blastx_gbnr_files/857827_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  857827
        (219 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|e1251531     (AJ224326) ribulose-5-phosphate-e... +1   221  1.5e-17   1
A gnl|PID|e339939      (Z98979) ribulose-phosphate 3-epi... +1   189  3.6e-14   1
A sp|P46969|RPE_YEAST  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1   174  1.4e-12   1
A gi|861366            (U28991) coded for by C. elegans ... +1   188  2.0e-12   1
A sp|P71676|RPE_MYCTU  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1   154  1.8e-10   1
A gi|2988419           (U97573) pentose-5-phosphate 3-ep... +1   151  3.8e-10   1
A sp|P32719|YJCU_ECOLI HYPOTHETICAL 26.1 KD PROTEIN IN F... +1   141  5.1e-09   1
A gnl|PID|e258326      (Z78161) unknown [Mus musculus]      +1   140  5.6e-09   1
A pir||S55287          hypothetical protein 24K - Escher... +1   138  9.1e-09   1
A sp|P32661|RPE_ECOLI  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1   138  1.0e-08   1
A sp|P45455|RPE_SERMA  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1   135  1.9e-08   1
A pir||A53305          pentose-5-phosphate 3-epimerase -... +1   133  3.5e-08   1
A sp|P51013|RPE_RHORU  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1   133  4.1e-08   1
A sp|P44756|RPE_HAEIN  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1   130  9.1e-08   1
A pir||I64077          dod protein (dod) homolog - Haemo... +1   130  1.1e-07   1
A gnl|PID|e323507      (Y13937) putative CfxE protein [B... +1   128  1.4e-07   1
A sp|P74061|RPE_SYNY3  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1   127  2.3e-07   1
A gi|2564973           (U23145) pentose-5-phosphate-3-ep... +1   123  6.5e-07   1
A gi|3328520           (AE001286) Ribulose-P Epimerase [... +1   122  9.1e-07   1
A sp|Q43843|RPE_SOLTU  RIBULOSE-PHOSPHATE 3-EPIMERASE PR... +1   124  9.3e-07   1
A sp|Q04539|RPEP_ALCEU RIBULOSE-PHOSPHATE 3-EPIMERASE, P... +1   121  1.3e-06   1
A pir||F47019          ribulose-phosphate 3-epimerase (E... +1   121  1.3e-06   1
A gi|3264792           (AF070943) ribulose-phosphate 3-e... +1   118  2.8e-06   1
A sp|P40117|RPEC_ALCEU RIBULOSE-PHOSPHATE 3-EPIMERASE, C... +1   117  3.8e-06   1
A sp|Q43157|RPE_SPIOL  RIBULOSE-PHOSPHATE 3-EPIMERASE PR... +1   118  4.5e-06   1
A gi|3264790           (AF070942) ribulose-phosphate 3-e... +1   118  4.5e-06   1
A gi|2983483           (AE000716) ribulose-5-phosphate 3... +1   109  2.4e-05   1
A gnl|PID|e240002      (X96878) pentose-5-phosphate 3-ep... +1    97  0.00020   1
A sp|Q58093|RPE_METJA  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1    95  0.0010    1
A sp|P75522|Y112_MYCPN HYPOTHETICAL PROTEIN MG112 HOMOLO... +1    87  0.0067    1
A gi|406423            (U02181) unknown [Mycoplasma geni... +1    78  0.021     1
A sp|P47358|Y112_MYCGE HYPOTHETICAL PROTEIN MG112 >pir||... +1    78  0.062     1
A sp|P56188|RPE_HELPY  RIBULOSE-PHOSPHATE 3-EPIMERASE (P... +1    72  0.27      1
A sp|P15748|GSPI_KLEPN GENERAL SECRETION PATHWAY PROTEIN... +1    57  0.99      1
A gi|2315430           (AF016446) similar to C. elegans ... -3    63  0.990     1



>gnl|PID|e1251531 (AJ224326) ribulose-5-phosphate-epimerase [Homo sapiens]
            Length = 174

  Plus Strand HSPs:

 Score = 221 (77.8 bits), Expect = 1.5e-17, P = 1.5e-17
 Identities = 44/72 (61%), Positives = 52/72 (72%), Frame = +1

Query:     4 PEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSV 183
             PE+WV+ M  AGA+QYTFHLE+TEN    I  IRE  MKVGL IKP T V  L P+ + +
Sbjct:    22 PEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQI 81

Query:   184 DMILIMTVEPGF 219
             DM L+MTVEPGF
Sbjct:    82 DMALVMTVEPGF 93


>gnl|PID|e339939 (Z98979) ribulose-phosphate 3-epimerase [Schizosaccharomyces
            pombe]
            Length = 228

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 3.6e-14, P = 3.6e-14
 Identities = 33/72 (45%), Positives = 50/72 (69%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDS 180
             +PE++++ +  AGAS + FH E+TE     I +  E  M VG  +KPKTPV  +LP+++ 
Sbjct:    75 EPERYIDQLADAGASLFCFHYEATEKHEEIISRAHEKGMLVGCALKPKTPVEVILPFVEK 134

Query:   181 VDMILIMTVEPG 216
             +DM+L+MTVEPG
Sbjct:   135 LDMVLVMTVEPG 146


>sp|P46969|RPE_YEAST RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (RPE) >pir||S51587 POS18 protein - yeast
            (Saccharomyces cerevisiae) >gi|609674 (X83571)
            Ribulose-5-Phosphate-Epimerase [Saccharomyces cerevisiae]
            >gi|1008313 (Z49396) ORF YJL121c [Saccharomyces cerevisiae]
            Length = 238

  Plus Strand HSPs:

 Score = 174 (61.3 bits), Expect = 1.4e-12, P = 1.4e-12
 Identities = 32/73 (43%), Positives = 45/73 (61%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDS 180
             +PEKWV++    GA Q+TFH E+T++ +H +  I+   +K    IKP T V  L      
Sbjct:    85 NPEKWVDDFAKCGADQFTFHYEATQDPLHLVKLIKSKGIKAACAIKPGTSVDVLFELAPH 144

Query:   181 VDMILIMTVEPGF 219
             +DM L+MTVEPGF
Sbjct:   145 LDMALVMTVEPGF 157


>gi|861366 (U28991) coded for by C. elegans cDNA cm21c7 [Caenorhabditis
           elegans]
           Length = 1741

  Plus Strand HSPs:

 Score = 188 (66.2 bits), Expect = 2.0e-12, P = 2.0e-12
 Identities = 39/76 (51%), Positives = 51/76 (67%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLESTEN---VMHCIHKIREADMKVGLGIKPKTPVTELLPY 171
             +P +WVE M  AGASQ+TFH E+ +    V   I KIR++ MKVGL +KP T V  +L +
Sbjct:  1589 NPGQWVEPMAKAGASQFTFHYEAVDGDVAVSELIEKIRKSGMKVGLSVKPGTSVEHILKH 1648

Query:   172 IDSVDMILIMTVEPGF 219
              + +D  LIMTVEPGF
Sbjct:  1649 ANHLDNALIMTVEPGF 1664


>sp|P71676|RPE_MYCTU RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E) >gnl|PID|e265632 (Z80108) rpe
            [Mycobacterium tuberculosis]
            Length = 232

  Plus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 1.8e-10, P = 1.8e-10
 Identities = 29/73 (39%), Positives = 42/73 (57%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDS 180
             +P++W      AGA   TFH E+T+N +     IR A  K G+ +KP TP+   L  +  
Sbjct:    77 NPDRWAPPYAEAGAYNVTFHAEATDNPVGVARDIRAAGAKAGISVKPGTPLEPYLDILPH 136

Query:   181 VDMILIMTVEPGF 219
              D +L+M+VEPGF
Sbjct:   137 FDTLLVMSVEPGF 149


>gi|2988419 (U97573) pentose-5-phosphate 3-epimerase homolog [Treponema
            pallidum] >gi|3323267 (AE001263) ribulose-phosphate 3-epimerase
            (cfxE) [Treponema pallidum]
            Length = 218

  Plus Strand HSPs:

 Score = 151 (53.2 bits), Expect = 3.8e-10, P = 3.8e-10
 Identities = 30/72 (41%), Positives = 42/72 (58%), Frame = +1

Query:     4 PEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSV 183
             P   +E+   AGA   TFH+E+  +    IH IR   +KVG+ + P TPV  L   +  V
Sbjct:    74 PADLIEDFVQAGADFLTFHIEAEVHAHRLIHAIRGRGVKVGISLVPSTPVAALSEVLPFV 133

Query:   184 DMILIMTVEPGF 219
             D++L+MTV PGF
Sbjct:   134 DLVLVMTVNPGF 145


>sp|P32719|YJCU_ECOLI HYPOTHETICAL 26.1 KD PROTEIN IN FDHF-PHNP INTERGENIC
            REGION (F231) >gi|396420 (U00006) similar to Alcaligenes eutrophus
            pHG1 D-ribulose-5-phosphate 3 epimerase [Escherichia coli]
            >gi|1790523 (AE000482) hypothetical 26.1 kD protein in fdhf-phnp
            intergenic region [Escherichia coli]
            Length = 231

  Plus Strand HSPs:

 Score = 141 (49.6 bits), Expect = 5.1e-09, P = 5.1e-09
 Identities = 30/73 (41%), Positives = 41/73 (56%), Frame = +1

Query:     4 PEKWVENMKAAGASQYTFHLESTEN-VMHCIHKIREADMKVGLGIKPKTPVTELLPYIDS 180
             P+ ++  +  AGA   T H E+        I +IR  DMKVGL + P+TPV  +  YI  
Sbjct:    69 PQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHK 128

Query:   181 VDMILIMTVEPGF 219
              D I +MTV+PGF
Sbjct:   129 ADKITVMTVDPGF 141


>gnl|PID|e258326 (Z78161) unknown [Mus musculus]
            Length = 145

  Plus Strand HSPs:

 Score = 140 (49.3 bits), Expect = 5.6e-09, P = 5.6e-09
 Identities = 31/54 (57%), Positives = 37/54 (68%), Frame = +1

Query:     4 PEKWVENMKAAGASQYTFHLESTENVMHC-IHKIREADMKVGLGIKPKTPVTEL 162
             PE+WV+ M  AGA+QYTFHLE+TEN     +  IRE  MKVGL IKP+    EL
Sbjct:    87 PEQWVKPMDVAGANQYTFHLEATENPGALDLKTIRENGMKVGLDIKPRNYRLEL 140


>pir||S55287 hypothetical protein 24K - Escherichia coli >gi|41222 (Z19601) ORF
            for 24kD protein; pid:g41222 [Escherichia coli]
            Length = 221

  Plus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 9.1e-09, P = 9.1e-09
 Identities = 30/71 (42%), Positives = 45/71 (63%), Frame = +1

Query:     7 EKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVD 186
             ++ V +  AAGAS  TFH E++E+V   +  I+E   K GL   P TP++ L   +D +D
Sbjct:    75 DRIVPDFAAAGASIITFHPEASEHVDRTLQLIKENGCKAGLVFNPATPLSYLDYVMDKLD 134

Query:   187 MILIMTVEPGF 219
             +IL+M+V PGF
Sbjct:   135 VILLMSVNPGF 145


>sp|P32661|RPE_ECOLI RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E) >gi|606320 (U18997) 24 kD protein
            [Escherichia coli] >gi|1789788 (AE000414) dod protein [Escherichia
            coli]
            Length = 225

  Plus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 30/71 (42%), Positives = 45/71 (63%), Frame = +1

Query:     7 EKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVD 186
             ++ V +  AAGAS  TFH E++E+V   +  I+E   K GL   P TP++ L   +D +D
Sbjct:    75 DRIVPDFAAAGASIITFHPEASEHVDRTLQLIKENGCKAGLVFNPATPLSYLDYVMDKLD 134

Query:   187 MILIMTVEPGF 219
             +IL+M+V PGF
Sbjct:   135 VILLMSVNPGF 145


>sp|P45455|RPE_SERMA RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E) >pir||S47100 dod protein - Serratia
            marcescens >gi|498769 (X78412) dod gene product [Serratia
            marcescens]
            Length = 210

  Plus Strand HSPs:

 Score = 135 (47.5 bits), Expect = 1.9e-08, P = 1.9e-08
 Identities = 29/71 (40%), Positives = 44/71 (61%), Frame = +1

Query:     7 EKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVD 186
             ++ V +   AGAS  +FH E++E+V   I  I+E   K GL   P TP++ L   +D +D
Sbjct:    75 DRIVPDFAKAGASYISFHPEASEHVDRTIQLIKEHGCKAGLVFNPATPLSYLDYVMDKID 134

Query:   187 MILIMTVEPGF 219
             +IL+M+V PGF
Sbjct:   135 VILLMSVNPGF 145


>pir||A53305 pentose-5-phosphate 3-epimerase - Rhodospirillum rubrum
            >bbs|136105 (S64484) pentose-5-phosphate 3-epimerase
            [Rhodospirillum rubrum, Str-2, Peptide, 219 aa] [Rhodospirillum
            rubrum]
            Length = 219

  Plus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 3.5e-08, P = 3.5e-08
 Identities = 23/68 (33%), Positives = 44/68 (64%), Frame = +1

Query:    16 VENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMIL 195
             +++   AGA   TFH E++++V   +  IR+  +K G+ + P +P++ L   ++ +D++L
Sbjct:    78 IDSFAEAGADMITFHPEASDHVHRSVQMIRKRGLKAGVALNPASPLSLLDHILEDLDLVL 137

Query:   196 IMTVEPGF 219
             IM+V PGF
Sbjct:   138 IMSVNPGF 145


>sp|P51013|RPE_RHORU RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E)
            Length = 225

  Plus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 4.1e-08, P = 4.1e-08
 Identities = 23/68 (33%), Positives = 44/68 (64%), Frame = +1

Query:    16 VENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMIL 195
             +++   AGA   TFH E++++V   +  IR+  +K G+ + P +P++ L   ++ +D++L
Sbjct:    78 IDSFAEAGADMITFHPEASDHVHRSVQMIRKRGLKAGVALNPASPLSLLDHILEDLDLVL 137

Query:   196 IMTVEPGF 219
             IM+V PGF
Sbjct:   138 IMSVNPGF 145


>sp|P44756|RPE_HAEIN RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E)
            Length = 224

  Plus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 9.1e-08, P = 9.1e-08
 Identities = 26/71 (36%), Positives = 43/71 (60%), Frame = +1

Query:     7 EKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVD 186
             ++ + +   AGA+  TFH ES+E++   +  IR+   K GL   P  P++ L   +D VD
Sbjct:    75 DRIIPDFAKAGANYITFHPESSEHIDRSLQLIRDCGCKSGLVFNPAMPLSYLDYVLDKVD 134

Query:   187 MILIMTVEPGF 219
             ++L+M+V PGF
Sbjct:   135 VVLLMSVNPGF 145


>pir||I64077 dod protein (dod) homolog - Haemophilus influenzae (strain Rd
            KW20) >gi|1573553 (U32738) ribulose-phosphate 3-epimerase (dod)
            [Haemophilus influenzae Rd]
            Length = 234

  Plus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 26/71 (36%), Positives = 43/71 (60%), Frame = +1

Query:     7 EKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVD 186
             ++ + +   AGA+  TFH ES+E++   +  IR+   K GL   P  P++ L   +D VD
Sbjct:    85 DRIIPDFAKAGANYITFHPESSEHIDRSLQLIRDCGCKSGLVFNPAMPLSYLDYVLDKVD 144

Query:   187 MILIMTVEPGF 219
             ++L+M+V PGF
Sbjct:   145 VVLLMSVNPGF 155


>gnl|PID|e323507 (Y13937) putative CfxE protein [Bacillus subtilis]
            >gnl|PID|e1185170 (Z99112) similar to ribulose-5-phosphate
            3-epimerase [Bacillus subtilis]
            Length = 217

  Plus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 1.4e-07, P = 1.4e-07
 Identities = 24/73 (32%), Positives = 42/73 (57%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDS 180
             +P++++     AGA   + H E+  ++   I  I+E  +K G+ + P TPV  +    D 
Sbjct:    70 EPDRYIPAFAKAGADILSVHAEACPHLHRTIQLIKEQGVKAGVVLNPHTPVQVIEHVFDD 129

Query:   181 VDMILIMTVEPGF 219
             +D++L+MTV PGF
Sbjct:   130 LDLVLLMTVNPGF 142


>sp|P74061|RPE_SYNY3 RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E) >gnl|PID|d1018870 (D90911)
            pentose-5-phosphate-3-epimerase [Synechocystis sp.]
            Length = 230

  Plus Strand HSPs:

 Score = 127 (44.7 bits), Expect = 2.3e-07, P = 2.3e-07
 Identities = 30/75 (40%), Positives = 47/75 (62%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLE--STENVMHCIHKIREADMKVGLGIKPKTPVTELLPYI 174
             +PEK+VE+   AGA   + H+E  ++ ++   + +IRE   K G  + P TP+ + L Y+
Sbjct:    73 EPEKYVEDFAKAGADIISVHVEHNASPHLHRTLCQIRELGKKAGAVLNPSTPL-DFLEYV 131

Query:   175 DSV-DMILIMTVEPGF 219
               V D+ILIM+V PGF
Sbjct:   132 LPVCDLILIMSVNPGF 147


>gi|2564973 (U23145) pentose-5-phosphate-3-epimerase [Rhodobacter capsulatus]
            Length = 228

  Plus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 6.5e-07, P = 6.5e-07
 Identities = 24/71 (33%), Positives = 39/71 (54%), Frame = +1

Query:     7 EKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVD 186
             + +++    AGA   T H+E+  ++   +  IR A MK G+ I P TP   +   +D  D
Sbjct:    77 DAYIDAYAQAGADVLTAHVEAGPHIHRTLQAIRAAGMKSGVAINPGTPAEAIEHVLDIAD 136

Query:   187 MILIMTVEPGF 219
             ++ +MTV PGF
Sbjct:   137 VVCVMTVNPGF 147


>gi|3328520 (AE001286) Ribulose-P Epimerase [Chlamydia trachomatis]
            Length = 233

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 9.1e-07, P = 9.1e-07
 Identities = 24/72 (33%), Positives = 41/72 (56%), Frame = +1

Query:     4 PEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSV 183
             P ++VE    AGA +   H E+ EN+   I  I++  ++ G+   P+T +  +  +I   
Sbjct:    80 PFEFVEAFVKAGADRIIVHFEAAENIKEIISYIQKCGVQAGVAFSPETSIEFVTSFIPLC 139

Query:   184 DMILIMTVEPGF 219
             D+IL+M+V PGF
Sbjct:   140 DVILLMSVHPGF 151


>sp|Q43843|RPE_SOLTU RIBULOSE-PHOSPHATE 3-EPIMERASE PRECURSOR
            (PENTOSE-5-PHOSPHATE 3-EPIMERASE) (PPE) (RPE) (R5P3E) >pir||S58081
            ribulose-phosphate 3-epimerase (EC 5.1.3.1) precursor - potato
            (fragment) >gi|902739 (Z50098) pentose-5-phosphate-3-epimerase
            [Solanum tuberosum]
            Length = 280

  Plus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 9.3e-07, P = 9.3e-07
 Identities = 26/75 (34%), Positives = 46/75 (61%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLESTENV-MH-CIHKIREADMKVGLGIKPKTPVTELLPYI 174
             +P++ V +   AGA   + H E +  + +H  I++I+    K G+ + P TP+T +   +
Sbjct:   125 EPDQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVL 184

Query:   175 DSVDMILIMTVEPGF 219
             D+VD++LIM+V PGF
Sbjct:   185 DAVDLVLIMSVNPGF 199


>sp|Q04539|RPEP_ALCEU RIBULOSE-PHOSPHATE 3-EPIMERASE, PLASMID
            (PENTOSE-5-PHOSPHATE 3-EPIMERASE) (PPE) (R5P3E) >gi|150678 (M64172)
            D-ribulose-5-phosphate 3 epimerase [Plasmid pHG1]
            Length = 241

  Plus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 1.3e-06, P = 1.3e-06
 Identities = 25/62 (40%), Positives = 40/62 (64%), Frame = +1

Query:    34 AGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEP 213
             AGA+  +FH E++ +V   I  IR+   K GL + P TP++ L   +D +D++L+M+V P
Sbjct:    95 AGANLISFHPEASRHVDRTIGLIRDHGCKAGLVLNPATPLSWLDHTLDKLDLVLLMSVNP 154

Query:   214 GF 219
             GF
Sbjct:   155 GF 156


>pir||F47019 ribulose-phosphate 3-epimerase (EC 5.1.3.1) - Alcaligenes
            eutrophus plasmid pHG1
            Length = 241

  Plus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 1.3e-06, P = 1.3e-06
 Identities = 25/62 (40%), Positives = 40/62 (64%), Frame = +1

Query:    34 AGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEP 213
             AGA+  +FH E++ +V   I  IR+   K GL + P TP++ L   +D +D++L+M+V P
Sbjct:    95 AGANLISFHPEASRHVDRTIGLIRDHGCKAGLVLNPATPLSWLDHTLDKLDLVLLMSVNP 154

Query:   214 GF 219
             GF
Sbjct:   155 GF 156


>gi|3264792 (AF070943) ribulose-phosphate 3-epimerase mature form [Expression
            vector pFL506]
            Length = 237

  Plus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 2.8e-06, P = 2.8e-06
 Identities = 26/75 (34%), Positives = 45/75 (60%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLE--STENVMHCIHKIREADMKVGLGIKPKTPVTELLPYI 174
             +PE+ V +   AGA   + H E  ST ++   +++I+    K G+ + P TP++ +   +
Sbjct:    82 EPEQRVPDFIKAGADIVSVHCELASTIHLHRTVNQIKSLGAKAGVVLNPGTPLSTIEYVL 141

Query:   175 DSVDMILIMTVEPGF 219
             D VD++LIM+V PGF
Sbjct:   142 DVVDLVLIMSVNPGF 156


>sp|P40117|RPEC_ALCEU RIBULOSE-PHOSPHATE 3-EPIMERASE, CHROMOSOMAL
            (PENTOSE-5-PHOSPHATE 3-EPIMERASE) (PPE) (R5P3E) >pir||C47019
            ribulose-phosphate 3-epimerase (EC 5.1.3.1) - Alcaligenes eutrophus
            >gi|304019 (M64173) D-ribulose-5-phosphate 3 epimerase [Alcaligenes
            eutrophus]
            Length = 241

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 3.8e-06, P = 3.8e-06
 Identities = 25/62 (40%), Positives = 39/62 (62%), Frame = +1

Query:    34 AGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEP 213
             AGA+  +FH E++ +V   I  IR+   K GL + P TP+  L   +D +D++L+M+V P
Sbjct:    95 AGANIISFHPEASRHVDRTIGLIRDHGCKAGLVLNPATPLGWLDHTLDQLDLVLLMSVNP 154

Query:   214 GF 219
             GF
Sbjct:   155 GF 156


>sp|Q43157|RPE_SPIOL RIBULOSE-PHOSPHATE 3-EPIMERASE PRECURSOR
            (PENTOSE-5-PHOSPHATE 3-EPIMERASE) (PPE) (RPE) (R5P3E) >pir||S62724
            ribulose-phosphate 3-epimerase (EC 5.1.3.1) precursor - spinach
            >gi|1162980 (L42328) ribulose-5-phosphate 3-epimerase [Spinacia
            oleracea] >gi|3264788 (AF070941) ribulose-phosphate 3-epimerase
            [Spinacia oleracea] >prf||2207382A D-ribulose-5-phosphate
            3-epimerase [Sorghum bicolor]
            Length = 285

  Plus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 4.5e-06, P = 4.5e-06
 Identities = 26/75 (34%), Positives = 45/75 (60%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLE--STENVMHCIHKIREADMKVGLGIKPKTPVTELLPYI 174
             +PE+ V +   AGA   + H E  ST ++   +++I+    K G+ + P TP++ +   +
Sbjct:   130 EPEQRVPDFIKAGADIVSVHCELASTIHLHRTVNQIKSLGAKAGVVLNPGTPLSTIEYVL 189

Query:   175 DSVDMILIMTVEPGF 219
             D VD++LIM+V PGF
Sbjct:   190 DVVDLVLIMSVNPGF 204


>gi|3264790 (AF070942) ribulose-phosphate 3-epimerase transit form [Expression
            vector pFL505]
            Length = 285

  Plus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 4.5e-06, P = 4.5e-06
 Identities = 26/75 (34%), Positives = 45/75 (60%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLE--STENVMHCIHKIREADMKVGLGIKPKTPVTELLPYI 174
             +PE+ V +   AGA   + H E  ST ++   +++I+    K G+ + P TP++ +   +
Sbjct:   130 EPEQRVPDFIKAGADIVSVHCELASTIHLHRTVNQIKSLGAKAGVVLNPGTPLSTIEYVL 189

Query:   175 DSVDMILIMTVEPGF 219
             D VD++LIM+V PGF
Sbjct:   190 DVVDLVLIMSVNPGF 204


>gi|2983483 (AE000716) ribulose-5-phosphate 3-epimerase [Aquifex aeolicus]
            Length = 222

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 20/73 (27%), Positives = 41/73 (56%), Frame = +1

Query:     1 DPEKWVENMKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDS 180
             +P+K++     AGA+  + H+E+  ++   +  I+E   K G+ + P T ++ +   +  
Sbjct:    70 NPDKYIPKFVEAGANWISVHIENNYHIHRTLQLIKELGAKAGVVVNPGTSLSAIEEALYY 129

Query:   181 VDMILIMTVEPGF 219
              D +L+M+V PGF
Sbjct:   130 ADYVLLMSVNPGF 142


>gnl|PID|e240002 (X96878) pentose-5-phosphate 3-epimerase [Chlamydomonas
            reinhardtii]
            Length = 143

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.00020, P = 0.00020
 Identities = 19/59 (32%), Positives = 36/59 (61%), Frame = +1

Query:    49 YTFHLESTENV-MH-CIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEPGF 219
             Y+ H E +  + +H  ++ +++   K G+ + P T ++ +   +D VD+ILIM+V PGF
Sbjct:     3 YSVHAEQSSTIHLHRTLNMVKDLGCKAGVVLNPGTSLSTIEEVLDVVDLILIMSVNPGF 61


>sp|Q58093|RPE_METJA RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E) >pir||H64384
            pentose-5-phosphate-3-epimerase (EC 5.1.3.-) - Methanococcus
            jannaschii >gi|1591395 (U67515) pentose-5-phosphate-3-epimerase
            [Methanococcus jannaschii]
            Length = 234

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.0010, P = 0.0010
 Identities = 19/56 (33%), Positives = 32/56 (57%), Frame = +1

Query:    52 TFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEPGF 219
             TFH+E+ +     I++I+    K  + + P TP+  +   +  V  +L+MTVEPGF
Sbjct:    85 TFHIEAVKFPFRIINRIKSIGAKPIVALNPATPLDAIEYILGDVYAVLVMTVEPGF 140


>sp|P75522|Y112_MYCPN HYPOTHETICAL PROTEIN MG112 HOMOLOG >pir||S73907
            D-ribulose-5-phosphate 3 epimerase cfxE - Mycoplasma pneumoniae
            (SGC3) (ATCC 29342) >gi|1674282 (AE000057) Mycoplasma pneumoniae,
            D-ribulose-5-phosphate 3 epimerase; similar to Swiss-Prot Accession
            Number Q04539, from A. eutrophus [Mycoplasma pneumoniae]
            Length = 215

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.0067, P = 0.0067
 Identities = 18/57 (31%), Positives = 32/57 (56%), Frame = +1

Query:    52 TFHLESTE--NVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEPG 216
             +FH+E  +   + H I +I++A  +VGL  K  TP+      +  +D + +M+V PG
Sbjct:    92 SFHVEPFDIPTIKHFIAQIKQAGKQVGLAFKFTTPLVNYERLVQQLDFVTLMSVPPG 148


>gi|406423 (U02181) unknown [Mycoplasma genitalium]
           Length = 88

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.021, P = 0.021
 Identities = 18/57 (31%), Positives = 30/57 (52%), Frame = +1

Query:    52 TFHLE--STENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEPG 216
             +FH+E  S   +   I  ++E   +VGL  K  T +    P+  ++D I +M+V PG
Sbjct:    18 SFHVEPFSFAKIKELIQLVKENGKEVGLAFKFTTNLQLYQPFFTTIDFITLMSVPPG 74


>sp|P47358|Y112_MYCGE HYPOTHETICAL PROTEIN MG112 >pir||D64212
            D-ribulose-5-phosphate 3 epimerase homolog - Mycoplasma genitalium
            (SGC3) >gi|1045791 (U39690) D-ribulose-5-phosphate 3 epimerase
            [Mycoplasma genitalium]
            Length = 209

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.064, P = 0.062
 Identities = 18/57 (31%), Positives = 30/57 (52%), Frame = +1

Query:    52 TFHLE--STENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEPG 216
             +FH+E  S   +   I  ++E   +VGL  K  T +    P+  ++D I +M+V PG
Sbjct:    87 SFHVEPFSFAKIKELIQLVKENGKEVGLAFKFTTNLQLYQPFFTTIDFITLMSVPPG 143


>sp|P56188|RPE_HELPY RIBULOSE-PHOSPHATE 3-EPIMERASE (PENTOSE-5-PHOSPHATE
            3-EPIMERASE) (PPE) (R5P3E) >gi|2314553 (AE000638)
            D-ribulose-5-phosphate 3 epimerase (rpe) [Helicobacter pylori]
            Length = 217

  Plus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.32, P = 0.27
 Identities = 14/56 (25%), Positives = 30/56 (53%), Frame = +1

Query:    52 TFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDSVDMILIMTVEPGF 219
             + H E+ ++    +  I+   +  G+ + P T    +   ++SV ++L+M+V PGF
Sbjct:    84 SIHAENEKHPHRVLQLIKNLGITPGIVLNPHTHEESIKYLLESVGLVLLMSVNPGF 139


>sp|P15748|GSPI_KLEPN GENERAL SECRETION PATHWAY PROTEIN I PRECURSOR
            (PULLULANASE SECRETION PROTEIN PULI) >pir||S11919 pulI protein -
            Klebsiella oxytoca >gi|149308 (M32613) pulI [Klebsiella pneumoniae]
            >prf||1707264C pulI gene [Klebsiella oxytoca]
            Length = 121

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 4.5, P = 0.99
 Identities = 18/56 (32%), Positives = 30/56 (53%), Frame = +1

Query:    13 WVEN-MKAAGASQYTFHLESTENVMHCIHKIREADMKVGLGIKPKTPVTELLPYIDS 180
             W E  ++AAG S   +H+   + V   + ++R  D++V      KTPV+ L  Y+ S
Sbjct:    68 WSETTLQAAGVS---WHIR-WQGVETDLPQLRALDVEVRHAKSDKTPVSSLRTYVTS 120


>gi|2315430 (AF016446) similar to C. elegans olfactory receptor ODR-10
            (NID:g1235900) [Caenorhabditis elegans]
            Length = 277

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 4.6, P = 0.99
 Identities = 13/45 (28%), Positives = 26/45 (57%), Frame = -3

Query:   166 VIVQ*LVFLVLYQDQLSCQLHVFYEYNA*HFQWILSEKYIDLHQQ 32
             +I+  LVF + Y  +  C+++  +  ++ HFQ+I S+ +  L  Q
Sbjct:   145 IIIMSLVFSIYYDVKCWCRMNEIFSSSSTHFQYIQSQLFYALVAQ 189


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.95
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.382   0.168   0.764  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.382   0.184   0.636  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.318   0.136   0.405  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.359   0.160   0.639  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.356   0.159   0.513  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.353   0.154   0.514  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0       72        72       10.  55 3 1000 22  0.093   31
                                                     27  0.12    31
   +2      0       72        72       10.  55 3 1000 22  0.093   31
                                                     27  0.12    31
   +1      0       73        73       10.  55 3 1000 22  0.095   31
                                                     27  0.12    31
   -1      0       73        73       10.  55 3 1000 22  0.095   31
                                                     27  0.12    31
   -2      0       72        72       10.  55 3 1000 22  0.093   31
                                                     27  0.12    31
   -3      0       72        72       10.  55 3 1000 22  0.093   31
                                                     27  0.12    31


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  35
  No. of states in DFA:  266 (26 KB)
  Total size of DFA:  31 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.01s 0.01t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  16.17u 1.09s 17.26t  Elapsed: 00:00:05
  Total cpu time:  16.21u 3.32s 19.53t  Elapsed: 00:00:07
  Start:  Sat Sep 26 05:01:50 1998   End:  Sat Sep 26 05:01:57 1998

Date: 14:44:25 on Sun 17 Dec 117.