Score = 54 (19.0 bits), Expect = 8.8, Sum P(2) = 1.0
 Identities = 16/46 (34%), Positives = 19/46 (41%), Frame = +3

Query:    90 ENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             E  DV  E+  E EE EE+   E+   E   E  E  E     E G
Sbjct:   559 EEEDVKAEEEEEKEEGEEDAEVEETKAEEGEEEGEKGEDEAEKEEG 604

 Score = 33 (11.6 bits), Expect = 4.4, Sum P(2) = 0.99
 Identities = 6/8 (75%), Positives = 7/8 (87%), Frame = +3

Query:    21 GHSLENML 44
             GHS +NML
Sbjct:   264 GHSSQNML 271


>gnl|PID|e276496 (Z81312) unknown [Schizosaccharomyces pombe]
            Length = 385

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 4.4, P = 0.99
 Identities = 23/74 (31%), Positives = 33/74 (44%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDX-VSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             +P S  +  +SSS   +  VSSS  S+ SS+ VS+  S  S  T  F     +     T 
Sbjct:   107 IPSSSQTISASSSTTDNVIVSSSISSTVSSTPVSTIYSGTSGTT--FVSSSTTYQVIPTQ 164

Query:    52 KCDNIFSKECPMVAY 8
              CD +   E  +  Y
Sbjct:   165 ICDGVRGLEYAVYNY 179

 Score = 61 (21.5 bits), Expect = 9.3, P = 1.0
 Identities = 18/60 (30%), Positives = 32/60 (53%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETY 53
             + P + +S  S+   IS   SS+  ++    S+SS SS  SS  S  S+ I ++S  +++
Sbjct:    48 ITPETPSSSSSTFVPISTHTSSATNTTSGQLSISSSSST-SSEYSSSSIPITTVSSSDSF 106


>pir||S59310 probable membrane protein YMR317w - yeast (Saccharomyces
            cerevisiae)
            Length = 1104

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 4.4, P = 0.99
 Identities = 22/67 (32%), Positives = 29/67 (43%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S  +  S+SS +S    SS  SS SS + SS SS  SS  S     + S          +
Sbjct:   345 SSEAPSSTSSSVSSEAPSSTSSSVSSEAPSSTSSSVSSEISSTKSSVMSSEVSSA--TSS 402

Query:    40 IFSKECP 20
             + S E P
Sbjct:   403 LVSSEAP 409


>pir||S63665 titin protein - human (fragment)
            Length = 97

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 4.4, P = 0.99
 Identities = 18/51 (35%), Positives = 24/51 (47%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXE 59
             S  S S  +S     + FSS SSSS SS +    ++ S  S+     SF E
Sbjct:    22 SFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVE 72


>pir||I51116 NF-180 - sea lamprey >gi|632549 (U19361) NF-180 [Petromyzon
            marinus]
            Length = 1110

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 4.4, P = 0.99
 Identities = 14/45 (31%), Positives = 22/45 (48%), Frame = +3

Query:    87 KENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +E  +   E+  E EE EEE +E+    E  +E+ E+    E  E
Sbjct:   560 EEEAEAEGEEAEEAEEVEEEAIEKAEAAEAKAEVEEEEAEAEEEE 604

 Score = 69 (24.3 bits), Expect = 4.4, P = 0.99
 Identities = 16/51 (31%), Positives = 25/51 (49%), Frame = +3

Query:    69 DKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             +K   ++   +V +E+    EE EEE  EE+   ET  E+  + E  E  E
Sbjct:   582 EKAEAAEAKAEVEEEEAEAEEEEEEEAEEEEVEAETKEEVEAEAEVEEEGE 632

 Score = 67 (23.6 bits), Expect = 7.3, P = 1.0
 Identities = 15/47 (31%), Positives = 21/47 (44%), Frame = +3

Query:    81 ISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             + KE  +  + +  E EETE E  EE+   E   E   + E  E  E
Sbjct:   528 VEKEEAEEAEVEEAEAEETEAEAAEEEEEAEGEEEAEAEGEEAEEAE 574

 Score = 66 (23.2 bits), Expect = 9.3, P = 1.0
 Identities = 15/47 (31%), Positives = 23/47 (48%), Frame = +3

Query:    72 KXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             K  + +E  +  +E+  E EE E E  E K   E  +E+ E+ E  E
Sbjct:   590 KAEVEEEEAEAEEEEEEEAEEEEVEA-ETKEEVEAEAEVEEEGEAAE 635


>sp|Q04893|YM96_YEAST HYPOTHETICAL 113.1 KD PROTEIN IN PRE5-FET4 INTERGENIC
            REGION >gi|1072409 (Z54141) unknown [Saccharomyces cerevisiae]
            Length = 1140

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 4.6, P = 0.99
 Identities = 22/67 (32%), Positives = 29/67 (43%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S  +  S+SS +S    SS  SS SS + SS SS  SS  S     + S          +
Sbjct:   381 SSEAPSSTSSSVSSEAPSSTSSSVSSEAPSSTSSSVSSEISSTKSSVMSSEVSSA--TSS 438

Query:    40 IFSKECP 20
             + S E P
Sbjct:   439 LVSSEAP 445


>bbs|178390 (S82450) vitellogenin=phosphoglycolipoprotein/phosvitin precursor
            [Oncorhynchus mykiss=rainbow trout, estrogen-treated female, liver,
            Peptide Partial, 407 aa] [Oncorhynchus mykiss]
            Length = 407

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 4.7, P = 0.99
 Identities = 20/45 (44%), Positives = 23/45 (51%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             LLP       +SSS  S   SSS  SS  S S  S SS  SS++S
Sbjct:   189 LLPDLKNGTRASSSSSSSSSSSSRSSSSRSRSRKSESSSSSSSSS 233


>sp|Q99457|NPL3_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 3 >gnl|PID|d1009538
            (D50370) nucleosome assembly protein [Homo sapiens]
            Length = 506

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 4.8, P = 0.99
 Identities = 18/38 (47%), Positives = 22/38 (57%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             +   SSSS  SD  SSS  S  SS S SS SS  S+++
Sbjct:    33 SDSSSSSSSTSDSSSSSSTSGSSSGSGSSSSSSGSTSS 70

 Score = 63 (22.2 bits), Expect = 7.9, P = 1.0
 Identities = 18/36 (50%), Positives = 19/36 (52%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXF 113
             S TS  SSSS  S   S S  SS SS S SS S  +
Sbjct:    40 SSTSDSSSSSSTSGSSSGSGSSSSSSGSTSSRSRLY 75


>pir||S66852 hypothetical protein YOL155c - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e251930 (Z74897) ORF YOL155c [Saccharomyces cerevisiae]
            Length = 967

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 4.9, P = 0.99
 Identities = 17/44 (38%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S T   SSS+ +S  ++ S  SS  SSS++S  S  S ++S  S
Sbjct:    66 SLTELTSSSTEVSSSIAPSTSSSEVSSSITSSGSSVSGSSSITS 109

 Score = 67 (23.6 bits), Expect = 6.2, P = 1.0
 Identities = 16/41 (39%), Positives = 25/41 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  +  +SSS +S  ++SS  S   SSS++S  S  SS++S
Sbjct:    79 SSIAPSTSSSEVSSSITSSGSSVSGSSSITSSGSSVSSSSS 119


>sp|P00164|CYB_TRYBB CYTOCHROME B >pir||CBUTB ubiquinol--cytochrome-c reductase
            (EC 1.10.2.2) cytochrome b - Trypanosoma brucei mitochondrion
            (SGC6) >gi|578828 (X00017) apocytochrome b [Trypanosoma
            (Trypanozoon) brucei]
            Length = 363

  Minus Strand HSPs:

 Score = 48 (16.9 bits), Expect = 5.0, Sum P(2) = 0.99
 Identities = 15/43 (34%), Positives = 18/43 (41%), Frame = -2

Query:   194 FTYF*XCFXXIFFFKXFFFCFFXLXXLLI*YIXIFLRYXXLIL 66
             F  F   F   F  +    CF  L  LL+ YI IF     +IL
Sbjct:    57 FVLFLWDFDLGFVIRSVHICFTSLLYLLL-YIHIFKSITLIIL 98

 Score = 33 (11.6 bits), Expect = 5.0, Sum P(2) = 0.99
 Identities = 4/7 (57%), Positives = 6/7 (85%), Frame = -3

Query:    25 CPMVAYW 5
             C M++YW
Sbjct:   128 CTMMSYW 134


>gnl|PID|e263523 (Z79639) F54E4.3 [Caenorhabditis elegans]
            Length = 292

  Plus Strand HSPs:

 Score = 43 (15.1 bits), Expect = 5.0, Sum P(2) = 0.99
 Identities = 8/20 (40%), Positives = 13/20 (65%), Frame = +2

Query:    14 DHGTFFRKY-VITFICFXKG 70
             D G+F R Y ++T+ C  +G
Sbjct:   105 DSGSFLRSYYLLTYSCSVEG 124

 Score = 36 (12.7 bits), Expect = 5.0, Sum P(2) = 0.99
 Identities = 6/18 (33%), Positives = 12/18 (66%), Frame = +3

Query:    99 DVLDEKXXEXEETEEEXL 152
             D  DE+  E +++E++ L
Sbjct:   215 DAQDEENLEQQQSEQDAL 232


>gnl|PID|d1014444 (D89044) serine repeat antigen [Plasmodium falciparum]
            Length = 246

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 5.0, P = 0.99
 Identities = 18/49 (36%), Positives = 26/49 (53%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             LP + T+    SS  +    +   S  SSSS SS SS  SS++S  S++
Sbjct:   161 LPSNGTTSEQGSSTGTVRGDTEPISDSSSSSSSSSSSSSSSSSSSSSVN 209


>gi|1177622 (X89715) AOF1001 gene product [Saccharomyces cerevisiae]
            Length = 1001

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 5.1, P = 0.99
 Identities = 17/44 (38%), Positives = 25/44 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S T   SSS+ +S  ++ S  SS  SSS++S  S  S ++S  S
Sbjct:    66 SLTELTSSSTEVSSSIAPSTSSSEVSSSITSSGSSVSGSSSITS 109

 Score = 67 (23.6 bits), Expect = 6.5, P = 1.0
 Identities = 16/41 (39%), Positives = 25/41 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S  +  +SSS +S  ++SS  S   SSS++S  S  SS++S
Sbjct:    79 SSIAPSTSSSEVSSSITSSGSSVSGSSSITSSGSSVSSSSS 119


>gnl|PID|d1012134 (D79215) fibroblast growth factor [Rattus norvegicus]
            Length = 215

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.2, P = 0.99
 Identities = 16/28 (57%), Positives = 18/28 (64%), Frame = -3

Query:   181 DXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             D VS    +S SSSS SS SS FSS +S
Sbjct:    42 DMVSPEATNSSSSSSSSSSSSSFSSPSS 69


>sp|P26632|EGR1_BRARE EARLY GROWTH RESPONSE PROTEIN 1 (EGR-1) (KROX24)
            >pir||I50114 egr1 - zebra fish >gi|531456 (U12895) egr1 [Danio
            rerio] >prf||2022191A Zn finger protein [Danio rerio]
            Length = 511

  Minus Strand HSPs:

 Score = 51 (18.0 bits), Expect = 5.3, Sum P(2) = 0.99
 Identities = 12/33 (36%), Positives = 18/33 (54%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVS 131
             +P S +     SS  +  + SS  SS SS+S+S
Sbjct:   135 IPSSTSQATHPSSSSTSSIPSSSSSSTSSASLS 167

 Score = 33 (11.6 bits), Expect = 5.3, Sum P(2) = 0.99
 Identities = 10/23 (43%), Positives = 12/23 (52%), Frame = -3

Query:   142 SSVSSXSSXFSSNTSXFSLDIXS 74
             SSVS+ S   SS  S +   I S
Sbjct:   409 SSVSNISISASSPVSSYPSPITS 431


>sp|P46335|YXBE_BACSU HYPOTHETICAL 23.1 KD PROTEIN IN HTPG-IOLR INTERGENIC
            REGION >gnl|PID|d1022456 (AB005554) yxcE [Bacillus subtilis]
            Length = 216

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.3, P = 0.99
 Identities = 19/47 (40%), Positives = 23/47 (48%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDI 80
             S  S  SSSS  S    SS  SS SS S SS     +S+ S  S+ +
Sbjct:    36 SSYSSRSSSSSYSGSYKSSPKSSYSSGSSSSSKKSKTSDDSSSSISL 82

 Score = 59 (20.8 bits), Expect = 6.8, P = 1.0
 Identities = 24/65 (36%), Positives = 30/65 (46%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S  S  SSSS  S    SS  SS SS S SS     +S+ S  S+   SL    + K  +
Sbjct:    36 SSYSSRSSSSSYSGSYKSSPKSSYSSGSSSSSKKSKTSDDSSSSI---SLKKKPSEKASS 92

Query:    40 IFSKE 26
               SK+
Sbjct:    93 SSSKK 97

 Score = 58 (20.4 bits), Expect = 8.8, P = 1.0
 Identities = 18/37 (48%), Positives = 21/37 (56%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S  SSSS  S   SSS+  S  SS  SS SS  SS++
Sbjct:    31 SGRSSSSYSSRSSSSSYSGSYKSSPKSSYSSGSSSSS 67

 Score = 58 (20.4 bits), Expect = 8.8, P = 1.0
 Identities = 20/49 (40%), Positives = 24/49 (48%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSS-SFFSSXSSSSVSSXSSXFSSNTSXFS 89
             LLP + +   S S   S   SS S  SS S S  SS  S +SS +S  S
Sbjct:    19 LLPSTISHAKSFSGRSSSSYSSRSSSSSYSGSYKSSPKSSYSSGSSSSS 67


>gi|4814 (X66245) YJU1 gene product [Saccharomyces cerevisiae]
         Length = 216

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.3, P = 0.99
 Identities = 19/62 (30%), Positives = 32/62 (51%), Frame = -3

Query:   184 SDXVSSSFFSSXSSSSVS-SXSSXFSSNTSXFSLDIXSLSFXETYKCDNIFSKECPMVAY 8
             S  V++ F  S SSSS S S SS  +S+++  S  I S+    T +  ++ S    +++ 
Sbjct:   117 SGSVAADFSPSDSSSSSSASASSASASSSTKHSSSIESVETSTTVETSSVSSPTASVISQ 176

Query:     7 WT 2
              T
Sbjct:   177 IT 178


>pir||JC4525 nucleic acid-binding protein E5.1 - human >gi|598231 (L37368)
            RNA-binding protein [Homo sapiens]
            Length = 305

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 5.3, P = 1.0
 Identities = 19/41 (46%), Positives = 21/41 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S TS  SSS   S   SS   SS +S S SS SS  S + S
Sbjct:    87 SSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPS 127

 Score = 62 (21.8 bits), Expect = 5.3, P = 1.0
 Identities = 19/44 (43%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S +S  SSS   +   SSS  SS S+SS S  SS   S++S  S
Sbjct:    77 SRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSS 120

 Score = 61 (21.5 bits), Expect = 6.8, P = 1.0
 Identities = 19/44 (43%), Positives = 24/44 (54%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S ++   SSS  S   S+S  SS  SSS S+ S   SS+TS  S
Sbjct:    72 SSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSS 115


>sp|P13816|GARP_PLAFF GLUTAMIC ACID-RICH PROTEIN PRECURSOR >pir||A54514
            glutamic acid-rich protein precursor - Plasmodium falciparum
            >gi|160299 (J03998) glutamic acid-rich protein [Plasmodium
            falciparum]
            Length = 678

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 5.3, P = 1.0
 Identities = 17/51 (33%), Positives = 23/51 (45%), Frame = +3

Query:    69 DKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             DK    KE    + E+  E +E EEE  E++   E   E  E+ E  E  E
Sbjct:   546 DKEEDKKEESKEVQEESKEVQEDEEEVEEDEEEEEEEEEEEEEEEEEEEEE 596

 Score = 65 (22.9 bits), Expect = 6.8, P = 1.0
 Identities = 17/53 (32%), Positives = 27/53 (50%), Frame = +3

Query:    66 KDKXXISKENXDVL-DEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXE 221
             ++   + +E+ +V  DE+  E +E EEE  EE+   E   E  E+ E  E  E
Sbjct:   553 EESKEVQEESKEVQEDEEEVEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 605


>gnl|PID|d1020704 (AB003521) flocculin [Saccharomyces cerevisiae]
            Length = 849

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 5.4, P = 1.0
 Identities = 19/59 (32%), Positives = 30/59 (50%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNI 38
             +S  +S+S   +   SS   + SS+S SS S   S+++S  S  I S S   TY   ++
Sbjct:   270 SSTTTSTSIFFESSKSSVIPTSSSTSGSSESKTSSASSSSSSSSISSESPKSTYSSSSL 328

 Score = 65 (22.9 bits), Expect = 8.8, P = 1.0
 Identities = 20/55 (36%), Positives = 27/55 (49%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK 50
             TS   SSS  S  V+SS  SS  +SS+ + S   SS+    S    +  F E+ K
Sbjct:   230 TSSVISSSVTSSLVTSSVISSSVTSSLFTSSPVISSSVISSSTTTSTSIFFESSK 284


>gnl|PID|d1014445 (D89045) serine repeat antigen [Plasmodium falciparum]
            Length = 221

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.5, P = 1.0
 Identities = 18/49 (36%), Positives = 26/49 (53%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             LP + T+    SS  +    +   S  SSSS SS SS  SS++S  S++
Sbjct:   161 LPSNGTTGEQGSSTGTVRGDTEPISDSSSSSSSSSSSSSSSSSSSSSVN 209


>gnl|PID|d1014447 (D89047) serine repeat antigen [Plasmodium falciparum]
            Length = 221

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.5, P = 1.0
 Identities = 18/49 (36%), Positives = 26/49 (53%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLD 83
             LP + T+    SS  +    +   S  SSSS SS SS  SS++S  S++
Sbjct:   161 LPSNGTTGEQGSSTGTVRGDTEPISDSSSSSSSSSSSSSSSSSSSSSVN 209


>gi|2605632 (D89996) NTAK alpha2 [Rattus rattus]
            Length = 860

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 5.5, P = 1.0
 Identities = 24/70 (34%), Positives = 29/70 (41%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK 50
             LP        SS   SD  SSS  ++ SSS+ S  SS  SS +S  S    S S      
Sbjct:     9 LPPPLEKARCSSYSYSDSSSSSSSNNSSSSTSSRSSSRSSSRSSRGSTTTTSSSENSGSN 68

Query:    49 CDNIFSKECP 20
               +IF    P
Sbjct:    69 SGSIFRPAAP 78


>gi|2605630 (D89995) NTAK alpha1 [Rattus rattus]
            Length = 868

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 5.5, P = 1.0
 Identities = 24/70 (34%), Positives = 29/70 (41%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYK 50
             LP        SS   SD  SSS  ++ SSS+ S  SS  SS +S  S    S S      
Sbjct:     9 LPPPLEKARCSSYSYSDSSSSSSSNNSSSSTSSRSSSRSSSRSSRGSTTTTSSSENSGSN 68

Query:    49 CDNIFSKECP 20
               +IF    P
Sbjct:    69 SGSIFRPAAP 78


>sp|P44139|YC53_HAEIN HYPOTHETICAL PROTEIN HI1253 >pir||D64023 hypothetical
            protein HI1253 - Haemophilus influenzae (strain Rd KW20)
            >gi|1574185 (U32805) H. influenzae predicted coding region HI1253
            [Haemophilus influenzae]
            Length = 127

  Minus Strand HSPs:

 Score = 44 (15.5 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 8/16 (50%), Positives = 11/16 (68%), Frame = -1

Query:   231 FFRFLLLLLLXHLHXF 184
             F  FL +++L HLH F
Sbjct:     7 FLTFLGVIMLVHLHIF 22

 Score = 30 (10.6 bits), Expect = 5.5, Sum P(2) = 1.0
 Identities = 6/12 (50%), Positives = 7/12 (58%), Frame = -2

Query:   143 FFCFFXLXXLLI 108
             FF F  L  L+I
Sbjct:    22 FFAFLSLALLVI 33


>gi|2081630 (U20661) unknown [Dictyostelium discoideum]
            Length = 877

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 5.6, P = 1.0
 Identities = 22/47 (46%), Positives = 24/47 (51%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDI 80
             S +S  SSSS  S   SSS  SS S SS SS S     N S  S D+
Sbjct:   181 SQSSYESSSSSESSSESSSSESSSSESSSSSESQSSEINYSSNSNDL 227


>sp|P47033|YJH8_YEAST HYPOTHETICAL 89.2 KD PROTEIN IN SCP160-MRPL8 INTERGENIC
            REGION >pir||S56032 probable membrane protein YJL078c - yeast
            (Saccharomyces cerevisiae) >gi|895900 (X88851) hypothetical protein
            [Saccharomyces cerevisiae] >gi|929878 (X83502) pid:e131267
            [Saccharomyces cerevisiae] >gi|1008238 (Z49353) ORF YJL078c
            [Saccharomyces cerevisiae]
            Length = 881

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 5.6, P = 1.0
 Identities = 22/62 (35%), Positives = 32/62 (51%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSS-XSSXFSSNT----SXFSLDIXSLSFX 62
             P S ++  SSS+   +  SSS   S SSS VS+  SS  +++T    S  S  + S+ F 
Sbjct:   300 PASSSAAASSSASTENAASSSSAISSSSSMVSAPLSSTLTTSTASSRSVTSNSVNSVKFA 359

Query:    61 ET 56
              T
Sbjct:   360 NT 361


>sp|Q01565|GSQD_ERWCH GENERAL SECRETION PATHWAY PROTEIN D PRECURSOR (PECTIC
            ENZYMES SECRETION PROTEIN OUTD) >pir||S28014 outD protein - Erwinia
            chrysanthemi >gi|581156 (X65265) outD gene product [Erwinia
            chrysanthemi]
            Length = 710

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 5.6, P = 1.0
 Identities = 19/43 (44%), Positives = 22/43 (51%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             P S +S  S+SS  S   SS   SS SSSS     S F S +S
Sbjct:   308 PRSGSSSNSNSSSGSSGSSSGSSSSSSSSSSMGFGSAFGSTSS 350


>gnl|PID|e250310 (Z75553) ZC443.4 [Caenorhabditis elegans]
            Length = 389

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 5.7, P = 1.0
 Identities = 14/60 (23%), Positives = 28/60 (46%), Frame = +3

Query:    18 MGHSLENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXED 197
             + + L  ++  L  + KD     KE+ +  D+   + EE EE   +++N  +   +  ED
Sbjct:   248 VANKLNEVVEKLISTAKDSGKSQKEDEEEEDDDDDDDEEEEENVEDDENLEDDEDDRTED 307


>pir||S51910 cryptogene protein G4 - Sauroleishmania tarentolae (strain LEM125)
            Length = 169

  Minus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 5.8, P = 1.0
 Identities = 15/51 (29%), Positives = 25/51 (49%), Frame = -2

Query:   215 YFXXFXIFTYF*XCFXXIFFFKXFFFCFFXL--XXLLI*YIXIFLRYXXLIL 66
             +F    +F +F  C   IF+F+  F  FF      L + +I  F+ +  LI+
Sbjct:    91 WFVFGFLFFFFYVCVL-IFYFEFLFMLFFVFCGFLLFVMFILFFISFFVLIV 141

 Score = 56 (19.7 bits), Expect = 9.7, P = 1.0
 Identities = 15/37 (40%), Positives = 21/37 (56%), Frame = -2

Query:   203 FXIFTYF*XCFXXIFFFKXFFFCFFXLXXLLI*YIXI 93
             F  F Y+  C   IF+F  FFFC F L  +++ +I I
Sbjct:    10 FGFFMYYFVCC--IFYF-CFFFCLFDLC-VMVYFIYI 42


>gnl|PID|e288614 (Z83122) R11A5.1 [Caenorhabditis elegans]
            Length = 906

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 5.8, P = 1.0
 Identities = 17/56 (30%), Positives = 25/56 (44%), Frame = +3

Query:    45 SHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             + L +   D+     +  +  DE   E +E EE+  EE+N  E   E  ED E  E
Sbjct:   575 NELKLDDSDEEEDDDDEDEEEDEDEEEEDEDEEDEEEEENESEEEEEDDEDEESEE 630

 Score = 67 (23.6 bits), Expect = 5.8, P = 1.0
 Identities = 21/69 (30%), Positives = 30/69 (43%), Frame = +3

Query:    15 TMGHSLENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXE 194
             T   SL    +H     K      +E+ D  DE+  E EE E+E  E++   E  SE  E
Sbjct:   561 TSSDSLLRKEAHAPNELKLDDSDEEEDDDDEDEEEDEDEEEEDEDEEDEEEEENESEEEE 620

Query:   195 DXEXXEVXE 221
             + +  E  E
Sbjct:   621 EDDEDEESE 629


>gi|343544 (M33228) ATPase 6 [Trypanosoma brucei]
           Length = 231

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.9, P = 1.0
 Identities = 17/56 (30%), Positives = 24/56 (42%), Frame = -2

Query:   221 FXYFXXFXIFTYF*XCFXXIFFFKXFFFCFFXLXXLLI*YIXIFLRYXXLILXRNI 54
             F YF  F  F Y   C+  I F   F FCF  L  + +  + +F     L +  N+
Sbjct:   164 FFYFI-FVFFFYGVFCYWFILFI--FVFCFCLLFYVFLYLLDLFAAILQLFIFCNM 216


>pir||S62361 squamosa-promoter binding protein 2 - garden snapdragon
            >gnl|PID|e205914 (X92079) squamosa-promoter binding protein 2
            [Antirrhinum majus]
            Length = 171

  Plus Strand HSPs:

 Score = 58 (20.4 bits), Expect = 5.9, P = 1.0
 Identities = 18/53 (33%), Positives = 29/53 (54%), Frame = +3

Query:    18 MGHSLENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEE-EXLEEKNXXET 176
             M  +++NM+S  Y+  K K  +  E  D  +E+  E EE EE E + + N  E+
Sbjct:     1 MDPNMQNMMSS-YL--KIKKLVGDEGSDFEEEEEGEDEEEEEQERVVKVNFAES 51


>gi|1492089 (U60315) MC146R [Molluscum contagiosum virus subtype 1]
            Length = 406

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 6.0, P = 1.0
 Identities = 20/48 (41%), Positives = 26/48 (54%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             S   +SS +S  VSSS  SS S S+ +   S  SS++S  S D  S S
Sbjct:   125 SASGASSSVSSSVSSSVSSSLSGSARAGFCSSASSSSS--SADSNSAS 170


>gi|507162 (U04817) PITSLRE alpha 2-3 [Homo sapiens]
           Length = 768

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.2, P = 1.0
 Identities = 19/60 (31%), Positives = 27/60 (45%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+      SE  E+ E  E
Sbjct:   250 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 309

 Score = 65 (22.9 bits), Expect = 7.9, P = 1.0
 Identities = 21/64 (32%), Positives = 30/64 (46%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+    + SE  E+ E  E
Sbjct:   250 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEG---STSEESEEEEEEE 306

Query:   213 VXEXG 227
               E G
Sbjct:   307 EEETG 311


>gi|507429 (U07705) PITSLRE isoform PBETA22 [Homo sapiens]
           Length = 775

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.2, P = 1.0
 Identities = 19/60 (31%), Positives = 27/60 (45%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+      SE  E+ E  E
Sbjct:   257 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 316

 Score = 65 (22.9 bits), Expect = 8.0, P = 1.0
 Identities = 21/64 (32%), Positives = 30/64 (46%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+    + SE  E+ E  E
Sbjct:   257 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEG---STSEESEEEEEEE 313

Query:   213 VXEXG 227
               E G
Sbjct:   314 EEETG 318


>pir||A55237 transcription factor E2F-4 - human >bbs|160059 (S75174)
            E2F-4=transcription factor [human, Nalm6 and HeLa cells, Peptide,
            416 aa] [Homo sapiens]
            Length = 416

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 6.2, P = 1.0
 Identities = 22/46 (47%), Positives = 24/46 (52%), Frame = -3

Query:   157 SSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNIFSKECP 20
             SS SSSS SS SS  +SN+S  S    S SF E  K D     E P
Sbjct:   308 SSSSSSSSSSSSSSSNSNSSSSSGPNPSTSF-EPIKADPTGVLELP 352


>gi|507160 (U04816) PITSLRE alpha 2-2 [Homo sapiens]
           Length = 777

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.2, P = 1.0
 Identities = 19/60 (31%), Positives = 27/60 (45%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+      SE  E+ E  E
Sbjct:   259 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 318

 Score = 65 (22.9 bits), Expect = 8.0, P = 1.0
 Identities = 21/64 (32%), Positives = 30/64 (46%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+    + SE  E+ E  E
Sbjct:   259 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEG---STSEESEEEEEEE 315

Query:   213 VXEXG 227
               E G
Sbjct:   316 EEETG 320


>gi|507427 (U07704) PITSLRE isoform PBETA21 [Homo sapiens]
           Length = 777

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.2, P = 1.0
 Identities = 19/60 (31%), Positives = 27/60 (45%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+      SE  E+ E  E
Sbjct:   259 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 318

 Score = 65 (22.9 bits), Expect = 8.0, P = 1.0
 Identities = 21/64 (32%), Positives = 30/64 (46%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+    + SE  E+ E  E
Sbjct:   259 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEG---STSEESEEEEEEE 315

Query:   213 VXEXG 227
               E G
Sbjct:   316 EEETG 320


>gi|2313831 (AE000583) H. pylori predicted coding region HP0702 [Helicobacter
            pylori]
            Length = 158

  Minus Strand HSPs:

 Score = 43 (15.1 bits), Expect = 6.3, Sum P(2) = 1.0
 Identities = 12/27 (44%), Positives = 15/27 (55%), Frame = -1

Query:    75 PYPLXKHINVITYFLKNV--PWSPIGL 1
             PY L  H ++IT  L N+  P  PI L
Sbjct:    62 PYVLDYHCSIITRNLPNLKNPLLPIKL 88

 Score = 37 (13.0 bits), Expect = 6.3, Sum P(2) = 1.0
 Identities = 6/12 (50%), Positives = 8/12 (66%), Frame = -2

Query:   158 FFKXFFFCFFXL 123
             FF  F+F F+ L
Sbjct:     4 FFSFFYFLFYFL 15


>gi|507168 (U04824) PITSLRE alpha 2-1 [Homo sapiens]
           Length = 779

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.3, P = 1.0
 Identities = 19/60 (31%), Positives = 27/60 (45%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+      SE  E+ E  E
Sbjct:   261 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 320

 Score = 65 (22.9 bits), Expect = 8.0, P = 1.0
 Identities = 21/64 (32%), Positives = 30/64 (46%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+    + SE  E+ E  E
Sbjct:   261 DLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEG---STSEESEEEEEEE 317

Query:   213 VXEXG 227
               E G
Sbjct:   318 EEETG 322


>gnl|PID|e334256 (Z98595) putative glycolipid anchored surface protein
            [Schizosaccharomyces pombe]
            Length = 510

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 6.3, P = 1.0
 Identities = 21/44 (47%), Positives = 25/44 (56%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLS 68
             SS+  S   SSS  ++ SSSSVSS SS  SS +S  S    S S
Sbjct:   425 SSTSGSSSGSSSASTTASSSSVSSGSS-ISSGSSSMSTSYTSAS 467


>pir||A55817 cyclin-dependent kinase p130-PITSLRE - mouse >gi|561746 (L37092)
            cyclin-dependent protein kinase [Mus musculus]
            Length = 783

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.3, P = 1.0
 Identities = 20/63 (31%), Positives = 28/63 (44%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             ++LS L  +S  ++   S E+         E EE EEE  EE+      SE  E+ E  E
Sbjct:   261 DLLSDLQDISDSERKTSSAESSSESGSGSEEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 320

Query:   213 VXE 221
               E
Sbjct:   321 EEE 323

 Score = 66 (23.2 bits), Expect = 6.3, P = 1.0
 Identities = 21/66 (31%), Positives = 30/66 (45%), Frame = +3

Query:    36 NMLSHLY-VSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEK-NXXETXSEIXEDXEXX 209
             ++LS L  +S  ++   S E+         E EE EEE  EE+ +  E   E  E+ E  
Sbjct:   261 DLLSDLQDISDSERKTSSAESSSESGSGSEEEEEEEEEEEEEEGSTSEESEEEEEEEEEE 320

Query:   210 EVXEXG 227
             E  E G
Sbjct:   321 EEEETG 326


>sp|Q09441|YP83_CAEEL HYPOTHETICAL 139.1 KD PROTEIN C08B11.3 IN CHROMOSOME II
            >gi|576996 (Z46676) C08B11.3 [Caenorhabditis elegans]
            Length = 1244

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 6.4, P = 1.0
 Identities = 16/44 (36%), Positives = 23/44 (52%), Frame = +3

Query:    81 ISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             +S  N D+  E   E E+ EEE  EEKN     +E+ +D +  E
Sbjct:   889 VSNGN-DIEKEIEKETEKVEEETNEEKNKEVVETEVVDDAQESE 931


>gnl|PID|d1021635 (AB002337) KIAA0339 [Homo sapiens]
            Length = 1260

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 6.5, P = 1.0
 Identities = 17/43 (39%), Positives = 24/43 (55%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXF 92
             S     ++++  S   SSS  SS SSSS SS SS F S+ + +
Sbjct:   324 STAIAATTAATASSSASSSSLSSSSSSSSSSSSSQFRSSDANY 366


>gi|340613 (L07545) A 'c' was inserted after nt 369 (=nt 10459 in genomic
           sequence (M10126)) to correct -1 frameshift probably due to gel
           compression [Leishmania tarentolae]
           Length = 355

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 6.5, P = 1.0
 Identities = 18/45 (40%), Positives = 22/45 (48%), Frame = -2

Query:   221 FXYFXXFXIFTY----F*XCFXXIFFFKXFFFC--FFXLXXLLI*Y 102
             F YF  F IF +    F  CF   FF K F F   FF +  +L+ Y
Sbjct:   286 FLYFDVFFIFVFLLILFIICFFG-FFLKDFLFLNIFFDMFSVLLIY 330


>gnl|PID|e315099 (Y13050) hunchback zinc finger protein [Musca domestica]
            Length = 817

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 6.6, P = 1.0
 Identities = 24/74 (32%), Positives = 38/74 (51%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSS-NTSXFSLDIXSLSFXET------ 56
             T+  S+SS  S   +SS  SS S+SS S+ SS  +S NT+ +      + F +       
Sbjct:   723 TANTSASSTASSSGNSSNSSSTSTSSNSNSSSAGNSPNTTMYECKYCDIFFKDAVLYTIH 782

Query:    55 ---YKCDNIFSKECPM 17
                + CD++F  +C M
Sbjct:   783 MGYHSCDDVF--KCNM 796


>sp|P54639|CYS4_DICDI CYSTEINE PROTEINASE 4 PRECURSOR >gi|1222695 (L36204) CP4
            [Dictyostelium discoideum]
            Length = 442

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 6.7, P = 1.0
 Identities = 18/41 (43%), Positives = 22/41 (53%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTS 98
             S T   +SSS  S   SSS     SSSS S  +S  +S+TS
Sbjct:   303 SSTGGKTSSSSSSGKASSSSSGKASSSSSSGKTSSAASSTS 343


>gnl|PID|e327027 (Z97342) resistance gene homolog (fragment) [Arabidopsis
            thaliana]
            Length = 365

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 6.8, P = 1.0
 Identities = 14/41 (34%), Positives = 22/41 (53%), Frame = +3

Query:    90 ENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXE 212
             EN DV DE   E EE E++  ++++  E   E  E+ +  E
Sbjct:    28 ENTDVEDEDEDEDEEDEDDDDDDEDEDEDEEEDDEEEDEDE 68


>gi|587438 (X79856) troponin T [Homo sapiens]
           Length = 163

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 6.9, P = 1.0
 Identities = 14/58 (24%), Positives = 25/58 (43%), Frame = +3

Query:    54 YVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             Y   + +    +E  D  +++  + E  EE+   E    ET +E  E+ E  +  E G
Sbjct:    11 YEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDG 68


>gi|2209115 (AF004294) myelin transcription factor 1 [Mus musculus]
            Length = 1078

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 7.0, P = 1.0
 Identities = 21/65 (32%), Positives = 30/65 (46%), Frame = +3

Query:    27 SLENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEX 206
             SL++M+S    S K K  +  E     +E+  E E+ EEE   E+   E   E  E+ E 
Sbjct:   191 SLKDMVSE--ESSKQKGVLGHEEEGEEEEEDEEEEDEEEEEEGEEGEEEEEEEEEEEEEE 248

Query:   207 XEVXE 221
              E  E
Sbjct:   249 DEEEE 253


>sp|Q03674|PLB2_YEAST PUTATIVE LYSOPHOSPHOLIPASE PRECURSOR (PHOSPHOLIPASE B)
            >pir||S53035 probable membrane protein YML006c - yeast
            (Saccharomyces cerevisiae) >gi|728653 (Z48613) unknown
            [Saccharomyces cerevisiae]
            Length = 706

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 7.2, P = 1.0
 Identities = 17/55 (30%), Positives = 31/55 (56%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXET 56
             S TS  S+ +  S+  S++  +S SSSS  S S+  SS+++    +  ++S+  T
Sbjct:   635 STTSTSSNVTSNSNSSSNTTLNSNSSSSSISSSTARSSSSTANKANAAAISYANT 689


>pir||S74260 troponin T1f, fast skeletal muscle - human (fragment) >gi|557028
            (U14643) troponin T1f [Homo sapiens]
            Length = 59

  Plus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 7.2, P = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%), Frame = +3

Query:   123 EXEETEEEXLEEKNXXETXSEIXEDX-EXXEVXE 221
             E E+ EE+  EE+   E  +E+ E+  E  EV E
Sbjct:     5 EVEQVEEQYEEEEEAQEEAAEVHEEVHEPEEVQE 38


>pir||I66796 fetal troponin T 3 - rat (fragment) >gi|440821 (U04980) fetal
            troponin T 3 [Rattus norvegicus]
            Length = 51

  Plus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 7.2, P = 1.0
 Identities = 14/42 (33%), Positives = 22/42 (52%), Frame = +3

Query:    81 ISKENXDVLDEKXXEXEET-EEEXLEEKNXXETXSEIXEDXE 203
             +S E  + ++E+  E EE  EEE ++E    E   E  E+ E
Sbjct:     1 MSDEETEQVEEQYEEEEEAQEEEEVQEDAVAEEEREEDEEEE 42


>gi|1294789 (L76261) ND3 gene product [Meloidogyne javanica]
            Length = 103

  Minus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 7.2, P = 1.0
 Identities = 14/35 (40%), Positives = 21/35 (60%), Frame = -1

Query:   231 FFRFLLLLLLXHLHXFLXLFXXHFFLQXLL-LLFLL 127
             FF  +L+ +L  L  FL LF  +F L  +  ++FLL
Sbjct:    48 FFMIILIFILFDLELFLFLFI-YFNLNLIYWMIFLL 82


>gnl|PID|e234456 (Z70684) F28D1.2 [Caenorhabditis elegans]
            Length = 268

  Plus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 7.3, P = 1.0
 Identities = 13/41 (31%), Positives = 21/41 (51%), Frame = +3

Query:    81 ISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXE 203
             + K+N D++ E+  E +  EEE  E +   E   E  E+ E
Sbjct:   223 LQKKNDDLMKEEEGEEDYEEEENYEVEEDFEDEEEYDEEGE 263


>gi|2257949 (AF006052) beta-1,4-endoglucanase-1 precursor [Heterodera glycines]
            Length = 476

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 7.4, P = 1.0
 Identities = 21/42 (50%), Positives = 23/42 (54%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +S  SS S  S   SSS  SS SSS  SS SS  SS +S  S
Sbjct:   338 SSGSSSGSSGSSSGSSSGSSSGSSSGSSSGSSGSSSGSSSGS 379

 Score = 62 (21.8 bits), Expect = 9.4, P = 1.0
 Identities = 19/45 (42%), Positives = 23/45 (51%), Frame = -3

Query:   214 TSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDI 80
             +S  S SS  S   SSS  SS SSS  S  SS  SS +   S+ +
Sbjct:   342 SSGSSGSSSGSSSGSSSGSSSGSSSGSSGSSSGSSSGSGSASISV 386


>gi|1825751 (U88311) similar to UDP-glucuronosyltransferases [Caenorhabditis
            elegans]
            Length = 537

  Minus Strand HSPs:

 Score = 48 (16.9 bits), Expect = 7.5, Sum P(2) = 1.0
 Identities = 11/28 (39%), Positives = 17/28 (60%), Frame = -3

Query:   175 VSSSFFSSXSSSSVSSXSSXFSSNTSXF 92
             + SSFF S SS ++   S  F+++ S F
Sbjct:     7 IFSSFFCSTSSLNILVYSPAFAASHSNF 34

 Score = 35 (12.3 bits), Expect = 7.5, Sum P(2) = 1.0
 Identities = 7/18 (38%), Positives = 11/18 (61%), Frame = -1

Query:    60 KHINVITYFLKNVPWSPI 7
             K+   +T  L N P+SP+
Sbjct:   445 KNAEKLTDILMNQPYSPM 462


>dbj||D89208_1 (D89208) similar to Saccharomyces cerevisiae hypothetical 48.0KD
            protein in CDC28-ARL1 intergenic region precursor, SWISS-PROT
            Accession Number P38288 [Schizosaccharomyces pombe]
            Length = 329

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 7.6, P = 1.0
 Identities = 16/67 (23%), Positives = 33/67 (49%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIX--SLSFXE 59
             ++P    S  SS+       SS +F+  +SSS+       +S++  + +D+   ++SF  
Sbjct:   248 MIPTLHGSQGSSNGNGGGAGSSDYFARPTSSSMIGAVIYDTSSSGIYIIDVTDQNVSFDS 307

Query:    58 TYKCDNI 38
             TY   ++
Sbjct:   308 TYSASDV 314


>pir||A49672 transcription factor Nrf1 - human
            Length = 742

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 7.6, P = 1.0
 Identities = 20/37 (54%), Positives = 21/37 (56%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             SS   S   SS   SS SSSS SS SS  SS +S FS
Sbjct:   453 SSHSPSSLSSSEGSSSSSSSSSSSSSSASSSASSSFS 489


>gi|793929 (U24265) special lobe-specific protein [Chironomus thummi]
           >prf||2211357A silk protein [Chironomus thummi]
           Length = 742

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 7.6, P = 1.0
 Identities = 19/68 (27%), Positives = 37/68 (54%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSX-FSLDIXSLSFXETYKCDNIF 35
             S  S+SS  ++  +SS  ++ S+S+ SS S+  S++TS   +    ++S  +T  C  ++
Sbjct:   104 SASSNSSSSANSTTSSNSTTSSNSTTSSNSTTSSNSTSSGLTTGASAISLIDT--CAWVY 161

Query:    34 SKECPMVAY 8
                   +AY
Sbjct:   162 QDSSVGIAY 170


>gnl|PID|e309990 (Z82052) T25E12.e [Caenorhabditis elegans]
            Length = 487

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 7.6, P = 1.0
 Identities = 14/60 (23%), Positives = 28/60 (46%), Frame = +3

Query:    18 MGHSLENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXED 197
             + + L  ++  L  + KD     KE+ +  D+   + EE EE   +++N  +   +  ED
Sbjct:   346 VANKLNEVVEKLISTAKDSGKSQKEDEEEEDDDDDDDEEEEENVEDDENLEDDEDDRTED 405


>gnl|PID|e324949 (Y14079) hypothetical protein [Bacillus subtilis]
            Length = 488

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 7.6, P = 1.0
 Identities = 17/41 (41%), Positives = 24/41 (58%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDI 80
             SSSS  S   +S+  SS SS S S+ SS  SS+T  + + +
Sbjct:   140 SSSSSSSKKSNSNKSSSSSSKSSSNKSSSSSSSTGTYKVQL 180


>sp|Q04635|ESC1_SCHPO ESC1 PROTEIN >pir||S28066 esc1 protein - fission yeast
            (Schizosaccharomyces pombe) >gi|4950 (X69389) Esc1
            [Schizosaccharomyces pombe] >gi|1204238 (Z69728) Esc1
            [Schizosaccharomyces pombe]
            Length = 413

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 7.9, P = 1.0
 Identities = 18/43 (41%), Positives = 23/43 (53%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             L  S T   S+    SD VS+S  SS +S++VS  S   SS T
Sbjct:   153 LTPSTTDSSSTDVSSSDSVSTSASSSNASNTVSVTSPASSSAT 195


>pir||A55004 transcription factor TFC11 - human >gi|541678 (X77366) hbZ17 [Homo
            sapiens]
            Length = 772

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 7.9, P = 1.0
 Identities = 20/37 (54%), Positives = 21/37 (56%), Frame = -3

Query:   199 SSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             SS   S   SS   SS SSSS SS SS  SS +S FS
Sbjct:   483 SSHSPSSLSSSEGSSSSSSSSSSSSSSASSSASSSFS 519


>gnl|PID|e304709 (Z35948) ORF YBR078w [Saccharomyces cerevisiae]
            Length = 242

  Minus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 8.1, P = 1.0
 Identities = 15/40 (37%), Positives = 24/40 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S TS  SS S  +   SSS  +S + ++VS+ +S  SS++
Sbjct:   136 SSTSTESSKSSATSSASSSGDASNAQANVSASASSSSSSS 175


>sp|P03161|DPOL_HPBGS DNA POLYMERASE (A PROTEIN) >pir||JDVLS DNA-directed DNA
            polymerase (EC 2.7.7.7) - ground squirrel hepatitis virus
            >gi|325402 (K02715) A protein [Ground squirrel hepatitis B virus]
            Length = 881

  Minus Strand HSPs:

 Score = 48 (16.9 bits), Expect = 8.4, Sum P(2) = 1.0
 Identities = 7/17 (41%), Positives = 13/17 (76%), Frame = -1

Query:    69 PLXKHINVITYFLKNVP 19
             P  KH++ +T +LK++P
Sbjct:   643 PQDKHVHKVTTYLKSIP 659

 Score = 39 (13.7 bits), Expect = 8.4, Sum P(2) = 1.0
 Identities = 10/25 (40%), Positives = 12/25 (48%), Frame = -1

Query:   165 HFFLQXLLLLFLLXXXPSHLIHHXF 91
             H +   LLLLF       HL+ H F
Sbjct:   521 HLY-NTLLLLFKTYGRKLHLLAHPF 544


>gnl|PID|d1007782 (D37989) Om(1E) protein [Drosophila ananassae]
            Length = 530

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 8.4, P = 1.0
 Identities = 19/50 (38%), Positives = 28/50 (56%), Frame = -3

Query:   226 PXSXTSXXSSSSXISDXVSS----SFFSSXSSSSVSSXSSXFSSNTSXFS 89
             P S T+  +S++ IS   ++    S  S  SSS +SS SS  SS++S  S
Sbjct:    98 PSSSTTTTTSATNISTSTNATTPPSTISIISSSIISSSSSSSSSSSSSSS 147


>gi|550444 (L21710) 58 kDa phosphoprotein [Plasmodium berghei]
           Length = 248

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 8.4, P = 1.0
 Identities = 15/33 (45%), Positives = 19/33 (57%), Frame = +3

Query:    66 KDKXXISK-ENXDVLDEKXXEXEETEEEXLEEK 161
             KDK    K ++ D  +EK  E EE EEE  EE+
Sbjct:    44 KDKMGYEKMKSEDSTEEKSDEEEEDEEEEEEEE 76


>sp|P34375|YLM1_CAEEL HYPOTHETICAL 12.0 KD PROTEIN D2007.1 IN CHROMOSOME III
            >pir||S44787 D2007.1 protein - Caenorhabditis elegans >gi|289668
            (L16560) putative [Caenorhabditis elegans]
            Length = 111

  Minus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 8.5, P = 1.0
 Identities = 16/60 (26%), Positives = 26/60 (43%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDNIFSKEC 23
             S+ S  S+ + SS FS       S+ +  +S  ++  S      S    Y+C N F + C
Sbjct:    16 STESAASNNIFSSIFSFGKKKPTSTPTPSYSKASASTSRCGVQASQCSAYECCN-FDQTC 74


>gi|1621359 (U70826) vitellogenin II precursor [Fundulus heteroclitus]
            Length = 1687

  Minus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 8.9, P = 1.0
 Identities = 21/40 (52%), Positives = 24/40 (60%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNT 101
             S +S  SS S  S   SSS  SS SSSS SS SS  SS++
Sbjct:  1088 SSSSSGSSRSSRSRSSSSSSSSSSSSSSRSSSSSSRSSSS 1127

 Score = 68 (23.9 bits), Expect = 8.9, P = 1.0
 Identities = 22/48 (45%), Positives = 25/48 (52%), Frame = -3

Query:   232 LLPXSXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             L P    S  +SSS      SS   SS SSSS SS SS  SS++S  S
Sbjct:  1077 LSPGLKNSTKASSSSSGSSRSSRSRSSSSSSSSSSSSSSRSSSSSSRS 1124


>sp|P53862|YNW8_YEAST HYPOTHETICAL 28.6 KD PROTEIN IN URE2-SSU72 INTERGENIC
            REGION PRECURSOR >pir||S63194 probable membrane protein YNL228w -
            yeast (Saccharomyces cerevisiae) >gnl|PID|e221816 (Z69381) N1249
            [Saccharomyces cerevisiae] >gnl|PID|e239626 (Z71504) ORF YNL228w
            [Saccharomyces cerevisiae]
            Length = 258

  Minus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 8.9, P = 1.0
 Identities = 27/77 (35%), Positives = 37/77 (48%), Frame = -3

Query:   202 SSSSXISDXVSSSFFSSXSSS------SVSSXSSXFSSNTSXFS----LDIXSLSFXET- 56
             SSS   S+  S+SF S  +SS      S+SS S   SS  S FS    L   S+ F  + 
Sbjct:   165 SSSLSSSEDDSASFLSISASSACNACRSISSFSLTLSSAESNFSRSERLSNPSVMFSSSI 224

Query:    55 -YKCDNIFSKECPMVAYW 5
              ++  +IF   C +V  W
Sbjct:   225 SFRISSIFFL-CSLVFMW 241


>sp|P36127|YK12_YEAST HYPOTHETICAL 12.4 KD PROTEIN IN SPO14-DAL80 INTERGENIC
            REGION >pir||S38104 hypothetical protein YKR032w - yeast
            (Saccharomyces cerevisiae) >gi|486465 (Z28257) ORF YKR032w
            [Saccharomyces cerevisiae]
            Length = 104

  Plus Strand HSPs:

 Score = 52 (18.3 bits), Expect = 9.2, P = 1.0
 Identities = 8/20 (40%), Positives = 14/20 (70%), Frame = +1

Query:    10 RRPWDIL*KICYHIYMFLQR 69
             R PW ++ K C  +Y+++QR
Sbjct:    59 RHPWTVISKCCL-VYIYIQR 77


>pir||S48790 troponin T, cardiac muscle (clone HTNT3) - human >gi|587430
            (X79858) troponin T [Homo sapiens]
            Length = 72

  Plus Strand HSPs:

 Score = 52 (18.3 bits), Expect = 9.2, P = 1.0
 Identities = 13/64 (20%), Positives = 29/64 (45%), Frame = +3

Query:    30 LENMLSHLYVSXKDKXXISKENXDVLDEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXX 209
             +E ++       +++  + +E  D  +++  + E  EE+   E    ET +E  E+ E  
Sbjct:     4 IEEVVEEYEEEEQEEAAVEEE--DWREDEDEQEEAAEEDAEAEAETEETRAEDEEEEEAK 61

Query:   210 EVXE 221
             E  +
Sbjct:    62 EAED 65


>pir||QFBO micro glutamic acid-rich protein - bovine
           Length = 82

  Plus Strand HSPs:

 Score = 52 (18.3 bits), Expect = 9.2, P = 1.0
 Identities = 14/40 (35%), Positives = 16/40 (40%), Frame = +3

Query:   108 DEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXG 227
             +EK  E  E E E  EE    E      ED E  +  E G
Sbjct:    12 EEKEKEEAEAEAEAEEEGAQEEEAEAAKEDAEEAKEEEGG 51


>gnl|PID|d1021481 (AB001684) ORF67 [Chlorella vulgaris]
            Length = 67

  Minus Strand HSPs:

 Score = 52 (18.3 bits), Expect = 9.2, P = 1.0
 Identities = 16/44 (36%), Positives = 19/44 (43%), Frame = -1

Query:   231 FFRFLLLLLLXHLHX-FLXLFXXHFFLQXLLLLFLLXXXPSHLI 103
             FF  LL       +  F  LF   F L  L +LFLL   P  +I
Sbjct:    24 FFSTLLFFKAFEKNFVFFRLFFRFFLLLYLFILFLLPLIPKKVI 67


>gi|2570557 (AF023215) anti-fluorescein monoclonal IgM heavy chain [Mus
            musculus]
            Length = 80

  Minus Strand HSPs:

 Score = 52 (18.3 bits), Expect = 9.2, P = 1.0
 Identities = 17/60 (28%), Positives = 24/60 (40%), Frame = -3

Query:   175 VSSSFFSSXSSSSVSSXSSXFSSNT-SXFSLDIXSLSFXET--YKCDNIFSKECPMVAYW 5
             +SS  F +    SV    +    N  +   L + SL   +T  Y C   F  + P  AYW
Sbjct:    12 ISSGGFYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARSFYYDYPWFAYW 71


>gnl|PID|e302832 (Y08769) microvascular endothelial differentiation gene 2
            [Rattus norvegicus]
            Length = 129

  Plus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 9.3, P = 1.0
 Identities = 11/23 (47%), Positives = 16/23 (69%), Frame = +1

Query:   127 QKKQKKKXLKKKMXXKQXQKXVK 195
             +KK+KKK  KKK   K+ +K +K
Sbjct:    85 KKKKKKKKKKKKKKKKKKKKKIK 107


>sp|P33322|CBF5_YEAST CENTROMERE/MICROTUBULE BINDING PROTEIN CBF5 (P64')
            >pir||S41853 centromere/microtubule-binding protein CBF5 - yeast
            (Saccharomyces cerevisiae) >gi|311097 (L12351)
            centromere/microtubule binding protein [Saccharomyces cerevisiae]
            >gi|577203 (U17246) Cbf5p: centromere/microtubule binding protein
            [Saccharomyces cerevisiae]
            Length = 483

  Plus Strand HSPs:

 Score = 48 (16.9 bits), Expect = 9.4, Sum P(2) = 1.0
 Identities = 12/35 (34%), Positives = 18/35 (51%), Frame = +1

Query:   127 QKKQKKKXLKKKMXXKQXQKXVKMXKXXK*XKXEE 231
             +KK+KK   +KK   ++  K  K  K  K  K E+
Sbjct:   436 EKKEKKDKKEKKEKKEKKDKKEKKEKKEKKRKSED 470

 Score = 33 (11.6 bits), Expect = 9.4, Sum P(2) = 1.0
 Identities = 6/13 (46%), Positives = 9/13 (69%), Frame = +3

Query:    18 MGHSLENMLSHLY 56
             +G SLEN+   L+
Sbjct:   139 LGRSLENLTGALF 151


>sp|P46060|RGP1_HUMAN RAN GTPASE ACTIVATING PROTEIN 1 >pir||I38146 RanGAP1 -
            human >gi|575268 (X82260) RanGAP1 [Homo sapiens]
            Length = 587

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 9.5, P = 1.0
 Identities = 15/41 (36%), Positives = 21/41 (51%), Frame = +3

Query:   108 DEKXXEXEETEEEXLEEKNXXETXSEIXEDXEXXEVXEXGR 230
             +E+  E EE EEE  EE+   E   E  E+ E  E  + G+
Sbjct:   363 EEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQ 403


>gi|1778865 (U83248) GtpA [Dictyostelium discoideum]
            Length = 273

  Minus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 9.7, P = 1.0
 Identities = 22/64 (34%), Positives = 29/64 (45%), Frame = -3

Query:   220 SXTSXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFSLDIXSLSFXETYKCDN 41
             S T+  SSSS  S   SS   +   S S SS SS  SS++     D    SF +     +
Sbjct:     9 SKTTKSSSSSSASPK-SSKISNVSGSGSSSSSSSSSSSSSKDKDKDKRKKSFLKDDSVPS 67

Query:    40 IFSK 29
             + SK
Sbjct:    68 LSSK 71


>sp|P54681|RTOA_DICDI RTOA PROTEIN (RATIO-A) >gi|1206019 (U48298) rtoA gene
            product [Dictyostelium discoideum]
            Length = 400

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 9.8, P = 1.0
 Identities = 16/41 (39%), Positives = 22/41 (53%), Frame = -3

Query:   211 SXXSSSSXISDXVSSSFFSSXSSSSVSSXSSXFSSNTSXFS 89
             S  SSS  +S  V SS  SS  S+S +S     SS+++  S
Sbjct:    56 SIGSSSQSLSSEVDSSDISSSGSNSTASSEGSVSSSSNSGS 96


>sp|P38739|YHC8_YEAST HYPOTHETICAL 63.8 KD PROTEIN IN GUT1-RIM1 INTERGENIC
            REGION PRECURSOR >pir||S48940 hypothetical protein YHL028w - yeast
            (Saccharomyces cerevisiae) >gi|2289857 (U11583) Similiar to mucin
            and several other Ser-Thr-rich proteins [Saccharomyces cerevisiae]
            Length = 605

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 9.8, P = 1.0
 Identities = 16/49 (32%), Positives = 29/49 (59%), Frame = -3

Query:   229 LPXSXTSXXSSSSXISDXVSS--SFFSSXSSSSVSSXSSXFSSNTSXFS 89
             +P S TS  S+++  S   S+  S  SS S+++ ++ S+  S++TS  S
Sbjct:   191 IPTSTTSSTSTTTSTSSSTSTTVSVTSSTSTTTSTTSSTLISTSTSSSS 239


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.58
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.305   0.127   0.319    same    same    same
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.397   0.192   0.777
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.356   0.154   0.504
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.351   0.167   0.596
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.407   0.199   0.828
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.306   0.114   0.305    same    same    same
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0       77        59      10. 55 3  12 23    0.11 30
                                                  26   0.094 30
   +2      0       77        61      10. 55 3  12 22    0.10 30
                                                  26    0.10 30
   +1      0       78        61      10. 55 3  12 22    0.10 30
                                                  26    0.10 30
   -1      0       78        64      10. 56 3  12 22    0.11 30
                                                  27    0.12 30
   -2      0       77        60      10. 55 3  12 22   0.098 30
                                                  26    0.10 30
   -3      0       77        65      10. 55 3  12 23    0.11 30
                                                  27   0.092 31


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  232
  No. of states in DFA:  558 (55 KB)
  Total size of DFA:  94 KB (128 KB)
  Time to generate neighborhood:  0.00u 0.01s 0.01t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  41.62u 0.61s 42.23t  Elapsed: 00:00:12
  Total cpu time:  41.89u 0.69s 42.58t  Elapsed: 00:00:12
  Start:  Sat Feb  7 08:00:20 1998   End:  Sat Feb  7 08:00:32 1998

Date: 16:25:39 on Sun 17 Dec 117.