blastx_gbnr_files/914074_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  914074
        (611 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|1916549           (U50966) DJNK [Drosophila melanog... +2   184  2.0e-13   1
A gi|1656058           (U73196) Jun-N-terminal kinase [D... +2   184  3.2e-13   1
A gi|1857041           (U49180) JNK protein kinase [Dros... +2   184  3.7e-13   1
A gi|1293853           (U57054) strong similarity to CDC... +2   183  8.2e-13   1
A pir||S71098          protein kinase JNK1 beta1 - human... +2   178  1.9e-12   1
A pir||S71099          protein kinase JNK1 beta2 - human... +2   178  2.4e-12   1
A gi|1916547           (U50965) DJNK [Drosophila melanog... +2   176  2.9e-12   1
A pir||S71103          protein kinase JNK3 alpha1 - huma... +2   171  1.4e-11   1
A gi|493211            (L27128) stress activated protein... +2   171  1.4e-11   1
A pir||S43969          p54-beta stress-activated protein... +2   171  1.4e-11   1
A sp|P53779|JNK3_HUMAN STRESS-ACTIVATED PROTEIN KINASE J... +2   171  1.7e-11   1
A sp|P49187|JNK3_RAT   STRESS-ACTIVATED PROTEIN KINASE J... +2   171  1.7e-11   1
A dbj||AB001744_1      (AB001744) JNKb [Cyprinus carpio]    +2   166  5.0e-11   1
A gi|529434            (L35236) mitogen-activated protei... +2   165  6.3e-11   1
A sp|Q61831|JNK3_MOUSE STRESS-ACTIVATED PROTEIN KINASE J... +2   165  7.6e-11   1
A pir||S71100          proteine kinase JNK2 alpha1 - hum... +2   161  1.4e-10   1
A gnl|PID|d1019937     (AB000807) c-JUN amino-terminal k... +2   161  1.4e-10   1
A sp|P49186|JNK2_RAT   STRESS-ACTIVATED PROTEIN KINASE J... +2   161  1.7e-10   1
A sp|P45984|JNK2_HUMAN STRESS-ACTIVATED PROTEIN KINASE J... +2   161  1.7e-10   1
A pir||A55480          c-Jun amino-terminal kinase JNK2,... +2   161  1.7e-10   1
A pir||A53063          protein kinase JNK1 - human >gi|4... +2   155  6.3e-10   1
A sp|P45983|JNK1_HUMAN STRESS-ACTIVATED PROTEIN KINASE J... +2   155  7.8e-10   1
A sp|P49185|JNK1_RAT   STRESS-ACTIVATED PROTEIN KINASE J... +2   153  1.2e-09   1
A pir||S43970          p54-gamma stress-activated protei... +2   153  1.2e-09   1
A pir||S71101          protein kinase JNK2 beta1 - human... +2   151  1.7e-09   1
A pir||S43967          p54-alpha stress-activated protei... +2   151  2.1e-09   1
A pir||S73317          protein kinase JNK2 beta2 - human... +2   151  2.1e-09   1
A dbj||D83273_1        (D83273) JNKa [Cyprinus carpio]      +2   146  3.7e-08   1
A gi|1326389           (U58752) strong similarity to CDC... +2   138  6.5e-07   1
A sp|P47812|MP38_XENLA MITOGEN-ACTIVATED PROTEIN KINASE ... +2   136  1.2e-06   1
A gi|493207            (L27111) stress activated protein... +2   132  5.8e-06   1
A gi|1326388           (U58752) similar to the CDC2/CDC2... +2   129  6.2e-06   1
A sp|Q09892|STY1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE ... +2   130  7.2e-06   1
A pir||S68680          stress-activated protein kinase 3... +2   128  1.5e-05   1
A gnl|PID|e320986      (Y13439) stress-activated protein... +2   128  1.5e-05   1
A gi|1136798           (U19775) Mxi2 [Homo sapiens] >prf... +2   126  1.7e-05   1
A gi|2196780           (AF003597) p38 mitogen activated ... +2   127  1.9e-05   1
A sp|Q16539|MP38_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE ... +2   126  2.6e-05   1
A sp|P70618|MP38_RAT   MITOGEN-ACTIVATED PROTEIN KINASE ... +2   126  2.6e-05   1
A gi|1916984           (U91847) p38 mitogen activated pr... +2   126  2.6e-05   1
A gi|2072361           (AF001008) p38Beta2 MAP Kinase [H... +2   126  2.6e-05   1
A gi|2316012           (U92268) mitogen activated protei... +2   126  2.6e-05   1
A pdb|1WFC|            Structure Of Apo, Unphosphorylate... +2   126  2.7e-05   1
A sp|Q15759|M38B_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE ... +2   126  2.8e-05   1
A pir||S47430          protein kinase (EC 2.7.1.37) cdc2... +2   103  7.4e-05   1
A gi|1279911           (U52963) mitogen-activated protei... +2   122  8.0e-05   1
A gi|1666813           (U70134) pathogenicity MAP kinase... +2   122  8.0e-05   1
A sp|P27638|SPK1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE ... +2   122  8.7e-05   1
A gi|295611            (L06279) HOG1 protein [Saccharomy... +2   122  0.00011   1
A gi|1256876           (U53878) Hog1p: Mitogen-activated... +2   122  0.00011   1
A sp|P32485|HOG1_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +2   122  0.00011   1
A pir||S43968          p54-alpha-2 stress-activated prot... +2   120  0.00019   1
A sp|P40417|ERKA_DROME MITOGEN-ACTIVATED PROTEIN KINASE ... +2   118  0.00028   1
A sp|Q40353|MMK2_MEDSA MITOGEN-ACTIVATED PROTEIN KINASE ... +2   117  0.00036   1
A gnl|PID|e122949      (X82270) protein kinase [Medicago... +2   117  0.00036   1
A pir||S60121          mitogen-activated protein kinase ... +2   117  0.00036   1
A pir||A37871          protein kinase (EC 2.7.1.37) cdk2... +2   115  0.00042   1
A sp|P23437|CDK2_XENLA CELL DIVISION PROTEIN KINASE 2 (C... +2   115  0.00042   1
A gi|507166            (U04819) PITSLRE beta 1 [Homo sap... +2   116  0.00062   1
A sp|Q39023|MPK3_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +2   115  0.00063   1
A sp|Q39025|MPK5_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +2   115  0.00065   1
A gnl|PID|e259403      (Y07597) shaggy-like kinase kappa... +2   114  0.00085   1
A sp|P04551|CC2_SCHPO  CELL DIVISION CONTROL PROTEIN 2 (... +2   112  0.00096   1
A gi|1110512           (U40484) MAP kinase [Aplysia cali... +2   113  0.00099   1
A pir||S51938          protein kinase homolog - Arabidop... +2   114  0.0010    1
A gnl|PID|d1020522     (D83073) p38b [Mus musculus]         +2   113  0.0010    1
A sp|Q92207|HOG1_CANAL MITOGEN-ACTIVATED PROTEIN KINASE ... +2   113  0.0011    1
A gi|2160191           (AC000132) Identical to A. thalia... +2   114  0.0011    1
A sp|Q39026|MPK6_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +2   113  0.0012    1
A sp|P43450|CDK2_CARAU CELL DIVISION PROTEIN KINASE 2 >p... +2   111  0.0013    1
A gnl|PID|e333558      (AJ001085) putative 34kDa cdc2-re... +2   111  0.0013    1
A pir||G54024          protein kinase (EC 2.7.1.37) cdc2... +2   116  0.0013    1
A pir||H54024          protein kinase (EC 2.7.1.37) cdc2... +2   116  0.0013    1
A gi|507429            (U07705) PITSLRE isoform PBETA22 ... +2   116  0.0014    1
A gi|507427            (U07704) PITSLRE isoform PBETA21 ... +2   116  0.0014    1
A pir||B54024          protein kinase (EC 2.7.1.37) cdc2... +2   116  0.0014    1
A pir||F54024          protein kinase (EC 2.7.1.37) cdc2... +2   116  0.0014    1
A pir||E54024          protein kinase (EC 2.7.1.37) cdc2... +2   116  0.0014    1
A sp|P53778|ERK6_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +2   112  0.0014    1
A gnl|PID|e291136      (Y10487) stress-activated protein... +2   112  0.0014    1
A sp||ERK1_MOUSE_2     [Segment 2 of 2] EXTRACELLULAR SI... +2   110  0.0017    1
A gi|2191146           (AF007269) MAP Kinase [Arabidopsi... +2   111  0.0018    1
A gi|1669368           (AC000065) human CDK6 [Homo sapiens] +2   100  0.0018    1
A pir||A47211          protein kinase ERK (EC 2.7.1.-) C... +2   111  0.0018    1
A gnl|PID|e354277      (Y15075) stress-activated protein... +2   111  0.0018    1
A gi|1772646           (U66243) p38gamma MAP Kinase [Hom... +2   111  0.0019    1
A pir||S56638          mitogen-activated protein kinase ... +2   111  0.0019    1
A sp|Q39024|MPK4_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +2   111  0.0019    1
A sp|Q07176|MMK1_MEDSA MITOGEN-ACTIVATED PROTEIN KINASE ... +2   111  0.0020    1
A sp|P24941|CDK2_HUMAN CELL DIVISION PROTEIN KINASE 2 (P... +2   109  0.0022    1
A gi|312803            (X62071) cdk2 gene product [Homo ... +2   109  0.0022    1
A gi|29849             (X61622) cell division kinase. CD... +2   109  0.0022    1
A sp|P48963|CDK2_MESAU CELL DIVISION PROTEIN KINASE 2 >g... +2   109  0.0022    1
A gnl|PID|d1006498     (D28753) cyclin dependent kinase ... +2   109  0.0022    1
A gi|1695880           (U63337) cyclin-dependent kinase-... +2   109  0.0022    1
A pdb|1JST|A           Homo sapiens >pdb|1JST|C Homo sap... +2   109  0.0022    1
A gi|170869            (M76585) protein kinase [Candida ... +2   111  0.0023    1
A sp|P28869|ERK1_CANAL EXTRACELLULAR SIGNAL-REGULATED KI... +2   111  0.0023    1
A gnl|PID|e49056       (Z11696) 44kDa protein kinase [Ho... +2   110  0.0023    1
A sp|Q90336|MP38_CYPCA MITOGEN-ACTIVATED PROTEIN KINASE ... +2   110  0.0024    1
A gi|2232214           (AF004709) stress-activated prote... +2   110  0.0024    1
A gnl|PID|e291121      (Y10488) stress-activated protein... +2   110  0.0024    1
A pir||PQ0270          extracellular signal-regulated ki... +2   110  0.0024    1
A gi|515499            (U12008) microtubule-associated p... +2   110  0.0024    1
A pir||A60041          Ca2+/calmodulin-dependent protein... +2   110  0.0025    1
A gi|204054            (M61177) extracellular-signal-reg... +2   110  0.0025    1
A pir||S28184          Ca2+/calmodulin-dependent protein... +2   110  0.0026    1
A pir||A48082          mitogen-activated protein kinase ... +2   110  0.0026    1
A sp|P27361|ERK1_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +2   110  0.0026    1
A sp|P21708|ERK1_RAT   EXTRACELLULAR SIGNAL-REGULATED KI... +2   110  0.0026    1
A sp|Q00526|CDK3_HUMAN CELL DIVISION PROTEIN KINASE 3 >p... +2   108  0.0031    1
A pir||A38282          p58 galactosyltransferase-associa... +2   110  0.0032    1
A sp|P21127|KP58_HUMAN GALACTOSYLTRANSFERASE ASSOCIATED ... +2   110  0.0032    1
A gi|2360960           (AF015256) p38 mitogen-activated ... +2   109  0.0032    1
A pir||A42823          cell division control-related pro... +2   110  0.0033    1
A gi|189481            (M37712) p58/GTA protein kinase [... +2   110  0.0033    1
A sp|Q13164|ERK5_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +2   113  0.0033    1
A gi|973307            (U29725) BMK1 alpha kinase [Homo ... +2   113  0.0033    1
A gi|189496            (M88565) p58 protein kinase [Homo... +2   110  0.0033    1
A gi|507158            (U04815) PITSLRE alpha 1 [Homo sa... +2   110  0.0035    1
A pir||A54024          protein kinase (EC 2.7.1.37) cdc2... +2   110  0.0035    1
A sp|Q07785|CC2H_PLAFK CELL DIVISION CONTROL PROTEIN 2 H... +2   107  0.0036    1
A sp|Q06060|MAPK_PEA   MITOGEN-ACTIVATED PROTEIN KINASE ... +2   109  0.0037    1
A gnl|PID|e290217      (Y10160) cyclin dependent kinase ... +2   107  0.0037    1
A sp|P51139|MSK3_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +2   109  0.0039    1
A sp|P54666|CC23_TRYBB CELL DIVISION CONTROL PROTEIN 2 H... +2   107  0.0041    1
A gi|507164            (U04818) PITSLRE alpha 2-4 [Homo ... +2   110  0.0046    1
A gi|530748            (X80845) cdc2Pnc gene product [Pi... +2   103  0.0049    1
A gi|23879             (Z11695) 40kDa protein kinase [Ho... +2   107  0.0051    1
A sp|P46196|ERK2_BOVIN EXTRACELLULAR SIGNAL-REGULATED KI... +2   107  0.0054    1
A pir||S23427          protein kinase, 41K (EC 2.7.1.-) ... +2   107  0.0054    1
A sp|P28482|ERK2_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +2   107  0.0054    1
A pir||A39754          mitogen-activated protein kinase ... +2   107  0.0054    1
A sp|P26696|ERK2_XENLA MITOGEN-ACTIVATED PROTEIN KINASE ... +2   107  0.0054    1
A gi|64894             (X59813) MAP kinase [Xenopus laevis] +2   107  0.0054    1
A pdb|1GOL|            Coordinates Of Rat Map Kinase Erk... +2   107  0.0055    1
A pdb|1ERK|            Structure Of Signal-Regulated Kin... +2   107  0.0055    1
A sp|Q40532|NTF4_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE ... +2   107  0.0062    1
A sp|P51138|MSK2_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +2   107  0.0067    1
A sp|P43068|MKC1_CANAL MITOGEN-ACTIVATED PROTEIN KINASE ... +2   108  0.0068    1
A gi|507162            (U04817) PITSLRE alpha 2-3 [Homo ... +2   110  0.0069    1
A gi|507160            (U04816) PITSLRE alpha 2-2 [Homo ... +2   110  0.0070    1
A gi|507168            (U04824) PITSLRE alpha 2-1 [Homo ... +2   110  0.0071    1
A pir||A55817          cyclin-dependent kinase p130-PITS... +2   110  0.0071    1
A sp|P23573|CC2C_DROME CELL DIVISION CONTROL PROTEIN 2 C... +2   105  0.0074    1
A sp|P51136|KG3H_DICDI GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +2   104  0.0075    2
A sp|P29619|CC22_ORYSA CELL DIVISION CONTROL PROTEIN 2 H... +2   104  0.0086    1
A gi|1710234           (U79269) cyclin dependent protein... +2   102  0.0086    1
A pir||A40444          protein kinase (EC 2.7.1.37) cdc2... +2   104  0.0087    1
A pir||B40444          protein kinase (EC 2.7.1.37) cdc2... +2   104  0.0087    1
A sp|P24100|CC2A_ARATH CELL DIVISION CONTROL PROTEIN 2 H... +2   104  0.0087    1
A sp|P23111|CC2_MAIZE  CELL DIVISION CONTROL PROTEIN 2 H... +2   104  0.0087    1
A gi|1236190           (U18365) cyclin dependent protein... +2   104  0.0087    1
A gnl|PID|e251152      (X98768) cdc2-like kinase [Theile... +2   104  0.0089    1
A gnl|PID|e251627      (X98824) cdec2-related kinase [Th... +2   104  0.0089    1
A gnl|PID|e323538      (Y12785) MAP kinase I [Petroselin... +2   105  0.0098    1
A pir||I50463          protein kinase - chicken >gi|5714... +2   109  0.010     2
A gi|2138340           (U94192) salicylic acid-activated... +2   105  0.011     1
A gnl|PID|e1172776     (AJ002314) shaggy-like kinase 111... +2   106  0.011     1
A pir||S42049          protein kinase (EC 2.7.1.37) cdc2... +2   103  0.011     1
A pir||JQ2243          protein kinase (EC 2.7.1.37) cdc2... +2   103  0.011     1
A gnl|PID|e252637      (X99100) protein kinase [Trifoliu... +2   104  0.011     1
A gi|1914883           (L29449) protein kinase [Schizosa... +2   104  0.012     1
A gnl|PID|e292745      (X97314) cdc2MsC [Medicago sativa]   +2   106  0.012     1
A sp|P24788|KP58_MOUSE GALACTOSYLTRANSFERASE ASSOCIATED ... +2   105  0.012     1
A gnl|PID|e292746      (X97315) cdc2MsD [Medicago sativa]   +2   103  0.013     1
A pir||A53227          galactosyltransferase-associated ... +2   105  0.013     1
A gnl|PID|e242658      (X97638) cyclin-dependent kinase ... +2   102  0.013     1
A gi|1303658           (L77991) cyclin-dependent kinase ... +2   103  0.014     1
A sp|Q05006|CC22_MEDSA CELL DIVISION CONTROL PROTEIN 2 H... +2   102  0.015     1
A gnl|PID|e251272      (Z75661) cdc2 kinase homologue [S... +2   102  0.015     1
A sp|P43289|KSGG_ARATH SHAGGY RELATED PROTEIN KINASE ASK... +2   104  0.015     1
A sp|P11802|CDK4_HUMAN CELL DIVISION PROTEIN KINASE 4 (P... +2   102  0.016     1
A sp|P35426|CDK4_RAT   CELL DIVISION PROTEIN KINASE 4 (P... +2   102  0.016     1
A sp|P30285|CDK4_MOUSE CELL DIVISION PROTEIN KINASE 4 (P... +2   102  0.016     1
A pir||S52841          protein kinase (EC 2.7.1.37) cdk4... +2   102  0.016     1
A gi|1763059           (U68478) cyclin-dependent kinase ... +2   102  0.016     1
A gi|2209290           (U81031) CDK4 [Homo sapiens]         +2   102  0.016     1
A gnl|PID|e305854      (Y11527) serine/threonine protein... +2    99  0.016     1
A gi|2191169           (AF007270) Similar to shaggy rela... +2   104  0.017     1
A gnl|PID|e1172778     (AJ002315) shaggy-like kinase 59 ... +2   104  0.019     1
A sp|P29618|CC21_ORYSA CELL DIVISION CONTROL PROTEIN 2 H... +2   101  0.020     1
A gi|1196796           (L34206) protein kinase p34cdc2 [... +2   101  0.020     1
A pir||S57928          protein kinase (EC 2.7.1.37) cdc2... +2   101  0.020     1
A sp|P52389|CC2_VIGUN  CELL DIVISION CONTROL PROTEIN 2 H... +2   101  0.020     1
A sp|P34112|CC2_DICDI  CELL DIVISION CONTROL PROTEIN 2 H... +2   101  0.020     1
A gi|2465400           (AF020316) MAP kinase Mps1 [Magna... +2   103  0.020     1
A gnl|PID|e242615      (X97637) cyclin-dependent kinase ... +2   101  0.021     1
A sp|P46892|KP58_RAT   GALACTOSYLTRANSFERASE ASSOCIATED ... +2   103  0.022     1
A gi|1129065           (L24388) galactosyltransferase-as... +2   103  0.022     1
A pir||S47042          protein kinase (EC 2.7.1.37) cdc2... +2   105  0.023     1
A gi|575365            (X80759) cdc2-related protein kin... +2   105  0.025     1
A bbs|129891           Mpk1p=mitogen-activated protein k... +2   103  0.025     1
A sp|Q00772|SLT2_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +2   103  0.025     1
A sp|P43288|KSGA_ARATH SHAGGY RELATED PROTEIN KINASE ASK... +2   102  0.025     1
A gnl|PID|e340154      (AJ000732) shaggy-like kinase alp... +2   102  0.025     1
A gnl|PID|d1010011     (D50738) cdc2 homolog [Nicotiana ... +2   100  0.025     1
A gi|1377888           (L77082) cdc2 gene product [Nicot... +2   100  0.025     1
A gnl|PID|d1022523     (AB006033) cdc2 kinase [Allium cepa] +2   100  0.025     1
A pir||S51105          petunia shaggy kinase 4 - garden ... +2   102  0.026     1
A sp|P51137|MSK1_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLO... +2   102  0.026     1
A gnl|PID|e321536      (Y13646) cyclin dependent kinase ... +2   100  0.028     1
A gi|1654379           (U69958) cdc2-related protein kin... +2   100  0.028     1
A gnl|PID|e281555      (Y09305) protein kinase [Homo sap... +2    98  0.029     1
A sp|Q00534|CDK6_HUMAN CELL DIVISION PROTEIN KINASE 6 (K... +2   100  0.031     1
A gi|16217             (X57840) p34(cdc2)-like protein [... +2    94  0.033     1
A pir||S57926          protein kinase (EC 2.7.1.37) cdk4... +2    99  0.038     1
A gnl|PID|d1010243     (D61377) WIPK [Nicotiana tabacum]    +2   100  0.038     1
A pir||A36978          MAP kinase mpk-1 (EC 2.7.1.-) - C... +2   100  0.038     1
A sp|Q12222|KOM8_YEAST PROBABLE SERINE/THREONINE-PROTEIN... +2    95  0.039     2
A gnl|PID|e305855      (Y11591) shaggy-like kinase [Rici... +2    98  0.039     1
A sp|Q11179|YPC2_CAEEL PUTATIVE SERINE/THREONINE-PROTEIN... +2   101  0.042     1
A gnl|PID|e320985      (Y13437) shaggy-like kinase etha ... +2   100  0.043     1
A gi|1377890           (L77083) cdc2 gene product [Nicot... +2    98  0.044     1
A pir||S52095          tau-protein kinase (EC 2.7.1.135)... +2   100  0.044     1
A gi|2564701           (AF026546) Cdc2 cyclin-dependent ... +2    98  0.045     1
A gi|2564703           (AF026545) Cdc2 cyclin-dependent ... +2    98  0.045     1
A pir||S51106          shaggy kinase 6 - garden petunia ... +2   100  0.047     1
A sp|P14681|KSS1_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +2    99  0.048     1
A sp|P39745|SUR1_CAEEL MITOGEN-ACTIVATED PROTEIN KINASE ... +2   100  0.049     1
A gnl|PID|e273936      (Y08607) Shaggy-like kinase 6 [Ni... +2   100  0.053     1
A gi|2408067           (Z99165) protein kinase [Schizosa... +2   101  0.056     1
A gnl|PID|e256971      (X99696) shaggy-like protein kina... +2    99  0.056     1
A sp|P48609|CDK5_DROME CELL DIVISION PROTEIN KINASE 5 HO... +2    97  0.057     1
A pir||S51008          protein kinase (EC 2.7.1.37) cdk5... +2    97  0.057     1
A gnl|PID|e255551      (X99511) CDK5 kinase [Drosophila ... +2    97  0.057     1
A pir||S71266          shaggy-like kinase dzeta - Arabid... +2    99  0.057     1
A pir||JC4898          minibrain protein - human >gnl|PI... +2   102  0.057     1
A prf||2208359A        protein kinase Dyrk [Rattus norve... +2   102  0.058     1
A sp|Q13627|MNB_HUMAN  SERINE/THREONINE-SPECIFIC PROTEIN... +2   102  0.058     1
A gi|1381158           (U58497) mp86 [Mus musculus]         +2   102  0.058     1
A gi|1663726           (U52373) MNB [Homo sapiens]          +2   102  0.058     1
A gnl|PID|e1169187     (X79769) Dual Specificity Yak1-re... +2   102  0.058     1
A gi|402652            (X73653) tau-protein kinase [Ratt... +2    99  0.059     1
A sp|P49841|KG3B_HUMAN GLYCOGEN SYNTHASE KINASE-3 BETA (... +2    99  0.059     1
A pir||I51425          intracellular kinase - African cl... +2    99  0.059     1
A pir||I51692          glycogen synthase kinase 3 beta -... +2    99  0.059     1
A gnl|PID|e338481      (AJ001275) cdc2-related kinase 3 ... +2    97  0.062     1
A pir||S71267          shaggy-like kinase etha - Arabido... +2    98  0.066     1
A gnl|PID|e312305      (Y07822) Shaggy-like kinase tetha... +2    99  0.069     1
A sp|P18265|KG3A_RAT   GLYCOGEN SYNTHASE KINASE-3 ALPHA ... +2    99  0.071     1
A sp|P49840|KG3A_HUMAN GLYCOGEN SYNTHASE KINASE-3 ALPHA ... +2    99  0.071     1
A gi|1658064           (U74762) cdc2-related protein kin... +2    96  0.076     1
A sp|P25859|CC2B_ARATH CELL DIVISION CONTROL PROTEIN 2 H... +2    96  0.080     1
A sp|P36005|KKQ1_YEAST PROBABLE SERINE/THREONINE-PROTEIN... +2    98  0.080     1
A gi|1695919           (U73195) MO15-related protein kin... +2    96  0.086     1
A sp|P27704|ERK3_RAT   EXTRACELLULAR SIGNAL-REGULATED KI... +2   100  0.091     1
A sp|Q16659|ERK3_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +2   100  0.091     1
A pir||S10931          probable protein kinase zeste-whi... +2    95  0.093     1
dbj||D87271_1        (D87271) ERK2 [Mus musculus]         +2    95  0.094     1
sp|Q02399|CDK5_BOVIN CELL DIVISION PROTEIN KINASE 5 (T... +2    95  0.095     1
sp|P49615|CDK5_MOUSE CELL DIVISION PROTEIN KINASE 5 (T... +2    95  0.095     1
sp|Q03114|CDK5_RAT   CELL DIVISION PROTEIN KINASE 5 (T... +2    95  0.095     1
sp|P51166|CDK5_XENLA CELL DIVISION PROTEIN KINASE 5 (N... +2    95  0.095     1
sp|P42525|ERK1_DICDI EXTRACELLULAR SIGNAL-REGULATED KI... +2    97  0.097     1
pir||A56042          mitogen-activated protein kinase ... +2    97  0.097     1
gnl|PID|e233924      (Z70308) F49E11.1 [Caenorhabditis... +2    98  0.099     1
sp|Q06309|CRK1_LEIME CELL DIVISION PROTEIN KINASE 2 HO... +2    95  0.10      1
sp|P18431|KSGZ_DROME PROTEIN KINASE SHAGGY, ZYGOTIC (P... +2    98  0.10      1
bbs|171000           (S79590) Mo15=putative protein ki... +2    96  0.10      1
sp|P54685|CDK7_DICDI CELL DIVISION PROTEIN KINASE 7 (C... +2    96  0.10      1
sp|P38615|MDS1_YEAST SERINE/THREONINE-PROTEIN KINASE M... +2    96  0.11      1
gi|295639            (L12761) protein-serine kinase [S... +2    96  0.11      1
pir||S66145          Cdk-activating protein kinase (EC... +2    95  0.12      1
sp|Q00535|CDK5_HUMAN CELL DIVISION PROTEIN KINASE 5 (T... +2    94  0.12      1
gi|36621             (X66364) serine/threonine protein... +2    94  0.12      1
sp|P18266|KG3B_RAT   GLYCOGEN SYNTHASE KINASE-3 BETA (... +2    96  0.13      1
gnl|PID|d1022290     (AB004538) identical to S.pombe m... +2    95  0.13      1
pir||S35326          protein kinase sgg3 (EC 2.7.1.-) ... +2    97  0.13      1
gi|4170              (Y00867) PHO85 [Saccharomyces cer... +2    94  0.13      1
pir||OKBY85          protein kinase (EC 2.7.1.37) PHO8... +2    94  0.13      1
pir||A44331          zeste-white 3-A - fruit fly (Dros... +2    97  0.13      1
gi|295932            (Y00867) PHO85 [Saccharomyces cer... +2    94  0.13      1
sp|P17157|PH85_YEAST NEGATIVE REGULATOR OF THE PHO SYS... +2    94  0.13      1
gnl|PID|e236437      (Z68298) F44D12.11 [Caenorhabditi... +2    93  0.13      1
gi|727249            (U15802) CDC2 [Paramecium tetraur... +2    94  0.13      1
pir||S53538          protein kinase (EC 2.7.1.37) cdc2... +2    94  0.13      1
gi|1015929           (Z54341) MAP kinase-like protein ... +2    95  0.13      1
sp|Q40531|NTF6_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE ... +2    95  0.14      1
pir||S35327          protein kinase sgg39 (EC 2.7.1.-)... +2    97  0.15      1
dbj||D89206_1        (D89206) similar to Saccharomyces... +2    95  0.15      1
sp|Q04770|CDK2_ENTHI CELL DIVISION PROTEIN KINASE 2 HO... +2    93  0.15      1
gi|1517820           (U35146) p56 KKIAMRE protein kina... +2    96  0.16      1
pir||JX0296          protein kinase (EC 2.7.1.37) cdc2... +2    94  0.16      1
sp|P43063|CC28_CANAL CELL DIVISION CONTROL PROTEIN 28 ... +2    93  0.18      1
sp|P23646|KSGM_DROME PROTEIN KINASE SHAGGY, MATERNAL (... +2    97  0.19      1
sp|Q92398|SPM1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE ... +2    94  0.21      1
sp|P38973|CC21_TRYBB CELL DIVISION CONTROL PROTEIN 2 H... +2    92  0.21      1
sp|P54664|CC21_TRYCO CELL DIVISION CONTROL PROTEIN 2 H... +2    92  0.21      1
gnl|PID|e318941      (Z95887) MAP-kinase homologue [Le... +2    93  0.21      1
gnl|PID|e330421      (Z92847) H01G02.2 [Caenorhabditis... +2    92  0.21      1
sp|Q40517|NTF3_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE ... +2    93  0.22      1
gi|757823            (X70794) serin/threonin-kinase [D... +2    95  0.22      1
gnl|PID|e280618      (Y09216) Dyrk2 [Homo sapiens]        +2    89  0.23      1
sp|P24923|CC21_MEDSA CELL DIVISION CONTROL PROTEIN 2 H... +2    91  0.25      1
gnl|PID|d1012143     (D79982) cdc2 [Asterina pectinifera] +2    91  0.26      1
gi|2589145           (D82878) p34cdc2 [Hemicentrotus p... +2    91  0.26      1
sp|Q92241|PH85_KLULA NEGATIVE REGULATOR OF THE PHO SYS... +2    91  0.27      1
gi|1280149           (U55854) similar to MAP kinases [... +2    92  0.28      1
pir||S35423          protein kinase sgg46 (EC 2.7.1.-)... +2    97  0.29      1
sp|Q63454|ERK4_RAT   EXTRACELLULAR SIGNAL-REGULATED KI... +2    90  0.29      1
pir||S36387          probable protein kinase (EC 2.7.1... +2    90  0.30      1
sp|Q00532|KKIA_HUMAN SERINE/THREONINE-PROTEIN KINASE K... +2    91  0.33      1
gi|1825660           (U88175) Similar to ser/thr-prote... +2    92  0.34      1
sp|Q39022|MPK2_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +2    91  0.35      1
pir||S22745          serine/threonine protein kinase K... +2    91  0.35      1
sp|P49657|MNB_DROME  SERINE/THREONINE PROTEIN KINASE M... +2    95  0.35      1
sp|P54119|CC2_AJECA  CELL DIVISION CONTROL PROTEIN 2 (... +2    90  0.37      1
gnl|PID|e255554      (X99513) protein kinase [Drosophi... +2    95  0.40      1
bbs|138416           Cdc2E1-4 product {P element-induc... +2    89  0.40      1
bbs|138417           Cdc2216 product {P element-induce... +2    89  0.40      1
bbs|138418           Cdc2D57 product {P element-induce... +2    89  0.40      1
bbs|138419           Cdc2E10 product {P element-induce... +2    89  0.40      1
bbs|138423           Cdc2E1-9 product {P element-induc... +2    89  0.40      1
sp|P23572|CC2_DROME  CELL DIVISION CONTROL PROTEIN 2 H... +2    89  0.40      1
pir||B54843          nemo, form II - fruit fly (Drosop... +2    91  0.42      1
gnl|PID|e353227      (Z99708) mitogen-activated protei... +2    90  0.42      1
gnl|PID|e242657      (X97640) cyclin-dependent kinase ... +2    89  0.43      1
sp|P46551|CDK2_CAEEL PUTATIVE CELL DIVISION PROTEIN KI... +2    90  0.43      1
gnl|PID|e292753      (X97317) cdc2MsF [Medicago sativa]   +2    89  0.44      1
gnl|PID|d1022330     (D85134) Bm cdc2 [Bombyx mori]       +2    89  0.44      1
pir||A54843          nemo, form I - fruit fly (Drosoph... +2    91  0.46      1
sp|Q39027|MPK7_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +2    89  0.51      1
pir||S51085          CdK-activating kinase Cdk7 - rat ... +2    88  0.52      1
sp|Q40884|MAPK_PETHY MITOGEN-ACTIVATED PROTEIN KINASE ... +2    89  0.54      1
sp|P51952|CDK7_RAT   CELL DIVISION PROTEIN KINASE 7 (C... +2    88  0.55      1
pir||S34652          cell division cycle-2-related pro... +2    88  0.57      1
sp|P50613|CDK7_HUMAN CELL DIVISION PROTEIN KINASE 7 (C... +2    88  0.57      1
sp|Q03147|CDK7_MOUSE CELL DIVISION PROTEIN KINASE 7 (C... +2    88  0.57      1
gi|1262446           (U36377) mitogen-activated protei... +2    92  0.58      1
gi|310969            (L10997) protein kinase [Trypanos... +2    88  0.58      1
sp|P00546|CC28_YEAST CELL DIVISION CONTROL PROTEIN 28 ... +2    87  0.59      1
gnl|PID|e264761      (X82646) mitogen-activated protei... +2    92  0.61      1
pir||JC5153          mitogen-activated protein kinase ... +2    92  0.61      1
sp|Q00646|CC2_EMENI  CELL DIVISION CONTROL PROTEIN 2 (... +2    87  0.64      1
sp|P54665|CC22_TRYBB CELL DIVISION CONTROL PROTEIN 2 H... +2    87  0.67      1
gnl|PID|e318801      (Y13120) serine/threonine protein... +2    87  0.68      1
gnl|PID|e325272      (Z82059) T27E9.3 [Caenorhabditis ... +2    86  0.68      1
sp|P20911|CDK7_XENLA CELL DIVISION PROTEIN KINASE 7 (4... +2    87  0.69      1
sp|P14680|YAK1_YEAST PROTEIN KINASE YAK1 >pir||A32582 ... +2    91  0.69      1
gnl|PID|e321513      (Y13493) protein kinase Dyrk2 [Ho... +2    89  0.70      1
gnl|PID|e242656      (X97639) cyclin-dependent kinas [... +2    86  0.70      1
pir||S12091          protein kinase, 40K - African cla... +2    87  0.71      1
pir||A56492          protein kinase ERK2 (EC 2.7.1.-) ... +2    87  0.71      1
sp|P31152|ERK4_HUMAN EXTRACELLULAR SIGNAL-REGULATED KI... +2    89  0.72      1
gnl|PID|e224540      (Z69885) T04C10.1 [Caenorhabditis... +2    92  0.75      2
sp|P34117|CC2H_DICDI CDC2-LIKE SERINE/THREONINE-PROTEI... +2    85  0.77      1
bbs|138420           Cdc2E1-23 product {P element-indu... +2    85  0.78      1
gnl|PID|e349043      (Z80215) C36B1.10 [Caenorhabditis... +2    86  0.81      1
sp|P34556|CC2_CAEEL  CELL DIVISION CONTROL PROTEIN 2 H... +2    85  0.83      1
bbs|160086           (S75262) p34cdc2 kinase [Caenorha... +2    85  0.83      1
gnl|PID|e284865      (Z83244) W06F12.d [Caenorhabditis... +2    86  0.88      1
dbj||D89120_1        (D89120) Saccharomyces cerevisiae... +2    85  0.90      1
gi|915406            (U29665) cdk7 gene product [Marth... +2    81  0.90      1
gnl|PID|e255553      (X99512) serine/threonine protein... +2    86  0.92      1
sp|P16892|FUS3_YEAST MITOGEN-ACTIVATED PROTEIN KINASE ... +2    84  0.92      1
gi|1336061           (U56661) cyclin-dependent kinase ... +2    84  0.92      1
sp|P50873|MRK1_YEAST SERINE/THREONINE-PROTEIN KINASE M... +2    84  0.94      1
gi|1326380           (U58751) coded for by C. elegans ... +2    86  0.95      1
gnl|PID|d1022237     (AB004534) cdc2 kinase homologue ... +2    86  0.95      1
bbs|138421           Cdc2E1-24 product {P element-indu... +2    82  0.96      1
gnl|PID|e340014      (Z98977) protein kniase [Schizosa... +2    83  0.96      1
sp|P24033|CC22_XENLA CELL DIVISION CONTROL PROTEIN 2 H... +2    82  0.97      1
sp|Q39021|MPK1_ARATH MITOGEN-ACTIVATED PROTEIN KINASE ... +2    83  0.97      1
gnl|PID|e304438      (Z81038) C25A1.14 [Caenorhabditis... +2    82  0.97      1
gnl|PID|d1022331     (D85135) cdc2-related kinase [Bom... +2    83  0.98      1
pir||S67615          MRK1 protein - yeast (Saccharomyc... +2    84  0.98      1
gi|2392814           (U62391) PFTAIRE kinase [Mus musc... +2    82  0.996     1
gnl|PID|d1020329     (D64036) protein cdc2 kinase [Ory... +2    80  0.997     1
pir||S62456          hypothetical protein SPAC2G11.01 ... +2    83  0.997     1
sp|Q02720|KC2A_DICDI CASEIN KINASE II, ALPHA CHAIN (CK... +2    80  0.999     1
sp|Q00537|KPT2_HUMAN SERINE/THREONINE-PROTEIN KINASE P... +2    82  0.9994    1
sp|P51958|CC2_CARAU  CELL DIVISION CONTROL PROTEIN 2 H... +2    79  0.9995    1
gi|1022332           (X83707) protein kinase [Plasmodi... +2    84  0.9998    1
sp|P48734|CC2_BOVIN  CELL DIVISION CONTROL PROTEIN 2 H... +2    78  0.99994   1
sp|P39951|CC2_RAT    CELL DIVISION CONTROL PROTEIN 2 H... +2    78  0.99994   1
sp|P06493|CC2_HUMAN  CELL DIVISION CONTROL PROTEIN 2 H... +2    78  0.99994   1
sp|P11440|CC2_MOUSE  CELL DIVISION CONTROL PROTEIN 2 H... +2    78  0.99994   1
gi|50360             (X16461) CDC2 kinase [Mus musculus]  +2    78  0.99994   1
gi|1575290           (U58633) p34 cdc2 kinase [Mus mus... +2    78  0.99994   1
gi|1947174           (AF000299) E03H12.8 gene product ... +3    73  0.99994   1
gi|1086650           (U41015) Similar to serine/threon... +2    83  0.99995   1
sp|P35567|CC21_XENLA CELL DIVISION CONTROL PROTEIN 2 H... +2    78  0.99995   1
prf||2005165A        cdc2 protein [Xenopus laevis]        +2    78  0.99995   1
sp|P13863|CC2_CHICK  CELL DIVISION CONTROL PROTEIN 2 H... +2    78  0.99995   1



>gi|1916549 (U50966) DJNK [Drosophila melanogaster]
            Length = 315

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 2.0e-13, P = 2.0e-13
 Identities = 36/59 (61%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEMIRG VLFPG DHIDQW K++  L    P     L  TVRNYVE  P
Sbjct:   204 VDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRP 262


>gi|1656058 (U73196) Jun-N-terminal kinase [Drosophila melanogaster]
            Length = 353

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 3.2e-13, P = 3.2e-13
 Identities = 36/59 (61%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEMIRG VLFPG DHIDQW K++  L    P     L  TVRNYVE  P
Sbjct:   204 VDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRP 262


>gi|1857041 (U49180) JNK protein kinase [Drosophila melanogaster] >gi|1857043
            (U49249) JNK protein kinase [Drosophila melanogaster]
            Length = 372

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 3.7e-13, P = 3.7e-13
 Identities = 36/59 (61%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEMIRG VLFPG DHIDQW K++  L    P     L  TVRNYVE  P
Sbjct:   204 VDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRP 262


>gi|1293853 (U57054) strong similarity to CDC2/CDC28 subfamily of SER/THR
            protein kinases [Caenorhabditis elegans]
            Length = 460

  Plus Strand HSPs:

 Score = 183 (64.4 bits), Expect = 8.2e-13, P = 8.2e-13
 Identities = 38/59 (64%), Positives = 42/59 (71%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVH--ASLAVTVRNYVEIVP 595
             VDVWS GCIFGE+IRG VLFPG DHIDQWT+++  L   PD      L  TVRNYVE  P
Sbjct:   296 VDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGT-PDRSFLERLQPTVRNYVENRP 354


>pir||S71098 protein kinase JNK1 beta1 - human >gi|1463137 (U35004) JNK1 beta1
            protein kinase [Homo sapiens]
            Length = 384

  Plus Strand HSPs:

 Score = 178 (62.7 bits), Expect = 1.9e-12, P = 1.9e-12
 Identities = 34/59 (57%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEMI+G VLFPG DHIDQW K++  L    P+    L  TVR YVE  P
Sbjct:   206 VDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRP 264


>pir||S71099 protein kinase JNK1 beta2 - human >gi|1463139 (U35005) JNK1 beta2
            protein kinase [Homo sapiens]
            Length = 427

  Plus Strand HSPs:

 Score = 178 (62.7 bits), Expect = 2.4e-12, P = 2.4e-12
 Identities = 34/59 (57%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEMI+G VLFPG DHIDQW K++  L    P+    L  TVR YVE  P
Sbjct:   206 VDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRP 264


>gi|1916547 (U50965) DJNK [Drosophila melanogaster]
            Length = 372

  Plus Strand HSPs:

 Score = 176 (62.0 bits), Expect = 2.9e-12, P = 2.9e-12
 Identities = 35/59 (59%), Positives = 38/59 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEMIRG VLFP  DHIDQW K++  L    P     L  TVRNYVE  P
Sbjct:   204 VDIWSVGCIMGEMIRGGVLFPETDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRP 262


>pir||S71103 protein kinase JNK3 alpha1 - human >gi|468151 (U07620) MAP kinase
            [Homo sapiens] >gi|1463127 (U34820) JNK3 alpha1 protein kinase
            [Homo sapiens]
            Length = 422

  Plus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 1.4e-11, P = 1.4e-11
 Identities = 32/59 (54%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+R  +LFPG D+IDQW K++  L    P+    L  TVRNYVE  P
Sbjct:   244 VDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRP 302


>gi|493211 (L27128) stress activated protein kinase [Rattus norvegicus]
           >prf||2011373C stress-activated protein kinase SAPK:SUBUNIT=beta
           [Rattus norvegicus]
           Length = 426

  Plus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 1.4e-11, P = 1.4e-11
 Identities = 32/59 (54%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+R  +LFPG D+IDQW K++  L    P+    L  TVRNYVE  P
Sbjct:   206 VDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRP 264


>pir||S43969 p54-beta stress-activated protein kinases - rat
            Length = 426

  Plus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 1.4e-11, P = 1.4e-11
 Identities = 32/59 (54%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+R  +LFPG D+IDQW K++  L    P+    L  TVRNYVE  P
Sbjct:   206 VDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRP 264


>sp|P53779|JNK3_HUMAN STRESS-ACTIVATED PROTEIN KINASE JNK3 (C-JUN N- TERMINAL
            KINASE 3) (MAP KINASE P49 3F12) >pir||S71104 protein kinase JNK3
            alpha2 - human >gi|1463125 (U34819) JNK3 alpha2 protein kinase
            [Homo sapiens]
            Length = 464

  Plus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 1.7e-11, P = 1.7e-11
 Identities = 32/59 (54%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+R  +LFPG D+IDQW K++  L    P+    L  TVRNYVE  P
Sbjct:   244 VDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRP 302


>sp|P49187|JNK3_RAT STRESS-ACTIVATED PROTEIN KINASE JNK3 (C-JUN N- TERMINAL
            KINASE 3) (SAPK-BETA) (P54-BETA)
            Length = 464

  Plus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 1.7e-11, P = 1.7e-11
 Identities = 32/59 (54%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+R  +LFPG D+IDQW K++  L    P+    L  TVRNYVE  P
Sbjct:   244 VDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRP 302


>dbj||AB001744_1 (AB001744) JNKb [Cyprinus carpio]
            Length = 427

  Plus Strand HSPs:

 Score = 166 (58.4 bits), Expect = 5.0e-11, P = 5.0e-11
 Identities = 33/59 (55%), Positives = 39/59 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VDVWS GCI  EM+RGSVLFPG+DHIDQW K++  L     +    L  +VR YVE  P
Sbjct:   206 VDVWSVGCIMAEMVRGSVLFPGSDHIDQWNKVIEQLGTPSQEFMMKLNQSVRTYVENRP 264


>gi|529434 (L35236) mitogen-activated protein kinase [Mus musculus]
           Length = 422

  Plus Strand HSPs:

 Score = 165 (58.1 bits), Expect = 6.3e-11, P = 6.3e-11
 Identities = 31/59 (52%), Positives = 38/59 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+R  +LFPG  +IDQW K++  L    P+    L  TVRNYVE  P
Sbjct:   244 VDIWSVGCIMGEMVRHKILFPGRSYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRP 302


>sp|Q61831|JNK3_MOUSE STRESS-ACTIVATED PROTEIN KINASE JNK3 (C-JUN N- TERMINAL
            KINASE 3) (MAP KINASE P49 3F12)
            Length = 464

  Plus Strand HSPs:

 Score = 165 (58.1 bits), Expect = 7.6e-11, P = 7.6e-11
 Identities = 31/59 (52%), Positives = 38/59 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+R  +LFPG  +IDQW K++  L    P+    L  TVRNYVE  P
Sbjct:   244 VDIWSVGCIMGEMVRHKILFPGRSYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRP 302


>pir||S71100 proteine kinase JNK2 alpha1 - human >gi|1463129 (U34821) JNK2
            alpha1 protein kinase [Homo sapiens]
            Length = 382

  Plus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 1.4e-10, P = 1.4e-10
 Identities = 31/62 (50%), Positives = 40/62 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI GE+++G V+F G DHIDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>gnl|PID|d1019937 (AB000807) c-JUN amino-terminal kinase-2 alpha1 [Gallus
            gallus]
            Length = 382

  Plus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 1.4e-10, P = 1.4e-10
 Identities = 31/62 (50%), Positives = 40/62 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI GE+++G V+F G DHIDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>sp|P49186|JNK2_RAT STRESS-ACTIVATED PROTEIN KINASE JNK2 (C-JUN N-TERMINAL
            KINASE 2) (SAPK-ALPHA) (P54-ALPHA) >gi|493209 (L27112) stress
            activated protein kinase [Rattus norvegicus] >prf||2011373B
            stress-activated protein kinase SAPK:SUBUNIT=alpha II [Rattus
            norvegicus]
            Length = 423

  Plus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 1.7e-10, P = 1.7e-10
 Identities = 31/62 (50%), Positives = 40/62 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI GE+++G V+F G DHIDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>sp|P45984|JNK2_HUMAN STRESS-ACTIVATED PROTEIN KINASE JNK2 (C-JUN N-TERMINAL
            KINASE 2) (JNK-55) >pir||A56358 protein kinase JNK2 - human
            >gi|598183 (L31951) protein kinase [Homo sapiens]
            Length = 424

  Plus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 1.7e-10, P = 1.7e-10
 Identities = 31/62 (50%), Positives = 40/62 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI GE+++G V+F G DHIDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>pir||A55480 c-Jun amino-terminal kinase JNK2, 55k - human >gi|607786 (U09759)
            protein kinase [Homo sapiens]
            Length = 424

  Plus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 1.7e-10, P = 1.7e-10
 Identities = 31/62 (50%), Positives = 40/62 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI GE+++G V+F G DHIDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>pir||A53063 protein kinase JNK1 - human >gi|474901 (L26318) protein kinase
            [Homo sapiens] >prf||2016534A protein kinase Jnk1 [Homo sapiens]
            Length = 384

  Plus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 6.3e-10, P = 6.3e-10
 Identities = 30/59 (50%), Positives = 37/59 (62%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+   +LFPG D+IDQW K++  L    P+    L  TVR YVE  P
Sbjct:   206 VDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRP 264


>sp|P45983|JNK1_HUMAN STRESS-ACTIVATED PROTEIN KINASE JNK1 (C-JUN N-TERMINAL
            KINASE 1) (JNK-46) >pir||S71097 protein kinase JNK1 alpha2 - human
            >gi|1463131 (U34822) JNK1 alpha2 protein kinase [Homo sapiens]
            Length = 427

  Plus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 7.8e-10, P = 7.8e-10
 Identities = 30/59 (50%), Positives = 37/59 (62%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+   +LFPG D+IDQW K++  L    P+    L  TVR YVE  P
Sbjct:   206 VDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRP 264


>sp|P49185|JNK1_RAT STRESS-ACTIVATED PROTEIN KINASE JNK1 (C-JUN N-TERMINAL
            KINASE 1) (SAPK GAMMA) (P54 GAMMA) >gi|493213 (L27129) stress
            activated protein kinase [Rattus norvegicus] >prf||2011373D
            stress-activated protein kinase SAPK:SUBUNIT=gamma [Rattus
            norvegicus]
            Length = 411

  Plus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 1.2e-09, P = 1.2e-09
 Identities = 30/59 (50%), Positives = 37/59 (62%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+   +LFPG D+IDQW K++  L    P+    L  TVR YVE  P
Sbjct:   206 VDLWSVGCIMGEMVCLKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRP 264


>pir||S43970 p54-gamma stress-activated protein kinases - rat
            Length = 411

  Plus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 1.2e-09, P = 1.2e-09
 Identities = 30/59 (50%), Positives = 37/59 (62%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI GEM+   +LFPG D+IDQW K++  L    P+    L  TVR YVE  P
Sbjct:   206 VDLWSVGCIMGEMVCLKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRP 264


>pir||S71101 protein kinase JNK2 beta1 - human >gi|1463133 (U35002) JNK2 beta1
            protein kinase [Homo sapiens]
            Length = 382

  Plus Strand HSPs:

 Score = 151 (53.2 bits), Expect = 1.7e-09, P = 1.7e-09
 Identities = 31/62 (50%), Positives = 38/62 (61%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI  EM+   VLFPG D+IDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>pir||S43967 p54-alpha stress-activated protein kinases - rat
            Length = 423

  Plus Strand HSPs:

 Score = 151 (53.2 bits), Expect = 2.1e-09, P = 2.1e-09
 Identities = 31/62 (50%), Positives = 38/62 (61%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI  EM+   VLFPG D+IDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>pir||S73317 protein kinase JNK2 beta2 - human >gi|1463135 (U35003) JNK2 beta2
            protein kinase [Homo sapiens]
            Length = 424

  Plus Strand HSPs:

 Score = 151 (53.2 bits), Expect = 2.1e-09, P = 2.1e-09
 Identities = 31/62 (50%), Positives = 38/62 (61%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI  EM+   VLFPG D+IDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>dbj||D83273_1 (D83273) JNKa [Cyprinus carpio]
            Length = 427

  Plus Strand HSPs:

 Score = 146 (51.4 bits), Expect = 3.7e-08, P = 3.7e-08
 Identities = 28/59 (47%), Positives = 36/59 (61%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP 595
             VD+WS GCI  EM+R  +LFPG D+IDQW K++  L     +    L  +VR YVE  P
Sbjct:   206 VDIWSVGCILAEMVRHKILFPGRDYIDQWNKVIEQLGTPTQEFMMKLNQSVRTYVENRP 264


>gi|1326389 (U58752) strong similarity to CDC2/CDC28 subfamily of ser/thr
            protein kinases [Caenorhabditis elegans]
            Length = 377

  Plus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 6.5e-07, P = 6.5e-07
 Identities = 28/60 (46%), Positives = 38/60 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT---VRNYVEIV 592
             VDVWS GCI  E+I G  LFPG+DHIDQ T+++ S+   PD      ++    RNY+  +
Sbjct:   215 VDVWSVGCILAELITGKTLFPGSDHIDQLTRIM-SVTGTPDEEFLKKISSEEARNYIRNL 273

Query:   593 P 595
             P
Sbjct:   274 P 274


>sp|P47812|MP38_XENLA MITOGEN-ACTIVATED PROTEIN KINASE 2 (MAP KINASE 2) (MPK2)
            >pir||A54805 protein kinase Mpk2 (EC 2.7.1.-) - African clawed frog
            >gi|557680 (X80751) MAP kinase [Xenopus laevis]
            Length = 361

  Plus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 27/61 (44%), Positives = 38/61 (62%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT---VRNYVEIV 592
             VD+WS GCI  E++ G  LFPG DHIDQ  KL+  LV  P+      ++    RNY++ +
Sbjct:   205 VDIWSVGCIMAELLTGRTLFPGTDHIDQ-LKLILRLVGTPEPELLQKISSEAARNYIQSL 263

Query:   593 PF 598
             P+
Sbjct:   264 PY 265


>gi|493207 (L27111) stress activated protein kinase [Rattus norvegicus]
           >prf||2011373A stress-activated protein kinase SAPK:SUBUNIT=alpha I
           [Rattus norvegicus]
           Length = 423

  Plus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 5.8e-06, P = 5.8e-06
 Identities = 28/62 (45%), Positives = 35/62 (56%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEIVP- 595
             VD+WS GCI  EM+      PG D+IDQW K++  L     +    L  TVRNYVE  P 
Sbjct:   206 VDIWSVGCIMAEMVLHKSCSPGRDYIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPK 265

Query:   596 FP 601
             +P
Sbjct:   266 YP 267


>gi|1326388 (U58752) similar to the CDC2/CDC28 subfamily of ser/thr protein
            kinases [Caenorhabditis elegans]
            Length = 283

  Plus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 6.2e-06, P = 6.2e-06
 Identities = 27/57 (47%), Positives = 39/57 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP--DVHASL-AVTVRNYVE 586
             VDVWS GCI  E++ G  LFPG+DHIDQ TK++ S+V  P  +  + + +   RNY++
Sbjct:   110 VDVWSVGCILAELVSGRPLFPGDDHIDQLTKIM-SVVGTPKEEFWSKIQSEEARNYIK 166


>sp|Q09892|STY1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE STY1 (MAP KINASE STY1)
            >pir||S57930 MAP kinase - fission yeast (Schizosaccharomyces pombe)
            >pir||S62551 STY1 protein - fission yeast (Schizosaccharomyces
            pombe) >bbs|175803 Phh1p=Hog1-like MAP kinase [Schizosaccharomyces
            pombe=fission yeast, L972, Peptide, 349 aa] >gi|897810 (X89262) MAP
            kinase [Schizosaccharomyces pombe] >gi|1022685 (U26739) Spc1p
            [Schizosaccharomyces pombe] >gi|1061294 (Z67757) Sty1p
            [Schizosaccharomyces pombe]
            Length = 349

  Plus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 7.2e-06, P = 7.2e-06
 Identities = 24/59 (40%), Positives = 36/59 (61%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIV 592
             V VD+WS GCIF EMI G  LFPG DH++Q++ ++  L+  P +     +  +N +  V
Sbjct:   193 VEVDIWSAGCIFAEMIEGKPLFPGRDHVNQFS-IITELLGTPPMEVIETICSKNTLRFV 250


>pir||S68680 stress-activated protein kinase 3 - rat >gnl|PID|e229676 (X96488)
            SAP kinase-3 [Rattus norvegicus] >prf||2209285A SAP kinase 3
            [Rattus norvegicus]
            Length = 367

  Plus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 1.5e-05, P = 1.5e-05
 Identities = 25/60 (41%), Positives = 35/60 (58%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD--VHASLAVTVRNYVEIVP 595
             VD+WS GCI  EMI G +LF GNDH+DQ  +++      P   V    +   +NY+E +P
Sbjct:   207 VDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKVTGTPPPEFVQKLQSAEAKNYMEGLP 266


>gnl|PID|e320986 (Y13439) stress-activated protein kinase-3 [Mus musculus]
            Length = 367

  Plus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 1.5e-05, P = 1.5e-05
 Identities = 25/60 (41%), Positives = 35/60 (58%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD--VHASLAVTVRNYVEIVP 595
             VD+WS GCI  EMI G +LF GNDH+DQ  +++      P   V    +   +NY+E +P
Sbjct:   207 VDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKITGTPPPEFVQKLQSAEAKNYMEGLP 266


>gi|1136798 (U19775) Mxi2 [Homo sapiens] >prf||2124426A Mxi2 protein [Homo
            sapiens]
            Length = 297

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 26/57 (45%), Positives = 34/57 (59%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT---VRNYVE 586
             VD+WS GCI  E++ G  LFPG DHIDQ  KL+  LV  P       ++    RNY++
Sbjct:   204 VDIWSVGCIMAELLTGRTLFPGTDHIDQ-LKLILRLVGTPGAELLKKISSESARNYIQ 260


>gi|2196780 (AF003597) p38 mitogen activated protein kinase [Canis familiaris]
            Length = 360

  Plus Strand HSPs:

 Score = 127 (44.7 bits), Expect = 1.9e-05, P = 1.9e-05
 Identities = 27/57 (47%), Positives = 37/57 (64%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP--DVHASLAV-TVRNYVE 586
             VD+WS GCI  E++ G  LFPG DHIDQ  KL+  LV  P  D+   ++  + RNY++
Sbjct:   204 VDIWSVGCIMAELLTGRTLFPGTDHIDQ-LKLILRLVGTPGADLLKKISSESARNYIQ 260


>sp|Q16539|MP38_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE P38 (MAP KINASE P38)
            (CYTOKINE SUPPRESSIVE ANTI-INFLAMMATORY DRUG BINDING PROTEIN)
            (CSAID BINDING PROTEIN) (CSBP) (MAX-INTERACTING PROTEIN 2) (MAP
            KINASE MXI2) >pir||S53536 p38 MAP kinase - human >gi|529040
            (L35253) MAP kinase [Homo sapiens] >gi|603919 (L35264) CSaids
            binding protein [Homo sapiens] >prf||2111247A p38 mitogen-activated
            protein kinase [Homo sapiens]
            Length = 360

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.6e-05, P = 2.6e-05
 Identities = 26/57 (45%), Positives = 34/57 (59%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT---VRNYVE 586
             VD+WS GCI  E++ G  LFPG DHIDQ  KL+  LV  P       ++    RNY++
Sbjct:   204 VDIWSVGCIMAELLTGRTLFPGTDHIDQ-LKLILRLVGTPGAELLKKISSESARNYIQ 260


>sp|P70618|MP38_RAT MITOGEN-ACTIVATED PROTEIN KINASE P38 (MAP KINASE P38)
            >gi|1621647 (U73142) p38 mitogen activated protein kinase [Rattus
            norvegicus]
            Length = 360

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.6e-05, P = 2.6e-05
 Identities = 26/57 (45%), Positives = 34/57 (59%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT---VRNYVE 586
             VD+WS GCI  E++ G  LFPG DHIDQ  KL+  LV  P       ++    RNY++
Sbjct:   204 VDIWSVGCIMAELLTGRTLFPGTDHIDQ-LKLILRLVGTPGAELLKKISSESARNYIQ 260


>gi|1916984 (U91847) p38 mitogen activated protein kinase [Rattus norvegicus]
            Length = 360

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.6e-05, P = 2.6e-05
 Identities = 26/57 (45%), Positives = 34/57 (59%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT---VRNYVE 586
             VD+WS GCI  E++ G  LFPG DHIDQ  KL+  LV  P       ++    RNY++
Sbjct:   204 VDIWSVGCIMAELLTGRTLFPGTDHIDQ-LKLILRLVGTPGAELLKKISSESARNYIQ 260


>gi|2072361 (AF001008) p38Beta2 MAP Kinase [Homo sapiens] >gi|2232138
            (AF001174) p38beta2 MAP kinase [Homo sapiens] >gnl|PID|e332879
            (Y14440) stress activated protein kinase-2b [Homo sapiens]
            Length = 364

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.6e-05, P = 2.6e-05
 Identities = 23/60 (38%), Positives = 39/60 (65%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVT-VRNYVEIVP 595
             VD+WS GCI  E+++G  LFPG+D+IDQ  +++  +    P+V A ++    R Y++ +P
Sbjct:   204 VDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLP 263


>gi|2316012 (U92268) mitogen activated protein kinase p38-2 [Homo sapiens]
            Length = 364

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.6e-05, P = 2.6e-05
 Identities = 23/60 (38%), Positives = 39/60 (65%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVT-VRNYVEIVP 595
             VD+WS GCI  E+++G  LFPG+D+IDQ  +++  +    P+V A ++    R Y++ +P
Sbjct:   204 VDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLP 263


>pdb|1WFC|  Structure Of Apo, Unphosphorylated, P38 Mitogen Activated Protein
            Kinase P38 (P38 Map Kinase) The Mammalian Homologue Of The Yeast
            Hog1 Protein P38 Map Kinase, SerineTHREONINE PROTEIN KINASE,
            TRANSFERASE Mol_id: 1; Molecule: Mitog...
            Length = 366

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.7e-05, P = 2.7e-05
 Identities = 26/57 (45%), Positives = 34/57 (59%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT---VRNYVE 586
             VD+WS GCI  E++ G  LFPG DHIDQ  KL+  LV  P       ++    RNY++
Sbjct:   210 VDIWSVGCIMAELLTGRTLFPGTDHIDQ-LKLILRLVGTPGAELLKKISSESARNYIQ 266


>sp|Q15759|M38B_HUMAN MITOGEN-ACTIVATED PROTEIN KINASE P38 BETA (MAP KINASE P38
            BETA) >gi|1469306 (U53442) p38B MAP kinase [Homo sapiens]
            Length = 372

  Plus Strand HSPs:

 Score = 126 (44.4 bits), Expect = 2.8e-05, P = 2.8e-05
 Identities = 23/60 (38%), Positives = 39/60 (65%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVT-VRNYVEIVP 595
             VD+WS GCI  E+++G  LFPG+D+IDQ  +++  +    P+V A ++    R Y++ +P
Sbjct:   212 VDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLP 271


>pir||S47430 protein kinase (EC 2.7.1.37) cdc2 - Sitka spruce (fragment)
            >gi|530757 (X80846) cdc2Ps gene product [Picea sitchensis]
            >gi|758205 (X77681) cdc2Pa [Picea abies]
            Length = 105

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 7.4e-05, P = 7.4e-05
 Identities = 19/36 (52%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:    54 VDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVL 89


>gi|1279911 (U52963) mitogen-activated protein kinase [Nectria haematococca
            var. brevicona]
            Length = 355

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 8.0e-05, P = 8.0e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             A+DVWS GCI  EM+ G  LFPG D+  Q T +L+ L    + D +   +   R Y+  +
Sbjct:   206 AIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSL 265

Query:   593 PF 598
             PF
Sbjct:   266 PF 267


>gi|1666813 (U70134) pathogenicity MAP kinase 1; Pmk1; MAP kinase homolog
            [Magnaporthe grisea]
            Length = 356

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 8.0e-05, P = 8.0e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             A+DVWS GCI  EM+ G  LFPG D+  Q T +L+ L    + D +   +   R Y+  +
Sbjct:   207 AIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSL 266

Query:   593 PF 598
             PF
Sbjct:   267 PF 268


>sp|P27638|SPK1_SCHPO MITOGEN-ACTIVATED PROTEIN KINASE SPK1 (MAP KINASE SPK1)
            (MAPK) >pir||S15663 protein kinase - fission yeast
            (Schizosaccharomyces pombe) >gi|5092 (X57334) protein kinase
            [Schizosaccharomyces pombe] >gnl|PID|d1007107 (D31735) Protein
            Kinase [Schizosaccharomyces pombe] >gnl|PID|e340020 (Z98979)
            mitogen-activated protein kinase [Schizosaccharomyces pombe]
            Length = 372

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 8.7e-05, P = 8.7e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             A+D+WSTGCI  EM+    LFPG D+  Q T +LN L    + D     +   R Y++ +
Sbjct:   222 AIDLWSTGCILAEMLSARPLFPGKDYHSQITLILNILGTPTMDDFSRIKSARARKYIKSL 281

Query:   593 PF 598
             PF
Sbjct:   282 PF 283


>gi|295611 (L06279) HOG1 protein [Saccharomyces cerevisiae]
           Length = 416

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 0.00011, P = 0.00011
 Identities = 24/40 (60%), Positives = 27/40 (67%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQW---TKLLNS 526
             V VD+WS GCIF EMI G  LFPG DH+ Q+   T LL S
Sbjct:   196 VEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGS 235


>gi|1256876 (U53878) Hog1p: Mitogen-activated and osmosensing protein kinase
            [Saccharomyces cerevisiae]
            Length = 435

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 0.00011, P = 0.00011
 Identities = 24/40 (60%), Positives = 27/40 (67%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQW---TKLLNS 526
             V VD+WS GCIF EMI G  LFPG DH+ Q+   T LL S
Sbjct:   196 VEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGS 235


>sp|P32485|HOG1_YEAST MITOGEN-ACTIVATED PROTEIN KINASE HOG1 (MAP KINASE HOG1)
            (OSMOSENSING PROTEIN HOG1) >pir||S64950 protein kinase HOG1 (EC
            2.7.1.-), mitogen-activated - yeast (Saccharomyces cerevisiae)
            >gnl|PID|e198746 (X89514) mitogen-activated protein kinase
            [Saccharomyces cerevisiae] >gnl|PID|e245558 (Z73285) ORF YLR113w
            [Saccharomyces cerevisiae]
            Length = 435

  Plus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 0.00011, P = 0.00011
 Identities = 24/40 (60%), Positives = 27/40 (67%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQW---TKLLNS 526
             V VD+WS GCIF EMI G  LFPG DH+ Q+   T LL S
Sbjct:   196 VEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGS 235


>pir||S43968 p54-alpha-2 stress-activated protein kinases - rat
            Length = 423

  Plus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00019, P = 0.00019
 Identities = 28/62 (45%), Positives = 37/62 (59%), Frame = +2

Query:   422 VDVWSTGCIF---GEMIRGSVLFPGNDHIDQWTKLLNSL-VLLPDVHASLAVTVRNYVEI 589
             VD+WS GCI    GE+++G V+F G DH   W K++  L     +    L  TVRNYVE 
Sbjct:   206 VDIWSVGCIMAEMGELVKGCVIFQGTDH---WNKVIEQLGTPSAEFMKKLQPTVRNYVEN 262

Query:   590 VP-FP 601
              P +P
Sbjct:   263 RPKYP 267


>sp|P40417|ERKA_DROME MITOGEN-ACTIVATED PROTEIN KINASE ERK-A
            (EXTRACELLULAR-REGULATED KINASE A) (ROLLED PROTEIN) >pir||A46036
            extracellular signal-regulated kinase, DmERK-A - fruit fly
            (Drosophila melanogaster) >gi|485755 (M95124) MAP kinase
            [Drosophila melanogaster]
            Length = 376

  Plus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 0.00028, P = 0.00028
 Identities = 24/68 (35%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D+   +    RNY+E +
Sbjct:   221 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESL 280

Query:   593 PF----PW 604
             PF    PW
Sbjct:   281 PFKPNVPW 288


>sp|Q40353|MMK2_MEDSA MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG MMK2 >gi|1204129
            (X82268) protein kinase [Medicago sativa]
            Length = 371

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00036, P = 0.00036
 Identities = 27/64 (42%), Positives = 38/64 (59%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAV----TVRNYVE 586
             A+D+WS GCI GE++    LFPG D++ Q  +L+  L+  PD  ASL        R YV 
Sbjct:   218 AIDIWSVGCILGEIVTRQPLFPGRDYVHQ-LRLVTELIGSPD-DASLGFLRSENARRYVR 275

Query:   587 IVP-FP 601
              +P +P
Sbjct:   276 QLPQYP 281


>gnl|PID|e122949 (X82270) protein kinase [Medicago sativa]
            Length = 371

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00036, P = 0.00036
 Identities = 27/64 (42%), Positives = 36/64 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP-DVHASLAVT--VRNYVEI 589
             A+DVWS GCIF E++    LFPG DH+ Q  +LL  L+  P D    L      R Y+  
Sbjct:   220 AIDVWSVGCIFMELMNKKPLFPGKDHVHQM-RLLTELLGTPTDADVGLVKNDDARRYIRQ 278

Query:   590 VP-FP 601
             +P +P
Sbjct:   279 LPQYP 283


>pir||S60121 mitogen-activated protein kinase MMK2 (EC 2.7.1.-) - alfalfa
            Length = 371

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00036, P = 0.00036
 Identities = 27/64 (42%), Positives = 38/64 (59%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAV----TVRNYVE 586
             A+D+WS GCI GE++    LFPG D++ Q  +L+  L+  PD  ASL        R YV 
Sbjct:   218 AIDIWSVGCILGEIVTRQPLFPGRDYVHQ-LRLVTELIGSPD-DASLGFLRSENARRYVR 275

Query:   587 IVP-FP 601
              +P +P
Sbjct:   276 QLPQYP 281


>pir||A37871 protein kinase (EC 2.7.1.37) cdk2 - African clawed frog
            Length = 297

  Plus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00042, P = 0.00042
 Identities = 25/62 (40%), Positives = 33/62 (53%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             AVD+WS GCIF EMI    LFPG+  IDQ  ++  +L    +V      T+ +Y    P 
Sbjct:   183 AVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTFP- 241

Query:   599 PW 604
              W
Sbjct:   242 KW 243


>sp|P23437|CDK2_XENLA CELL DIVISION PROTEIN KINASE 2 (CDC2 HOMOLOG EG1 PROTEIN
            KINASE) >gi|64666 (X14227) highly homologous to cdc2
            (serine-threonine kinase) [Xenopus laevis]
            Length = 297

  Plus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00042, P = 0.00042
 Identities = 25/62 (40%), Positives = 33/62 (53%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             AVD+WS GCIF EMI    LFPG+  IDQ  ++  +L    +V      T+ +Y    P 
Sbjct:   183 AVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTFP- 241

Query:   599 PW 604
              W
Sbjct:   242 KW 243


>gi|507166 (U04819) PITSLRE beta 1 [Homo sapiens]
           Length = 439

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.00062, P = 0.00062
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   262 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 298


>sp|Q39023|MPK3_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 3 (MAP KINASE 3)
            (ATMPK3) >pir||S40469 mitogen-activated protein kinase 3 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005401 (D21839) MAP
            kinase [Arabidopsis thaliana]
            Length = 370

  Plus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00063, P = 0.00063
 Identities = 27/64 (42%), Positives = 37/64 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT----VRNYVE 586
             A+DVWS GCIF E++    LFPG DH+ Q  +LL  L+  P   + L  T     + Y+ 
Sbjct:   219 AIDVWSVGCIFMELMNRKPLFPGKDHVHQM-RLLTELLGTP-TESDLGFTHNEDAKRYIR 276

Query:   587 IVP-FP 601
              +P FP
Sbjct:   277 QLPNFP 282


>sp|Q39025|MPK5_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 5 (MAP KINASE 5)
            (ATMPK5) >pir||S40471 mitogen-activated protein kinase 5 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005403 (D21841) MAP
            kinase [Arabidopsis thaliana]
            Length = 376

  Plus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00065, P = 0.00065
 Identities = 29/64 (45%), Positives = 39/64 (60%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASL----AVTVRNYVE 586
             A+DVWS GCIF E++    LFPG D++ Q  KL+  L+  PD  ASL    +     YV+
Sbjct:   224 AIDVWSVGCIFAEIMTREPLFPGKDYVHQ-LKLITELIGSPD-GASLEFLRSANGGKYVK 281

Query:   587 IVP-FP 601
              +P FP
Sbjct:   282 ELPKFP 287


>gnl|PID|e259403 (Y07597) shaggy-like kinase kappa [Arabidopsis thaliana]
            Length = 375

  Plus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.00085, P = 0.00085
 Identities = 24/65 (36%), Positives = 34/65 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVE---- 586
             A+D+WSTGC+  E++ G  LFPG   +DQ  +++   VL       +     NY E    
Sbjct:   218 AIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKCMNGNYTEFKFP 275

Query:   587 -IVPFPW 604
              I P PW
Sbjct:   276 QIKPHPW 282


>sp|P04551|CC2_SCHPO CELL DIVISION CONTROL PROTEIN 2 (P34 PROTEIN KINASE)
            >pir||TVZP2 protein kinase (EC 2.7.1.37) cdc2 - fission yeast
            (Schizosaccharomyces pombe) >gi|173359 (M12912) CDC2 protein kinase
            [Schizosaccharomyces pombe] >gnl|PID|d1022225 (AB004534) CELL
            DIVISION CONTROL PROTEIN 2 [Schizosaccharomyces pombe]
            >prf||1101270A protein CDC2 [Schizosaccharomyces pombe]
            Length = 297

  Plus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.00097, P = 0.00096
 Identities = 21/36 (58%), Positives = 25/36 (69%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VD+WS GCIF EMIR S LFPG+  ID+  K+   L
Sbjct:   191 VDIWSVGCIFAEMIRRSPLFPGDSEIDEIFKIFQVL 226


>gi|1110512 (U40484) MAP kinase [Aplysia californica]
            Length = 351

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.00099, P = 0.00099
 Identities = 24/68 (35%), Positives = 35/68 (51%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++DVWS GCI  EM+    LFPG  ++DQ   +L  L      D+   +    R Y++ +
Sbjct:   197 SIDVWSVGCILAEMLANRPLFPGKHYLDQLNHILGVLGSPSQEDLQCIINDKARGYIQSL 256

Query:   593 PF----PW 604
             PF    PW
Sbjct:   257 PFKPKVPW 264


>pir||S51938 protein kinase homolog - Arabidopsis thaliana >gi|717180 (X79279)
            protein kinase homologous to shaggy and glycogen synthase kinase-3
            [Arabidopsis thaliana]
            Length = 421

  Plus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.0010, P = 0.0010
 Identities = 24/65 (36%), Positives = 34/65 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVE---- 586
             A+D+WSTGC+  E++ G  LFPG   +DQ  +++   VL       +     NY E    
Sbjct:   264 AIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKCMNGNYTEFKFP 321

Query:   587 -IVPFPW 604
              I P PW
Sbjct:   322 QIKPHPW 328


>gnl|PID|d1020522 (D83073) p38b [Mus musculus]
            Length = 360

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0010, P = 0.0010
 Identities = 21/57 (36%), Positives = 33/57 (57%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD--VHASLAVTVRNYVE 586
             VD+WS GCI  E++ G  LFPG DHI+Q  +++      P   ++   +   RNY++
Sbjct:   204 VDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRMTGTPPAYLINRMPSHEARNYIQ 260


>sp|Q92207|HOG1_CANAL MITOGEN-ACTIVATED PROTEIN KINASE HOG1 (MAP KINASE HOG1)
            >gnl|PID|e195326 (X90586) unnamed protein product [Candida
            albicans]
            Length = 377

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0011, P = 0.0011
 Identities = 22/38 (57%), Positives = 26/38 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQW---TKLLNS 526
             VD+WS GCI  EMI G  LFPG DH+ Q+   T+LL S
Sbjct:   198 VDLWSVGCILAEMIEGKPLFPGKDHVHQFSIITELLGS 235


>gi|2160191 (AC000132) Identical to A. thaliana AtK-1 (gb|X79279). [Arabidopsis
            thaliana]
            Length = 447

  Plus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.0011, P = 0.0011
 Identities = 24/65 (36%), Positives = 34/65 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVE---- 586
             A+D+WSTGC+  E++ G  LFPG   +DQ  +++   VL       +     NY E    
Sbjct:   290 AIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKCMNPNYTEFKFP 347

Query:   587 -IVPFPW 604
              I P PW
Sbjct:   348 QIKPHPW 354


>sp|Q39026|MPK6_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 6 (MAP KINASE 6)
            (ATMPK6) >pir||S40472 mitogen-activated protein kinase 6 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005404 (D21842) MAP
            kinase [Arabidopsis thaliana] >gi|2281091 (AC002333) MAP Kinase 6
            [Arabidopsis thaliana]
            Length = 395

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0012, P = 0.0012
 Identities = 25/63 (39%), Positives = 36/63 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHAS--LAVTVRNYV-EI 589
             A+DVWS GCIF E++    LFPG DH+ Q  +LL  L+  P       L    + Y+ ++
Sbjct:   244 AIDVWSVGCIFMELMDRKPLFPGRDHVHQ-LRLLMELIGTPSEEELEFLNENAKRYIRQL 302

Query:   590 VPFP 601
              P+P
Sbjct:   303 PPYP 306


>sp|P43450|CDK2_CARAU CELL DIVISION PROTEIN KINASE 2 >pir||A44878 protein
            kinase (EC 2.7.1.37) cdk2 - goldfish >bbs|108783 (S40289) cell
            division kinase, cyclin-dependent kinase, cdk2=cell cycle regulator
            cdc2 homolog [goldfish, oocytes, Peptide, 298 aa] [Carassius
            auratus]
            Length = 298

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0013, P = 0.0013
 Identities = 20/37 (54%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EMI    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMITRKALFPGDSEIDQLFRIFRTL 219


>gnl|PID|e333558 (AJ001085) putative 34kDa cdc2-related protein kinase
            [Toxoplasma gondii]
            Length = 300

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0013, P = 0.0013
 Identities = 27/64 (42%), Positives = 34/64 (53%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDV--HASLAVTV---RNYVE 586
             VD+WS GCIF EM+ G  LFPG  + DQ  K+   L   P V  H  LA      R++ +
Sbjct:   182 VDIWSVGCIFAEMVNGRPLFPGTGNEDQLMKIFKVLGT-PQVSEHPQLAELPHWNRDFPQ 240

Query:   587 IVPFP 601
               P P
Sbjct:   241 FPPLP 245


>pir||G54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE beta 2-2 - human
            Length = 766

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0013, P = 0.0013
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   589 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 625


>pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-3 -
            human
            Length = 768

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0014, P = 0.0013
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   591 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 627


>gi|507429 (U07705) PITSLRE isoform PBETA22 [Homo sapiens]
           Length = 775

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0014, P = 0.0014
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   598 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 634


>gi|507427 (U07704) PITSLRE isoform PBETA21 [Homo sapiens]
           Length = 777

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0014, P = 0.0014
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   600 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 636


>pir||B54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-2 -
            human
            Length = 777

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0014, P = 0.0014
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   600 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 636


>pir||F54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE beta 2-1 - human
            Length = 777

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0014, P = 0.0014
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   600 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 636


>pir||E54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-1 -
            human
            Length = 779

  Plus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0014, P = 0.0014
 Identities = 21/37 (56%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPGN  IDQ  K+   L
Sbjct:   602 AVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKEL 638


>sp|P53778|ERK6_HUMAN EXTRACELLULAR SIGNAL-REGULATED KINASE 6 (ERK6) (ERK5)
            >gnl|PID|e257805 (X79483) extracellular signal regulated kinase
            [Homo sapiens]
            Length = 367

  Plus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.0014, P = 0.0014
 Identities = 23/60 (38%), Positives = 34/60 (56%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD--VHASLAVTVRNYVEIVP 595
             VD+WS GCI  EMI G  LF G+DH+DQ  +++      P   V    +   +NY++ +P
Sbjct:   207 VDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLP 266


>gnl|PID|e291136 (Y10487) stress-activated protein kinase-3 [Homo sapiens]
            Length = 367

  Plus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.0014, P = 0.0014
 Identities = 23/60 (38%), Positives = 34/60 (56%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD--VHASLAVTVRNYVEIVP 595
             VD+WS GCI  EMI G  LF G+DH+DQ  +++      P   V    +   +NY++ +P
Sbjct:   207 VDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLP 266


>sp||ERK1_MOUSE_2 [Segment 2 of 2] EXTRACELLULAR SIGNAL-REGULATED KINASE 1
            (ERK1) (INSULIN-STIMULATED MAP2 KINASE) (MAP KINASE 1) (MAPK 1)
            (P44-ERK1) (ERT2) (P44-MAPK) (MICROTUBULE-ASSOCIATED PROTEIN-2
            KINASE) (MNK1)
            Length = 304

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0017, P = 0.0017
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   150 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 209

Query:   593 P 595
             P
Sbjct:   210 P 210


>gi|2191146 (AF007269) MAP Kinase [Arabidopsis thaliana]
            Length = 354

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0018, P = 0.0018
 Identities = 26/64 (40%), Positives = 37/64 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAV----TVRNYVE 586
             A+D+WS GCI GE +    LFPG D++ Q  +L+  L+  PD  +SL        R YV 
Sbjct:   202 AIDIWSVGCILGETMTREPLFPGKDYVHQ-LRLITELIGSPD-DSSLGFLRSDNARRYVR 259

Query:   587 IVP-FP 601
              +P +P
Sbjct:   260 QLPQYP 265


>gi|1669368 (AC000065) human CDK6 [Homo sapiens]
            Length = 147

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.0018, P = 0.0018
 Identities = 20/40 (50%), Positives = 27/40 (67%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP 541
             VD+WS GCIF EM R   LF G+  +DQ  K+L+ ++ LP
Sbjct:    21 VDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILD-VIGLP 59


>pir||A47211 protein kinase ERK (EC 2.7.1.-) CEK1 - yeast (Candida albicans)
            (fragment)
            Length = 362

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0018, P = 0.0018
 Identities = 23/62 (37%), Positives = 34/62 (54%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVL--LPDVHASLAVTVRNYVEIV 592
             A+DVWS GCI  EM+ G  LFPG D+ +Q   ++  L    + D +   +   R Y+  +
Sbjct:   196 AIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVLGTPNMEDYYNIKSKRAREYIRSL 255

Query:   593 PF 598
             PF
Sbjct:   256 PF 257


>gnl|PID|e354277 (Y15075) stress-activated protein kinase-3 [Danio rerio]
            Length = 363

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0018, P = 0.0018
 Identities = 25/60 (41%), Positives = 36/60 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP--DVHASL-AVTVRNYVEIV 592
             VD+WS GCI  EM+ G  LF G+DH+DQ  +++  +   P  +  A L +   RNYV  +
Sbjct:   205 VDIWSVGCIMAEMLLGKPLFKGHDHLDQLMEIMK-VTGTPSKEFTAKLQSEDARNYVTKL 263

Query:   593 P 595
             P
Sbjct:   264 P 264


>gi|1772646 (U66243) p38gamma MAP Kinase [Homo sapiens]
            Length = 367

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0019, P = 0.0019
 Identities = 18/33 (54%), Positives = 24/33 (72%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLL 520
             VD+WS GCI  EMI G  LF G+DH+DQ  +++
Sbjct:   207 VDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIM 239


>pir||S56638 mitogen-activated protein kinase 1 homolog (clone Aspk9) - oat
            >gi|871984 (X79993) MAP KINASE [Avena sativa]
            Length = 369

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0019, P = 0.0019
 Identities = 26/64 (40%), Positives = 37/64 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP---DVHASLAVTVRNYVEI 589
             A+DVWS GCIF E+I  + LFPG DH+ Q  +L+  ++  P   D+        R Y+  
Sbjct:   217 AIDVWSVGCIFMELINRAPLFPGRDHMHQM-RLITEVIGTPTDDDLGFIRNEDARRYMRH 275

Query:   590 VP-FP 601
             +P FP
Sbjct:   276 LPQFP 280


>sp|Q39024|MPK4_ARATH MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 4 (MAP KINASE 4)
            (ATMPK4) >pir||S40470 mitogen-activated protein kinase 4 (EC
            2.7.1.-) - Arabidopsis thaliana >gnl|PID|d1005402 (D21840) MAP
            kinase [Arabidopsis thaliana]
            Length = 376

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0019, P = 0.0019
 Identities = 26/64 (40%), Positives = 37/64 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAV----TVRNYVE 586
             A+D+WS GCI GE +    LFPG D++ Q  +L+  L+  PD  +SL        R YV 
Sbjct:   224 AIDIWSVGCILGETMTREPLFPGKDYVHQ-LRLITELIGSPD-DSSLGFLRSDNARRYVR 281

Query:   587 IVP-FP 601
              +P +P
Sbjct:   282 QLPQYP 287


>sp|Q07176|MMK1_MEDSA MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG MMK1 (MAP KINASE
            MSK7) (MAP KINASE ERK1) >pir||S48123 mitogen-activated protein
            kinase 7 (EC 2.7.1.-) - alfalfa >pir||S59949
            serine/threonine-specific protein kinase MAP (EC 2.7.1.-) - alfalfa
            >gi|289125 (L07042) MAP kinase [Medicago sativa] >gi|298019
            (X66469) MAP Kinase [Medicago sativa]
            Length = 387

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0020, P = 0.0020
 Identities = 25/60 (41%), Positives = 34/60 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP--DVHASLAVTVRNYVEIV 592
             A+DVWS GCIF E++    LFPG DH+ Q  +LL  L+  P  D    L    + Y+  +
Sbjct:   236 AIDVWSVGCIFMELMDRKPLFPGRDHVHQ-LRLLMELIGTPSEDDLGFLNENAKRYIRQL 294

Query:   593 P 595
             P
Sbjct:   295 P 295


>sp|P24941|CDK2_HUMAN CELL DIVISION PROTEIN KINASE 2 (P33 PROTEIN KINASE)
            >pir||A41227 protein kinase (EC 2.7.1.37) cdk2 - human >pdb|1FIN|A
            Homo sapiens >pdb|1FIN|C Homo sapiens >pdb|1HCK|  Human
            Cyclin-Dependent Kinase 2 Transferase, SerineTHREONINE PROTEIN
            KINASE, ATP-Binding, Cell Cycle, Cell Division, Mitosis,
            Phosphorylation Mol_id: 1; Molecule: Human Cyclin-Dependent Kinase
            2; Chain: Null; Synonym: Cdk2; Ec: 2.... >pdb|1HCL|  Human
            Cyclin-Dependent Kinase 2 Transferase, SerineTHREONINE PROTEIN
            KINASE, ATP-Binding, Cell Cycle, Cell Division, Mitosis,
            Phosphorylation Mol_id: 1; Molecule: Human Cyclin-Dependent Kinase
            2; Chain: Null; Synonym: Cdk2; Ec: 2.... >gi|180178 (M68520)
            cdc2-related protein kinase [Homo sapiens] >prf||1717387A cyclin A
            dependent p33 kinase:SUBUNIT=2 [Homo sapiens]
            Length = 298

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0022, P = 0.0022
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTL 219


>gi|312803 (X62071) cdk2 gene product [Homo sapiens]
           Length = 298

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0022, P = 0.0022
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTL 219


>gi|29849 (X61622) cell division kinase. CDC2 homolog [Homo sapiens]
          Length = 298

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0022, P = 0.0022
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTL 219


>sp|P48963|CDK2_MESAU CELL DIVISION PROTEIN KINASE 2 >gnl|PID|d1004684 (D17350)
            cdk2 [Mesocricetus auratus]
            Length = 298

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0022, P = 0.0022
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTL 219


>gnl|PID|d1006498 (D28753) cyclin dependent kinase 2-alpha [Rattus rattus]
            Length = 298

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0022, P = 0.0022
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTL 219


>gi|1695880 (U63337) cyclin-dependent kinase-2 alpha [Mus musculus]
            Length = 298

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0022, P = 0.0022
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTL 219


>pdb|1JST|A Homo sapiens >pdb|1JST|C Homo sapiens >pdb|1JSU|A Homo sapiens
            Length = 298

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0022, P = 0.0022
 Identities = 19/37 (51%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++  +L
Sbjct:   183 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTL 219


>gi|170869 (M76585) protein kinase [Candida albicans]
           Length = 417

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0023, P = 0.0023
 Identities = 23/62 (37%), Positives = 34/62 (54%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVL--LPDVHASLAVTVRNYVEIV 592
             A+DVWS GCI  EM+ G  LFPG D+ +Q   ++  L    + D +   +   R Y+  +
Sbjct:   251 AIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVLGTPNMEDYYNIKSKRAREYIRSL 310

Query:   593 PF 598
             PF
Sbjct:   311 PF 312


>sp|P28869|ERK1_CANAL EXTRACELLULAR SIGNAL-REGULATED KINASE 1 (ERK1) (MAP
            KINASE 1) (MAPK 1)
            Length = 417

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0023, P = 0.0023
 Identities = 23/62 (37%), Positives = 34/62 (54%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVL--LPDVHASLAVTVRNYVEIV 592
             A+DVWS GCI  EM+ G  LFPG D+ +Q   ++  L    + D +   +   R Y+  +
Sbjct:   251 AIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVLGTPNMEDYYNIKSKRAREYIRSL 310

Query:   593 PF 598
             PF
Sbjct:   311 PF 312


>gnl|PID|e49056 (Z11696) 44kDa protein kinase [Homo sapiens] >prf||1813206C
            mitogen-activated protein kinase [Homo sapiens]
            Length = 355

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0023, P = 0.0023
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   201 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 260

Query:   593 P 595
             P
Sbjct:   261 P 261


>sp|Q90336|MP38_CYPCA MITOGEN-ACTIVATED PROTEIN KINASE P38 (MAP KINASE P38)
            >gnl|PID|d1012548 (D83274) mitogen-activated protein kinase (p38)
            [Cyprinus carpio]
            Length = 361

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0024, P = 0.0024
 Identities = 17/35 (48%), Positives = 25/35 (71%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLL 520
             + VD+WS GCI  E++ G  LFPG DHI+Q  +++
Sbjct:   203 MTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIM 237


>gi|2232214 (AF004709) stress-activated protein kinase 4 [Homo sapiens]
            Length = 365

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0024, P = 0.0024
 Identities = 18/33 (54%), Positives = 24/33 (72%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLL 520
             VD+WS GCI  EM+ G  LF G D++DQ T++L
Sbjct:   204 VDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQIL 236


>gnl|PID|e291121 (Y10488) stress-activated protein kinase-4 [Homo sapiens]
            Length = 365

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0024, P = 0.0024
 Identities = 18/33 (54%), Positives = 24/33 (72%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLL 520
             VD+WS GCI  EM+ G  LF G D++DQ T++L
Sbjct:   204 VDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQIL 236


>pir||PQ0270 extracellular signal-regulated kinase 1 (EC 2.7.1.-) - human
            (fragment) >gi|186696 (M84490) kinase 1 [Homo sapiens]
            Length = 366

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0024, P = 0.0024
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   212 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 271

Query:   593 P 595
             P
Sbjct:   272 P 272


>gi|515499 (U12008) microtubule-associated protein-2 kinase [Rattus norvegicus]
           Length = 367

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0024, P = 0.0024
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   213 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 272

Query:   593 P 595
             P
Sbjct:   273 P 273


>pir||A60041 Ca2+/calmodulin-dependent protein kinase (EC 2.7.1.123) ERK1 -
            Chinese hamster (fragment)
            Length = 369

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0025, P = 0.0025
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   215 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 274

Query:   593 P 595
             P
Sbjct:   275 P 275


>gi|204054 (M61177) extracellular-signal-regulated kinase 1 [Rattus norvegicus]
           Length = 374

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0025, P = 0.0025
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   220 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 279

Query:   593 P 595
             P
Sbjct:   280 P 280


>pir||S28184 Ca2+/calmodulin-dependent protein kinase (EC 2.7.1.123) - mouse
            Length = 377

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   223 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 282

Query:   593 P 595
             P
Sbjct:   283 P 283


>pir||A48082 mitogen-activated protein kinase p44-erk1 - human >gi|31221
            (X60188) protein serine/threonine kinase [Homo sapiens]
            Length = 379

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   225 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 284

Query:   593 P 595
             P
Sbjct:   285 P 285


>sp|P27361|ERK1_HUMAN EXTRACELLULAR SIGNAL-REGULATED KINASE 1 (ERK1)
            (INSULIN-STIMULATED MAP2 KINASE) (MAP KINASE 1) (MAPK 1) (P44-ERK1)
            (ERT2) (P44-MAPK) (MICROTUBULE-ASSOCIATED PROTEIN-2 KINASE)
            Length = 379

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   225 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 284

Query:   593 P 595
             P
Sbjct:   285 P 285


>sp|P21708|ERK1_RAT EXTRACELLULAR SIGNAL-REGULATED KINASE 1 (ERK1)
            (INSULIN-STIMULATED MAP2 KINASE) (MAP KINASE 1) (MAPK 1) (P44-ERK1)
            (ERT2) (P44-MAPK) (MICROTUBULE-ASSOCIATED PROTEIN-2 KINASE) (MNK1)
            >pir||JC1451 Ca2+/calmodulin-dependent protein kinase (EC
            2.7.1.123) - rat >gi|56627 (X65198) MAP kinase [Rattus norvegicus]
            Length = 380

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0026, P = 0.0026
 Identities = 20/61 (32%), Positives = 35/61 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY++ +
Sbjct:   226 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSL 285

Query:   593 P 595
             P
Sbjct:   286 P 286


>sp|Q00526|CDK3_HUMAN CELL DIVISION PROTEIN KINASE 3 >pir||S23382 protein
            kinase (EC 2.7.1.37) cdk3 - human >gi|36613 (X66357)
            serine/threonine protein kinase [Homo sapiens]
            Length = 305

  Plus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.0031, P = 0.0031
 Identities = 19/37 (51%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EM+    LFPG+  IDQ  ++   L
Sbjct:   183 AVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRML 219


>pir||A38282 p58 galactosyltransferase-associated protein kinase - human
            Length = 434

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0032, P = 0.0032
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   257 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 293


>sp|P21127|KP58_HUMAN GALACTOSYLTRANSFERASE ASSOCIATED PROTEIN KINASE P58/GTA
            (CELL DIVISION CYCLE 2-LIKE 1) (CLK-1) (P58 CLK-1)
            Length = 436

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0032, P = 0.0032
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   259 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 295


>gi|2360960 (AF015256) p38 mitogen-activated protein kinase [Homo sapiens]
            Length = 365

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0032, P = 0.0032
 Identities = 18/33 (54%), Positives = 24/33 (72%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLL 520
             VD+WS GCI  EM+ G  LF G D++DQ T++L
Sbjct:   204 VDIWSVGCIMAEMLTGKTLFRGKDYLDQLTQIL 236


>pir||A42823 cell division control-related protein kinase p58clk-1 - human
            Length = 439

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0033, P = 0.0033
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   262 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 298


>gi|189481 (M37712) p58/GTA protein kinase [Homo sapiens]
           Length = 439

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0033, P = 0.0033
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   262 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 298


>sp|Q13164|ERK5_HUMAN EXTRACELLULAR SIGNAL-REGULATED KINASE 5 (ERK5) (ERK4)
            (BMK1 KINASE) >pir||B56708 extracellular signal-regulated kinase 5
            - human >gi|837261 (U25278) ERK5 [Homo sapiens]
            Length = 815

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0033, P = 0.0033
 Identities = 26/68 (38%), Positives = 40/68 (58%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD---VHASLAVTVRNYVEI 589
             A+D+WS GCIFGEM+    LFPG +++ Q  +L+  ++  P    + A  A  VR Y++ 
Sbjct:   241 AIDLWSVGCIFGEMLARRQLFPGKNYVHQ-LQLIMMVLGTPSPAVIQAVGAERVRAYIQS 299

Query:   590 VP----FPW 604
             +P     PW
Sbjct:   300 LPPRQPVPW 308


>gi|973307 (U29725) BMK1 alpha kinase [Homo sapiens] >gi|973309 (U29726) BMK1
           beta kinase [Homo sapiens] >gi|973311 (U29727) BMK1 gamma kinase
           [Homo sapiens]
           Length = 816

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0033, P = 0.0033
 Identities = 26/68 (38%), Positives = 40/68 (58%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD---VHASLAVTVRNYVEI 589
             A+D+WS GCIFGEM+    LFPG +++ Q  +L+  ++  P    + A  A  VR Y++ 
Sbjct:   242 AIDLWSVGCIFGEMLARRQLFPGKNYVHQ-LQLIMMVLGTPSPAVIQAVGAERVRAYIQS 300

Query:   590 VP----FPW 604
             +P     PW
Sbjct:   301 LPPRQPVPW 309


>gi|189496 (M88565) p58 protein kinase [Homo sapiens]
           Length = 446

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0033, P = 0.0033
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   269 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 305


>gi|507158 (U04815) PITSLRE alpha 1 [Homo sapiens]
           Length = 461

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0035, P = 0.0035
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   284 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 320


>pir||A54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha-1 - human
            Length = 461

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0035, P = 0.0035
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   284 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 320


>sp|Q07785|CC2H_PLAFK CELL DIVISION CONTROL PROTEIN 2 HOMOLOG >pir||S42566
            protein kinase (EC 2.7.1.37) cdc2 homolog - Plasmodium falciparum
            >gi|9934 (X61921) protein kinase p34cdc2 [Plasmodium falciparum]
            Length = 288

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0036, P = 0.0036
 Identities = 25/67 (37%), Positives = 33/67 (49%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVL-----LPDVHASLAVTVRNYVE 586
             +D+WS GCIF EM+ G+ LFPG    DQ  ++   L        P+V   L     N+  
Sbjct:   182 IDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSKNWPNV-TELPKYDPNFTV 240

Query:   587 IVPFPWFS 610
               P PW S
Sbjct:   241 YEPLPWES 248


>sp|Q06060|MAPK_PEA MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG D5 >pir||S33635
            mitogen-activated protein kinase homolog (clone D5) - garden pea
            >gi|20808 (X70703) MAP kinase homologue [Pisum sativum]
            Length = 394

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0037, P = 0.0037
 Identities = 26/60 (43%), Positives = 34/60 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRN---YVEI 589
             A+DVWS GCIF E++    LFPG DH+ Q  +LL  L+  P   A L     N   Y+  
Sbjct:   243 AIDVWSVGCIFMELMDRKPLFPGRDHVHQ-LRLLMELIGTPS-EADLGFLNENAKRYIRQ 300

Query:   590 VP 595
             +P
Sbjct:   301 LP 302


>gnl|PID|e290217 (Y10160) cyclin dependent kinase p34 [Chenopodium rubrum]
            Length = 294

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0037, P = 0.0037
 Identities = 19/36 (52%), Positives = 24/36 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+  +L
Sbjct:   185 VDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRTL 220


>sp|P51139|MSK3_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLOG MSK-3 >pir||S37642
            protein kinase MSK-3 (EC 2.7.1.-) - alfalfa >gi|313148 (X68409)
            protein kinase [Medicago sativa]
            Length = 412

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0039, P = 0.0039
 Identities = 22/61 (36%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+D+WS GC+ GE++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   256 AIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKCMNPNYTEF-KF 312

Query:   599 P 601
             P
Sbjct:   313 P 313


>sp|P54666|CC23_TRYBB CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 3 >pir||S36619
            protein kinase (EC 2.7.1.37) cdc2 homolog - Trypanosoma brucei
            >gi|397365 (X74617) CDC2-related protein kinase [Trypanosoma
            brucei]
            Length = 311

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0042, P = 0.0041
 Identities = 26/63 (41%), Positives = 36/63 (57%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHAS-LAVT-VRNYVEIV 592
             AVD+WS GCIF E+ RG VLF G+  I Q  ++   L    D   S L V+ + +Y ++ 
Sbjct:   201 AVDMWSIGCIFAELARGKVLFRGDSEIGQLFEIFQVLGTPMDAEGSWLGVSSLPDYRDVF 260

Query:   593 PFPW 604
             P  W
Sbjct:   261 P-KW 263


>gi|507164 (U04818) PITSLRE alpha 2-4 [Homo sapiens]
           Length = 562

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0046, P = 0.0046
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   385 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 421


>gi|530748 (X80845) cdc2Pnc gene product [Pinus contorta]
           Length = 206

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.0049, P = 0.0049
 Identities = 19/36 (52%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   112 VDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVL 147


>gi|23879 (Z11695) 40kDa protein kinase [Homo sapiens] >prf||1813206B
          mitogen-activated protein kinase [Homo sapiens]
          Length = 348

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0051, P = 0.0051
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   196 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 255

Query:   593 PF----PW 604
             P     PW
Sbjct:   256 PHKNKVPW 263


>sp|P46196|ERK2_BOVIN EXTRACELLULAR SIGNAL-REGULATED KINASE 2 (ERK2)
            (MITOGEN-ACTIVATED PROTEIN KINASE 2) (MAP KINASE 2) (MAPK 2)
            (P42-MAPK) (ERT1) >pir||S25011 protein kinase ERK2 (EC 2.7.1.-) -
            bovine >gi|337 (Z14089) extracellular signal-regulated kinase
            (ERK2) [Bos taurus]
            Length = 360

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0054, P = 0.0054
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   208 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 267

Query:   593 PF----PW 604
             P     PW
Sbjct:   268 PHKNKVPW 275


>pir||S23427 protein kinase, 41K (EC 2.7.1.-) - human >gi|23881 (Z11694) 41kD
            protein kinase [Homo sapiens] >prf||1813206A mitogen-activated
            protein kinase [Homo sapiens]
            Length = 360

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0054, P = 0.0054
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   208 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 267

Query:   593 PF----PW 604
             P     PW
Sbjct:   268 PHKNKVPW 275


>sp|P28482|ERK2_HUMAN EXTRACELLULAR SIGNAL-REGULATED KINASE 2 (ERK2)
            (MITOGEN-ACTIVATED PROTEIN KINASE 2) (MAP KINASE 2) (MAPK 2)
            (P42-MAPK) (ERT1) >pir||JQ1400 extracellular signal-regulated
            kinase 2 (EC 2.7.-.-) - human >gi|182191 (M84489) protein kinase 2
            [Homo sapiens]
            Length = 360

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0054, P = 0.0054
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   208 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 267

Query:   593 PF----PW 604
             P     PW
Sbjct:   268 PHKNKVPW 275


>pir||A39754 mitogen-activated protein kinase (EC 2.7.1.-) - African clawed
            frog
            Length = 361

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0054, P = 0.0054
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   211 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 270

Query:   593 PF----PW 604
             P     PW
Sbjct:   271 PHKNKVPW 278


>sp|P26696|ERK2_XENLA MITOGEN-ACTIVATED PROTEIN KINASE (MYELIN XP42 PROTEIN
            KINASE) (MYELIN BASIC PROTEIN KINASE) (MBP KINASE) (M PHASE MAP
            KINASE) >gi|214931 (M60977) myelin basic protein kinase-like
            protein [Xenopus laevis]
            Length = 361

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0054, P = 0.0054
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   211 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 270

Query:   593 PF----PW 604
             P     PW
Sbjct:   271 PHKNKVPW 278


>gi|64894 (X59813) MAP kinase [Xenopus laevis]
          Length = 361

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0054, P = 0.0054
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   211 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 270

Query:   593 PF----PW 604
             P     PW
Sbjct:   271 PHKNKVPW 278


>pdb|1GOL|  Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At
            Position 52 Transferase, SerineTHREONINE-Protein Kinase,
            Atp-Binding, Cell Cycle, Phosphorylation Mol_id: 1; Molecule:
            Extracellular Regulated Kinase 2; Chain: Null; ...
            Length = 364

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0055, P = 0.0055
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   212 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 271

Query:   593 PF----PW 604
             P     PW
Sbjct:   272 PHKNKVPW 279


>pdb|1ERK|  Structure Of Signal-Regulated Kinase Transferase,
            SerineTHREONINE-Protein Kinase, Atp-Binding Cell Cycle,
            Phosphorylation. Mol_id: 1; Molecule: Extracellular Regulated
            Kinase 2; Chain: Null; Synonym: Mitogen Activated Protein (Map...
            Length = 364

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0055, P = 0.0055
 Identities = 22/68 (32%), Positives = 36/68 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHASLAVTVRNYVEIV 592
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L      D++  + +  RNY+  +
Sbjct:   212 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL 271

Query:   593 PF----PW 604
             P     PW
Sbjct:   272 PHKNKVPW 279


>sp|Q40532|NTF4_TOBAC MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG NTF4 (P45)
            >pir||S51321 serine/threonine protein kinase p45Ntf4 - common
            tobacco >pir||S68190 serine/threonine protein kinase p45 - common
            tobacco >gi|634070 (X83880) p45Ntf4 serine/threonine protein kinase
            [Nicotiana tabacum]
            Length = 393

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0062, P = 0.0062
 Identities = 21/41 (51%), Positives = 27/41 (65%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP 541
             A+DVWS GCIF E++    LFPG DH+ Q  +LL  L+  P
Sbjct:   241 AIDVWSVGCIFMELMDRKPLFPGRDHVHQ-LRLLMELIGTP 280


>sp|P51138|MSK2_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLOG MSK-2 >pir||S37643
            protein kinase MSK-2 (EC 2.7.1.-) - alfalfa >gi|313146 (X68410)
            protein kinase [Medicago sativa]
            Length = 411

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.0067, P = 0.0067
 Identities = 22/61 (36%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+D+WS GC+ GE++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   255 AIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIK--VLGTPTREEIKCMNPNYTEF-KF 311

Query:   599 P 601
             P
Sbjct:   312 P 312


>sp|P43068|MKC1_CANAL MITOGEN-ACTIVATED PROTEIN KINASE MKC1 (MAP KINASE MKC1)
            >gi|619450 (X76708) MAP kinase Mkc1 [Candida albicans]
            Length = 501

  Plus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.0069, P = 0.0068
 Identities = 23/61 (37%), Positives = 34/61 (55%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVR--NYVEIV 592
             A+D+WS GCI  E++ G  LF G D++DQ  ++L  L   P+       + R  NYV  +
Sbjct:   234 AIDIWSVGCILAELLGGKPLFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSL 293

Query:   593 P 595
             P
Sbjct:   294 P 294


>gi|507162 (U04817) PITSLRE alpha 2-3 [Homo sapiens]
           Length = 768

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0070, P = 0.0069
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   591 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 627


>gi|507160 (U04816) PITSLRE alpha 2-2 [Homo sapiens]
           Length = 777

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0071, P = 0.0070
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   600 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 636


>gi|507168 (U04824) PITSLRE alpha 2-1 [Homo sapiens]
           Length = 779

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0071, P = 0.0071
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   602 AVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 638


>pir||A55817 cyclin-dependent kinase p130-PITSLRE - mouse >gi|561746 (L37092)
            cyclin-dependent protein kinase [Mus musculus]
            Length = 783

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0071, P = 0.0071
 Identities = 20/37 (54%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   606 AVDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDL 642


>sp|P23573|CC2C_DROME CELL DIVISION CONTROL PROTEIN 2 COGNATE >pir||S12007
            protein kinase (EC 2.7.1.37) cdc2 homolog C - fruit fly (Drosophila
            sp.) >gi|7709 (X57486) p34-cdc2 homologue [Drosophila melanogaster]
            Length = 314

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.0074, P = 0.0074
 Identities = 21/41 (51%), Positives = 26/41 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EMI    LFPG+  IDQ  ++  +L   PD
Sbjct:   187 VDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLST-PD 226


>sp|P51136|KG3H_DICDI GLYCOGEN SYNTHASE KINASE-3 HOMOLOG (GSK-3) >pir||A55476
            protein kinase (EC 2.7.1.37) gskA - slime mold (Dictyostelium
            discoideum) >gi|511849 (L34674) glycogen synthase kinase 3
            [Dictyostelium discoideum]
            Length = 468

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0075, Sum P(2) = 0.0075
 Identities = 23/64 (35%), Positives = 34/64 (53%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL--VLLPDVHA-SLAVTVRNYVEIV 592
             +DVWS GC+  E++ G  LFPG + IDQ  +++  L       +HA +   T   + EI 
Sbjct:   237 IDVWSLGCVLAELLLGQPLFPGENGIDQLVEIIKVLGTPTKEQIHAMNPYYTSFKFPEIK 296

Query:   593 PFPW 604
               PW
Sbjct:   297 ANPW 300

 Score = 40 (14.1 bits), Expect = 0.0075, Sum P(2) = 0.0075
 Identities = 11/26 (42%), Positives = 13/26 (50%), Frame = +3

Query:   237 IP-TTYRADRHTSISLISKANCMWKL 311
             +P T YR  RH S+S     N   KL
Sbjct:   134 VPDTVYRVSRHYSMSKQPVPNIFVKL 159


>sp|P29619|CC22_ORYSA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 2 >pir||S22441
            protein kinase (EC 2.7.1.37) cdc2 homolog 2 - rice >gi|20345
            (X60375) Rcdc2-2 gene product [Oryza sativa] >prf||1814443B cdc2
            protein:ISOTYPE=cdc2Os-2 [Oryza sativa]
            Length = 292

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0086, P = 0.0086
 Identities = 23/61 (37%), Positives = 35/61 (57%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAV-TVRNYVEIVPF 598
             VD+WS GCIF EM+    LFPG+  ID+  K+  S++  P+      V ++ +Y+   P 
Sbjct:   184 VDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIF-SIMGTPNEETWPGVASLPDYISTFP- 241

Query:   599 PW 604
              W
Sbjct:   242 KW 243


>gi|1710234 (U79269) cyclin dependent protein kinase [Homo sapiens]
            Length = 229

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.0086, P = 0.0086
 Identities = 20/41 (48%), Positives = 25/41 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN   DQ  K+ + + L P+
Sbjct:   121 VDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE 161


>pir||A40444 protein kinase (EC 2.7.1.37) cdc2 homolog A - maize
            Length = 294

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0087, P = 0.0087
 Identities = 19/36 (52%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRIL 220


>pir||B40444 protein kinase (EC 2.7.1.37) cdc2 homolog B - maize (fragment)
            Length = 294

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0087, P = 0.0087
 Identities = 19/36 (52%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRVL 220


>sp|P24100|CC2A_ARATH CELL DIVISION CONTROL PROTEIN 2 HOMOLOG A >pir||S23095
            protein kinase (EC 2.7.1.37) cdc2 - Arabidopsis thaliana
            >bbs|109461 p34cdc2 protein kinase [Arabidopsis thaliana, flower,
            Peptide, 294 aa] >gi|16219 (X57839) p34(cdc2) [Arabidopsis
            thaliana] >gi|166784 (M59198) protein kinase [Arabidopsis thaliana]
            >gnl|PID|d1002098 (D10850) p32 protein serine/threonine kinase
            [Arabidopsis thaliana] >bbs|115411 (S45387) Aracdc2=p34cdc2 protein
            kinase homolog [Arabidopsis thaliana, ecotype Columbia, flowers,
            Peptide, 294 aa] [Arabidopsis thaliana]
            Length = 294

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0087, P = 0.0087
 Identities = 19/32 (59%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VD+WS GCIF EMI    LFPG+  IDQ  K+
Sbjct:   185 VDIWSVGCIFAEMISQKPLFPGDSEIDQLFKI 216


>sp|P23111|CC2_MAIZE CELL DIVISION CONTROL PROTEIN 2 HOMOLOG >gi|168511
            (M60526) protein cdc2 kinase [Zea mays]
            Length = 294

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0087, P = 0.0087
 Identities = 19/36 (52%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRIL 220


>gi|1236190 (U18365) cyclin dependent protein kinase homolog; similar to moth
            bean p34cdc2 protein, PIR Accession Number JQ2243 [Brassica napus]
            Length = 294

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0087, P = 0.0087
 Identities = 19/32 (59%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VD+WS GCIF EMI    LFPG+  IDQ  K+
Sbjct:   185 VDIWSVGCIFAEMISQKPLFPGDSEIDQLFKI 216


>gnl|PID|e251152 (X98768) cdc2-like kinase [Theileria annulata]
            Length = 298

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0089, P = 0.0089
 Identities = 20/37 (54%), Positives = 23/37 (62%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EMI G  LFPG    DQ  ++   L
Sbjct:   181 AVDIWSVGCIFAEMINGVPLFPGISEQDQLKRIFKIL 217

 Score = 91 (32.0 bits), Expect = 0.30, P = 0.26
 Identities = 23/57 (40%), Positives = 29/57 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPG---ND------------HIDQWTKLLNSLVLLPD 544
             AVD+WS GCIF EMI G  LFPG    D            ++D W +++N     PD
Sbjct:   181 AVDIWSVGCIFAEMINGVPLFPGISEQDQLKRIFKILGTPNVDSWPQVVNLPAYNPD 237


>gnl|PID|e251627 (X98824) cdec2-related kinase [Theileria parva]
            Length = 298

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.0089, P = 0.0089
 Identities = 20/37 (54%), Positives = 23/37 (62%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF EMI G  LFPG    DQ  ++   L
Sbjct:   181 AVDIWSVGCIFAEMINGVPLFPGISEQDQLKRIFKIL 217

 Score = 90 (31.7 bits), Expect = 0.40, P = 0.33
 Identities = 23/57 (40%), Positives = 28/57 (49%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPG---NDH------------IDQWTKLLNSLVLLPD 544
             AVD+WS GCIF EMI G  LFPG    D             +D W +++N     PD
Sbjct:   181 AVDIWSVGCIFAEMINGVPLFPGISEQDQLKRIFKILGTPSVDSWPQVVNLPAYNPD 237


>gnl|PID|e323538 (Y12785) MAP kinase I [Petroselinum crispum]
            Length = 371

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.0099, P = 0.0098
 Identities = 25/54 (46%), Positives = 32/54 (59%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRN 577
             VA+DVWS GCI+ E++    LF G DH+ Q  +LL  L+  P   A L   VRN
Sbjct:   219 VAIDVWSVGCIYMELMNRKPLFAGKDHVHQM-RLLTELLGSP-TEADLGF-VRN 269


>pir||I50463 protein kinase - chicken >gi|571460 (U16656) protein kinase
            [Gallus gallus]
            Length = 772

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.010, Sum P(2) = 0.010
 Identities = 19/37 (51%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A+D+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   595 AIDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDL 631

 Score = 38 (13.4 bits), Expect = 0.010, Sum P(2) = 0.010
 Identities = 10/30 (33%), Positives = 16/30 (53%), Frame = +3

Query:   201 MSLIGKKTNSNDIPTTYRADRHTSISLISK 290
             MS   ++ N N IP   R DR ++ S + +
Sbjct:   336 MSEEEERENGNHIPVESRFDRDSAGSEVEE 365


>gi|2138340 (U94192) salicylic acid-activated MAP kinase [Nicotiana tabacum]
            Length = 393

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.011, P = 0.011
 Identities = 20/41 (48%), Positives = 27/41 (65%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP 541
             A+DVWS GCIF E++    LFPG DH+ Q  +L+  L+  P
Sbjct:   241 AIDVWSVGCIFMELMDRKPLFPGRDHVHQ-LRLIMELIGTP 280


>gnl|PID|e1172776 (AJ002314) shaggy-like kinase 111 [Nicotiana tabacum]
            Length = 469

  Plus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.011, P = 0.011
 Identities = 16/37 (43%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A+D+WS GC+F E++ G  LFPG   +DQ  +++  L
Sbjct:   321 AIDIWSAGCVFAELLLGQPLFPGESGVDQLAEIIKIL 357


>pir||S42049 protein kinase (EC 2.7.1.37) cdc2-Pa - Norway spruce >gi|454980
            (X77680) cdc2Pa [Picea abies]
            Length = 294

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.011, P = 0.011
 Identities = 19/36 (52%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVL 220


>pir||JQ2243 protein kinase (EC 2.7.1.37) cdc2 homolog - moth bean >gi|170642
            (M99497) protein kinase [Vigna aconitifolia]
            Length = 294

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.011, P = 0.011
 Identities = 19/36 (52%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRIL 220


>gnl|PID|e252637 (X99100) protein kinase [Trifolium repens]
            Length = 341

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.011, P = 0.011
 Identities = 22/61 (36%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+DVWS GC+  E++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   186 AIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKCMNPNYTEF-KF 242

Query:   599 P 601
             P
Sbjct:   243 P 243


>gi|1914883 (L29449) protein kinase [Schizosaccharomyces pombe]
            Length = 354

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.012, P = 0.012
 Identities = 17/37 (45%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A+D+WSTGC+  E++ G  LFPG   IDQ  +++  L
Sbjct:   213 AIDIWSTGCVMAELMLGHPLFPGESGIDQLVEIIKIL 249


>gnl|PID|e292745 (X97314) cdc2MsC [Medicago sativa]
            Length = 509

  Plus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.012, P = 0.012
 Identities = 20/42 (47%), Positives = 26/42 (61%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             AVD+WS GCIF E++ G  +FPG D  +Q  K+   L   PD
Sbjct:   220 AVDMWSVGCIFAELLHGKPIFPGKDEPEQLNKIFE-LCGAPD 260


>sp|P24788|KP58_MOUSE GALACTOSYLTRANSFERASE ASSOCIATED PROTEIN KINASE P58/GTA
            >gi|200208 (M58633) p58/GTA protein kinase [Mus musculus]
            Length = 434

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.013, P = 0.012
 Identities = 19/37 (51%), Positives = 23/37 (62%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A D+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   257 ACDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDL 293


>gnl|PID|e292746 (X97315) cdc2MsD [Medicago sativa]
            Length = 311

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.013, P = 0.013
 Identities = 21/39 (53%), Positives = 24/39 (61%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLL 538
             VD+WS GCIF EM+R   LFPG+    Q   LLN   LL
Sbjct:   202 VDIWSVGCIFAEMVRRQALFPGDSEFQQ---LLNIFKLL 237


>pir||A53227 galactosyltransferase-associated protein kinase - mouse
            Length = 436

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.013, P = 0.013
 Identities = 19/37 (51%), Positives = 23/37 (62%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A D+WS GCIFGE++    LFPG   IDQ  K+   L
Sbjct:   259 ACDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDL 295


>gnl|PID|e242658 (X97638) cyclin-dependent kinase [Antirrhinum majus]
            Length = 280

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.014, P = 0.013
 Identities = 18/32 (56%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VDVWS GCIF EM+    LFPG+  ID+  K+
Sbjct:   172 VDVWSVGCIFAEMVNQKPLFPGDSEIDELHKI 203


>gi|1303658 (L77991) cyclin-dependent kinase [Gallus gallus]
            Length = 326

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.014, P = 0.014
 Identities = 20/41 (48%), Positives = 27/41 (65%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN  +DQ  K+ + ++ LP+
Sbjct:   200 VDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFD-VIGLPE 239


>sp|Q05006|CC22_MEDSA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 2 >pir||S31332
            protein kinase (EC 2.7.1.37) cdc2-B - alfalfa >gi|19583 (X70707)
            CDC2 kinase [Medicago sativa]
            Length = 294

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.015, P = 0.015
 Identities = 19/32 (59%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VDVWS GCIF EMI    LFPG+  ID+  K+
Sbjct:   185 VDVWSVGCIFAEMINQRPLFPGDSEIDELFKI 216


>gnl|PID|e251272 (Z75661) cdc2 kinase homologue [Sesbania rostrata]
            Length = 294

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.015, P = 0.015
 Identities = 18/36 (50%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VD+WS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDIWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRIL 220


>sp|P43289|KSGG_ARATH SHAGGY RELATED PROTEIN KINASE ASK-GAMMA >pir||S41597
            protein kinase ASK-gamma (EC 2.7.1.-) - Arabidopsis thaliana
            >gi|456509 (X75431) ASK-gamma (Arabidopsis shaggy-related kinase)
            [Arabidopsis thaliana] >gnl|PID|e314173 (Y12710) shaggy-like kinase
            gamma [Arabidopsis thaliana]
            Length = 409

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.015, P = 0.015
 Identities = 22/61 (36%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+DVWS GC+  E++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   254 AIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKCMNPNYTEF-KF 310

Query:   599 P 601
             P
Sbjct:   311 P 311


>sp|P11802|CDK4_HUMAN CELL DIVISION PROTEIN KINASE 4 (PSK-J3) >gi|456427
            (M14505) cyclin-dependent protein kinase, type 4 [Homo sapiens]
            >gi|1353416 (U37022) cyclin-dependent kinase 4 [Homo sapiens]
            Length = 303

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.016, P = 0.016
 Identities = 20/41 (48%), Positives = 25/41 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN   DQ  K+ + + L P+
Sbjct:   195 VDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE 235


>sp|P35426|CDK4_RAT CELL DIVISION PROTEIN KINASE 4 (PSK-J3) >pir||JN0460
            protein kinase (EC 2.7.1.37) cdk4 - rat >bbs|128628
            cyclin-dependent kinase 4=cdk4 product [rats, fetal lungs, Peptide,
            303 aa] >gi|203392 (L11007) cyclin-dependent kinase 4 [Rattus
            norvegicus]
            Length = 303

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.016, P = 0.016
 Identities = 20/41 (48%), Positives = 25/41 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN   DQ  K+ + + L P+
Sbjct:   195 VDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE 235


>sp|P30285|CDK4_MOUSE CELL DIVISION PROTEIN KINASE 4 (PSK-J3) (CRK3)
            >pir||A44293 protein kinase (EC 2.7.1.37) crk3 - mouse >gi|193364
            (L01640) D-type G1 cyclin catalytic subunit [Mus musculus]
            Length = 303

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.016, P = 0.016
 Identities = 20/41 (48%), Positives = 25/41 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN   DQ  K+ + + L P+
Sbjct:   195 VDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE 235


>pir||S52841 protein kinase (EC 2.7.1.37) cdk4 - human >gi|763124 (Z48970) orf
            [Homo sapiens]
            Length = 303

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.016, P = 0.016
 Identities = 20/41 (48%), Positives = 25/41 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN   DQ  K+ + + L P+
Sbjct:   195 VDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE 235


>gi|1763059 (U68478) cyclin-dependent kinase 4 [Sus scrofa]
            Length = 303

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.016, P = 0.016
 Identities = 20/41 (48%), Positives = 25/41 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN   DQ  K+ + + L P+
Sbjct:   195 VDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE 235


>gi|2209290 (U81031) CDK4 [Homo sapiens]
            Length = 303

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.016, P = 0.016
 Identities = 20/41 (48%), Positives = 25/41 (60%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             VD+WS GCIF EM R   LF GN   DQ  K+ + + L P+
Sbjct:   195 VDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPE 235


>gnl|PID|e305854 (Y11527) serine/threonine protein kinase [Oryza sativa]
            Length = 211

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.016, P = 0.016
 Identities = 15/37 (40%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A+D+WS GC+  E++ G  LFPG   +DQ  +++  L
Sbjct:    62 AIDIWSVGCVLAELLIGQPLFPGESGVDQLVEIIKIL 98


>gi|2191169 (AF007270) Similar to shaggy related protein kinase. Belongs to the
            CDC2/CDKX subfamily [Arabidopsis thaliana]
            Length = 447

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.017, P = 0.017
 Identities = 22/61 (36%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+DVWS GC+  E++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   284 AIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKCMNPNYTEF-KF 340

Query:   599 P 601
             P
Sbjct:   341 P 341


>gnl|PID|e1172778 (AJ002315) shaggy-like kinase 59 [Nicotiana tabacum]
            Length = 469

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.019, P = 0.019
 Identities = 16/37 (43%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A+D+WS GC+F E++ G  LFPG   +DQ  +++  L
Sbjct:   321 AIDMWSAGCVFAELLLGQPLFPGESGVDQLVEIIKIL 357


>sp|P29618|CC21_ORYSA CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 1 >pir||S22440
            protein kinase (EC 2.7.1.37) cdc2 homolog 1 - rice >gi|20343
            (X60374) Rcdc2-1 gene product [Oryza sativa] >prf||1814443A cdc2
            protein:ISOTYPE=cdc2Os-1 [Oryza sativa]
            Length = 294

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.020, P = 0.020
 Identities = 18/36 (50%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VD+WS GCIF EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRVL 220


>gi|1196796 (L34206) protein kinase p34cdc2 [Petroselinum crispum]
            Length = 294

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.020, P = 0.020
 Identities = 18/32 (56%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VDVWS GCIF EM+    LFPG+  ID+  K+
Sbjct:   185 VDVWSVGCIFAEMVNQRPLFPGDSEIDELFKI 216


>pir||S57928 protein kinase (EC 2.7.1.37) cdc2 homolog - cowpea >gi|1235610
            (X89400) protein kinase [Vigna unguiculata]
            Length = 294

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.020, P = 0.020
 Identities = 18/36 (50%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GC+F EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDVWSVGCLFAEMVNRRPLFPGDSEIDELFKIFRIL 220


>sp|P52389|CC2_VIGUN CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
            Length = 294

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.020, P = 0.020
 Identities = 18/36 (50%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VDVWS GC+F EM+    LFPG+  ID+  K+   L
Sbjct:   185 VDVWSVGCLFAEMVNRRPLFPGDSEIDELFKIFRIL 220


>sp|P34112|CC2_DICDI CELL DIVISION CONTROL PROTEIN 2 HOMOLOG (P34 PROTEIN
            KINASE) >pir||S24386 protein kinase (EC 2.7.1.37) cdc2 homolog -
            slime mold (Dictyostelium discoideum) >gi|167686 (M80808) p34-cdc2
            protein [Dictyostelium discoideum]
            Length = 296

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.020, P = 0.020
 Identities = 26/60 (43%), Positives = 32/60 (53%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT-VRNYVEIV 592
             V VD+WS GCIFGEM+    LF G+  IDQ  ++   L   PD      VT +  YV   
Sbjct:   184 VPVDMWSVGCIFGEMLNKKPLFSGDCEIDQIFRIFRVLGT-PDDSIWPGVTKLPEYVSTF 242

Query:   593 P 595
             P
Sbjct:   243 P 243


>gi|2465400 (AF020316) MAP kinase Mps1 [Magnaporthe grisea]
            Length = 415

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.020, P = 0.020
 Identities = 23/62 (37%), Positives = 34/62 (54%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVR--NYVEIV 592
             A+DVWS GCI  E++ G   F G D++DQ  ++L+ L    +   S   + R   YV  +
Sbjct:   209 AIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNL 268

Query:   593 PF 598
             PF
Sbjct:   269 PF 270


>gnl|PID|e242615 (X97637) cyclin-dependent kinase [Antirrhinum majus]
            Length = 302

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.021, P = 0.021
 Identities = 18/32 (56%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VDVWS GCIF EM+    LFPG+  ID+  K+
Sbjct:   193 VDVWSVGCIFAEMVNQRPLFPGDSEIDELFKI 224


>sp|P46892|KP58_RAT GALACTOSYLTRANSFERASE ASSOCIATED PROTEIN KINASE P58/GTA
            >pir||S47628 GTA-kinase - rat
            Length = 436

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.022, P = 0.022
 Identities = 18/37 (48%), Positives = 23/37 (62%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A D+WS GCIFGE++    LFPG   IDQ  K+   +
Sbjct:   259 ACDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDI 295


>gi|1129065 (L24388) galactosyltransferase-associated kinase [Rattus
            norvegicus]
            Length = 438

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.022, P = 0.022
 Identities = 18/37 (48%), Positives = 23/37 (62%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A D+WS GCIFGE++    LFPG   IDQ  K+   +
Sbjct:   261 ACDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDI 297


>pir||S47042 protein kinase (EC 2.7.1.37) cdc2-related 1 - Plasmodium
            falciparum
            Length = 670

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.023, P = 0.023
 Identities = 22/41 (53%), Positives = 27/41 (65%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             +D+WS GCIF EMI    LF G + IDQ  K+L  L+ LPD
Sbjct:   509 IDIWSAGCIFAEMILKKPLFVGENEIDQLFKIL-CLLGLPD 548


>gi|575365 (X80759) cdc2-related protein kinase 1 [Plasmodium falciparum]
           Length = 719

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.025, P = 0.025
 Identities = 22/41 (53%), Positives = 27/41 (65%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             +D+WS GCIF EMI    LF G + IDQ  K+L  L+ LPD
Sbjct:   558 IDIWSAGCIFAEMILKKPLFVGENEIDQLFKIL-CLLGLPD 597


>bbs|129891 Mpk1p=mitogen-activated protein kinase homolog [Saccharomyces
            cerevisiae, Peptide, 484 aa]
            Length = 484

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.025, P = 0.025
 Identities = 18/42 (42%), Positives = 26/42 (61%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             A+DVWS GCI  E + G  +F G D+++Q  ++L  L   PD
Sbjct:   213 AIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPD 254


>sp|Q00772|SLT2_YEAST MITOGEN-ACTIVATED PROTEIN KINASE SLT2/MPK1 (MAP KINASE
            MPK1) >pir||S43737 protein kinase SLT2 (EC 2.7.1.-) - yeast
            (Saccharomyces cerevisiae) >gi|455519 (X59262) SLT2 protein kinase
            [Saccharomyces cerevisiae] >gi|488177 (U00062) Slt2p: Putative
            Ser/Thr protein kinases [Saccharomyces cerevisiae]
            Length = 484

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.025, P = 0.025
 Identities = 18/42 (42%), Positives = 26/42 (61%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD 544
             A+DVWS GCI  E + G  +F G D+++Q  ++L  L   PD
Sbjct:   213 AIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPD 254


>sp|P43288|KSGA_ARATH SHAGGY RELATED PROTEIN KINASE ASK-ALPHA >pir||S41596
            protein kinase ASK-alpha (EC 2.7.1.-) - Arabidopsis thaliana
            >gi|460832 (X75432) shaggy related kinase [Arabidopsis thaliana]
            >gnl|PID|e55023 (X68525) serine /threonine protein kinase
            [Arabidopsis thaliana]
            Length = 405

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.025, P = 0.025
 Identities = 22/61 (36%), Positives = 30/61 (49%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+DVWS GC+  E++ G  LFPG   +DQ   ++   VL       +     NY E   F
Sbjct:   250 AIDVWSAGCVLAELLLGQPLFPGESGVDQLVHIIK--VLGTPTREEIKCMNPNYTEF-KF 306

Query:   599 P 601
             P
Sbjct:   307 P 307


>gnl|PID|e340154 (AJ000732) shaggy-like kinase alpha [Arabidopsis thaliana]
            Length = 405

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.025, P = 0.025
 Identities = 22/61 (36%), Positives = 30/61 (49%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+DVWS GC+  E++ G  LFPG   +DQ   ++   VL       +     NY E   F
Sbjct:   250 AIDVWSAGCVLAELLLGQPLFPGESGVDQLVHIIK--VLGTPTREEIKCMNPNYTEF-KF 306

Query:   599 P 601
             P
Sbjct:   307 P 307


>gnl|PID|d1010011 (D50738) cdc2 homolog [Nicotiana tabacum]
            Length = 294

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.026, P = 0.025
 Identities = 18/32 (56%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VDVWS GCIF EM+    LFPG+  ID+  K+
Sbjct:   185 VDVWSVGCIFAEMVTQRPLFPGDSEIDELFKI 216


>gi|1377888 (L77082) cdc2 gene product [Nicotiana tabacum]
            Length = 294

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.026, P = 0.025
 Identities = 18/32 (56%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VDVWS GCIF EM+    LFPG+  ID+  K+
Sbjct:   185 VDVWSVGCIFAEMVTQRPLFPGDSEIDELFKI 216


>gnl|PID|d1022523 (AB006033) cdc2 kinase [Allium cepa]
            Length = 294

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.026, P = 0.025
 Identities = 17/32 (53%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VD+WS GCIF EM+    LFPG+  ID+  K+
Sbjct:   185 VDIWSVGCIFAEMVNQRPLFPGDSEIDELFKI 216


>pir||S51105 petunia shaggy kinase 4 - garden petunia >gi|619894 (X83619)
            Petunia Shaggy kinase 4 [Petunia hybrida]
            Length = 409

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.026, P = 0.026
 Identities = 21/61 (34%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+D+WS GC+  E++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   254 AIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIK--VLGTPTREEIKSMNPNYTEF-KF 310

Query:   599 P 601
             P
Sbjct:   311 P 311


>sp|P51137|MSK1_MEDSA GLYCOGEN SYNTHASE KINASE-3 HOMOLOG MSK-1 >pir||S37644
            protein kinase MSK-1 (EC 2.7.1.-) - alfalfa >gi|313144 (X68411)
            protein kinase [Medicago sativa]
            Length = 411

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.026, P = 0.026
 Identities = 22/61 (36%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+DVWS GC+  E++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   256 AIDVWSVGCVLAELLLGQPLFPGERGVDQLVEIIK--VLGTPTREEIKCMNPNYTEF-KF 312

Query:   599 P 601
             P
Sbjct:   313 P 313


>gnl|PID|e321536 (Y13646) cyclin dependent kinase [Petunia x hybrida]
            Length = 307

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.028, P = 0.028
 Identities = 18/32 (56%), Positives = 22/32 (68%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             VDVWS GCIF EM+    LFPG+  ID+  K+
Sbjct:   190 VDVWSVGCIFAEMVTQRPLFPGDSEIDELFKI 221


>gi|1654379 (U69958) cdc2-related protein kinase 1 [Trypanosoma cruzi]
            Length = 311

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.029, P = 0.028
 Identities = 18/37 (48%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             AVD+WS GCIF E+ RG V+F G+  I Q  ++   L
Sbjct:   201 AVDIWSVGCIFAELARGKVIFRGDSEIGQLFEIFQIL 237


>gnl|PID|e281555 (Y09305) protein kinase [Homo sapiens]
            Length = 240

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.030, P = 0.029
 Identities = 21/62 (33%), Positives = 32/62 (51%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVP 595
             VA+D+WS GCI  E+  G  LFPG + ++Q   ++  L L P      A   + + +   
Sbjct:     4 VAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKG 63

Query:   596 FP 601
             FP
Sbjct:    64 FP 65


>sp|Q00534|CDK6_HUMAN CELL DIVISION PROTEIN KINASE 6 (KINASE PLSTIRE)
            >pir||S23387 protein kinase (EC 2.7.1.37) cdk6 - human >gi|36623
            (X66365) serine/threonine protein kinase [Homo sapiens]
            Length = 326

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.031, P = 0.031
 Identities = 20/40 (50%), Positives = 27/40 (67%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP 541
             VD+WS GCIF EM R   LF G+  +DQ  K+L+ ++ LP
Sbjct:   200 VDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILD-VIGLP 238


>gi|16217 (X57840) p34(cdc2)-like protein [Arabidopsis thaliana]
          Length = 170

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.033, P = 0.033
 Identities = 16/28 (57%), Positives = 19/28 (67%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQ 505
             VD+WS GCIF EM+R   LFPG+    Q
Sbjct:    61 VDMWSVGCIFAEMVRRQALFPGDSEFRQ 88


>pir||S57926 protein kinase (EC 2.7.1.37) cdk4 - African clawed frog >gi|897817
            (X89477) cyclin dependent kinase 4 [Xenopus laevis]
            Length = 319

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.039, P = 0.038
 Identities = 20/40 (50%), Positives = 25/40 (62%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP 541
             VDVWS GCIF EM +   LF GN   DQ  K+ + ++ LP
Sbjct:   195 VDVWSAGCIFAEMFKRKPLFCGNSEADQLCKIFD-IIGLP 233


>gnl|PID|d1010243 (D61377) WIPK [Nicotiana tabacum]
            Length = 375

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.039, P = 0.038
 Identities = 20/41 (48%), Positives = 26/41 (63%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP 541
             A+DVWS GCIF E++    LF G DH+ Q  +LL  L+  P
Sbjct:   224 AIDVWSVGCIFMELMNRKPLFGGKDHVHQ-IRLLTELLGTP 263


>pir||A36978 MAP kinase mpk-1 (EC 2.7.1.-) - Caenorhabditis elegans >gi|603527
            (Z46937) F43C1.2 [Caenorhabditis elegans] >gi|861209 (U27124) MPK-1
            [Caenorhabditis elegans]
            Length = 376

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.039, P = 0.038
 Identities = 24/68 (35%), Positives = 37/68 (54%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP---DVHASLAVTVRNYVEI 589
             ++DVWS GCI  EM+    LFPG  ++DQ   +L ++V  P   D+   +    R+Y+  
Sbjct:   211 SIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLIL-AVVGSPSNADLQCIINDKARSYLIS 269

Query:   590 VPF----PW 604
             +P     PW
Sbjct:   270 LPHKPKQPW 278


>sp|Q12222|KOM8_YEAST PROBABLE SERINE/THREONINE-PROTEIN KINASE YOL128C
            >pir||S63442 probable protein kinase YOL128c (EC 2.7.1.-) - yeast
            (Saccharomyces cerevisiae) >gi|1209713 (U41293) putative
            serine/threonine protein kinase [Saccharomyces cerevisiae]
            >gnl|PID|e251913 (Z74870) ORF YOL128c [Saccharomyces cerevisiae]
            Length = 375

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.040, Sum P(2) = 0.039
 Identities = 18/36 (50%), Positives = 24/36 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPG---NDHIDQWTKLL 520
             +D+WS GCI GEMI+G  LF G   N  +++  KLL
Sbjct:   230 IDIWSLGCIIGEMIKGQPLFKGDSANSQLEEIAKLL 265

 Score = 41 (14.4 bits), Expect = 0.040, Sum P(2) = 0.039
 Identities = 10/24 (41%), Positives = 14/24 (58%), Frame = +3

Query:    24 KKMWVYA*IQILLATIIRHTMEIC 95
             K + +Y   QIL A +  H+M IC
Sbjct:   148 KHIKLYT-FQILRALLTLHSMSIC 170


>gnl|PID|e305855 (Y11591) shaggy-like kinase [Ricinus communis]
            Length = 277

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.040, P = 0.039
 Identities = 14/37 (37%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             ++D+WS GC+  E++ G  LFPG + +DQ  +++  L
Sbjct:   118 SIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVL 154


>sp|Q11179|YPC2_CAEEL PUTATIVE SERINE/THREONINE-PROTEIN KINASE C05D10.2 IN
            CHROMOSOME III >gi|532109 (U13645) similar to protein kinases
            [Caenorhabditis elegans]
            Length = 474

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.043, P = 0.042
 Identities = 17/36 (47%), Positives = 26/36 (72%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VD+WS GCI  EM+ G  LFPG+  I+Q  +++N++
Sbjct:   206 VDMWSLGCILAEMLIGRALFPGSSTINQIERIMNTI 241


>gnl|PID|e320985 (Y13437) shaggy-like kinase etha (OSKetha) [Oryza]
            Length = 403

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.044, P = 0.043
 Identities = 20/61 (32%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             ++D+WS GC+  E++ G  LFPG   +DQ  +++   VL       +     NY E   F
Sbjct:   252 SIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIK--VLGTPTREEIRCMNPNYTEF-KF 308

Query:   599 P 601
             P
Sbjct:   309 P 309


>gi|1377890 (L77083) cdc2 gene product [Nicotiana tabacum]
            Length = 293

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.045, P = 0.044
 Identities = 17/31 (54%), Positives = 22/31 (70%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTK 514
             VDVWS GCIF EM+    LFPG+  ID+ ++
Sbjct:   185 VDVWSVGCIFAEMVTQRPLFPGDSEIDELSR 215


>pir||S52095 tau-protein kinase (EC 2.7.1.135) homolog - common tobacco
            >gi|456356 (X77763) shaggy like protein kinase [Nicotiana tabacum]
            >prf||2106142A Ser/Thr protein kinase [Nicotiana tabacum]
            Length = 409

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.045, P = 0.044
 Identities = 15/37 (40%), Positives = 24/37 (64%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             A+D+WS GC+  E++ G  LFPG   +DQ  +++  L
Sbjct:   254 AIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVL 290


>gi|2564701 (AF026546) Cdc2 cyclin-dependent kinase [Pneumocystis carinii]
            Length = 300

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.046, P = 0.045
 Identities = 24/62 (38%), Positives = 35/62 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEI-VP 595
             A+D+WS GCIF EM     LFPG+  ID+  ++   L   PD ++   +T  +Y +    
Sbjct:   184 ALDIWSIGCIFAEMATKKPLFPGDSEIDEIFRIFRILGT-PDENSWPGIT--SYPDFKAT 240

Query:   596 FP-W 604
             FP W
Sbjct:   241 FPKW 244


>gi|2564703 (AF026545) Cdc2 cyclin-dependent kinase [Pneumocystis carinii]
            Length = 300

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.046, P = 0.045
 Identities = 24/62 (38%), Positives = 35/62 (56%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEI-VP 595
             A+D+WS GCIF EM     LFPG+  ID+  ++   L   PD ++   +T  +Y +    
Sbjct:   184 ALDIWSIGCIFAEMATKKPLFPGDSEIDEIFRIFRILGT-PDENSWPGIT--SYPDFKAT 240

Query:   596 FP-W 604
             FP W
Sbjct:   241 FPKW 244


>pir||S51106 shaggy kinase 6 - garden petunia >gi|619896 (X83620) Petunia
            Shaggy kinase 6 [Petunia hybrida]
            Length = 431

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.048, P = 0.047
 Identities = 20/61 (32%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+D+WS GC+  E++ G  LFPG   +DQ  +++   +L       +     NY E   F
Sbjct:   266 AIDMWSAGCVMAELLLGQPLFPGESGVDQLVEIIK--ILGTPTREEIRCMNPNYTEF-KF 322

Query:   599 P 601
             P
Sbjct:   323 P 323


>sp|P14681|KSS1_YEAST MITOGEN-ACTIVATED PROTEIN KINASE KSS1 (MAP KINASE KSS1)
            (KINASE SUPPRESSOR OF SST2) >pir||A33297 probable
            serine/threonine-specific protein kinase KSS1 (EC 2.7.1.-) - yeast
            (Saccharomyces cerevisiae) >gi|172185 (M26398) protein kinase
            [Saccharomyces cerevisiae] >gnl|PID|e243401 (Z72825) ORF YGR040w
            [Saccharomyces cerevisiae]
            Length = 368

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.049, P = 0.048
 Identities = 23/68 (33%), Positives = 33/68 (48%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVL--LPDVHASLAVTVRNYVEIV 592
             A+D+WS GCI  EM+ G  LFPG D+  Q   +L  L      D +   +   + Y+  +
Sbjct:   206 AMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANL 265

Query:   593 PF----PW 604
             P     PW
Sbjct:   266 PMRPPLPW 273


>sp|P39745|SUR1_CAEEL MITOGEN-ACTIVATED PROTEIN KINASE SUR-1 (MAP KINASE SUR-1)
            >pir||A36977 MAP kinase sur-1 (EC 2.7.1.-) - Caenorhabditis elegans
            >gi|433357 (U03879) Sur-1 MAP kinase [Caenorhabditis elegans]
            Length = 444

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.050, P = 0.049
 Identities = 24/68 (35%), Positives = 37/68 (54%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLP---DVHASLAVTVRNYVEI 589
             ++DVWS GCI  EM+    LFPG  ++DQ   +L ++V  P   D+   +    R+Y+  
Sbjct:   279 SIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLIL-AVVGSPSNADLQCIINDKARSYLIS 337

Query:   590 VPF----PW 604
             +P     PW
Sbjct:   338 LPHKPKQPW 346


>gnl|PID|e273936 (Y08607) Shaggy-like kinase 6 [Nicotiana tabacum]
            Length = 471

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.055, P = 0.053
 Identities = 20/61 (32%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+D+WS GC+  E++ G  LFPG   +DQ  +++   +L       +     NY E   F
Sbjct:   323 AIDMWSAGCVMAELLLGQPLFPGESGVDQLVEIIK--ILGTPTREEIRCMNPNYTEF-KF 379

Query:   599 P 601
             P
Sbjct:   380 P 380


>gi|2408067 (Z99165) protein kinase [Schizosaccharomyces pombe]
            Length = 593

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.058, P = 0.056
 Identities = 22/63 (34%), Positives = 33/63 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             AVD+WS GCI  E+  G   F G D I Q  +++  ++  PDVH+        + E+   
Sbjct:   456 AVDIWSAGCIVMELFTGKPFFQGRDEISQ-LEVIYDMMGTPDVHS--------WPEVKNL 506

Query:   599 PWF 607
             PW+
Sbjct:   507 PWY 509


>gnl|PID|e256971 (X99696) shaggy-like protein kinase iota [Arabidopsis
            thaliana] >gi|2444277 (AF019927) GSK3/shaggy-like protein kinase
            [Arabidopsis thaliana]
            Length = 407

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.058, P = 0.056
 Identities = 14/37 (37%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             ++D+WS GC+  E++ G  LFPG + +DQ  +++  L
Sbjct:   251 SIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVL 287


>sp|P48609|CDK5_DROME CELL DIVISION PROTEIN KINASE 5 HOMOLOG >gi|710417
            (U21552) CDK5 homolog [Drosophila melanogaster]
            Length = 294

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.058, P = 0.057
 Identities = 24/66 (36%), Positives = 37/66 (56%), Frame = +2

Query:   407 LALVAVDVWSTGCIFGEMI-RGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT-VRNY 580
             L   ++D+WS GCI  E+   G  LFPG+D +DQ  K+   L   P+  +   V+ + +Y
Sbjct:   178 LYTTSIDMWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGT-PNEDSWPGVSHLSDY 236

Query:   581 VEIVPFP 601
             V +  FP
Sbjct:   237 VALPSFP 243


>pir||S51008 protein kinase (EC 2.7.1.37) cdk5 homolog - fruit fly (Drosophila
            melanogaster) >prf||2102275A Cdk5 gene [Drosophila melanogaster]
            Length = 294

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.058, P = 0.057
 Identities = 24/66 (36%), Positives = 37/66 (56%), Frame = +2

Query:   407 LALVAVDVWSTGCIFGEMI-RGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT-VRNY 580
             L   ++D+WS GCI  E+   G  LFPG+D +DQ  K+   L   P+  +   V+ + +Y
Sbjct:   178 LYTTSIDMWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGT-PNEDSWPGVSHLSDY 236

Query:   581 VEIVPFP 601
             V +  FP
Sbjct:   237 VALPSFP 243


>gnl|PID|e255551 (X99511) CDK5 kinase [Drosophila melanogaster]
            Length = 294

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.058, P = 0.057
 Identities = 24/66 (36%), Positives = 37/66 (56%), Frame = +2

Query:   407 LALVAVDVWSTGCIFGEMI-RGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVT-VRNY 580
             L   ++D+WS GCI  E+   G  LFPG+D +DQ  K+   L   P+  +   V+ + +Y
Sbjct:   178 LYTTSIDMWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGT-PNEDSWPGVSHLSDY 236

Query:   581 VEIVPFP 601
             V +  FP
Sbjct:   237 VALPSFP 243


>pir||S71266 shaggy-like kinase dzeta - Arabidopsis thaliana >gnl|PID|e228498
            (X94938) shaggy-like kinase dzeta [Arabidopsis thaliana]
            >gnl|PID|e281556 (Y09300) serine/threonine kinase [Arabidopsis
            thaliana]
            Length = 412

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.059, P = 0.057
 Identities = 14/37 (37%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             ++D+WS GC+  E++ G  LFPG + +DQ  +++  L
Sbjct:   253 SIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVL 289


>pir||JC4898 minibrain protein - human >gnl|PID|d1013551 (D85759) MNB protein
            kinase [Homo sapiens] >gnl|PID|d1013797 (D86550) serine/threonine
            protein kinase [Homo sapiens]
            Length = 754

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.059, P = 0.057
 Identities = 22/60 (36%), Positives = 32/60 (53%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVP 595
             +A+D+WS GCI  EM  G  LF G + +DQ  K++  L + P      A   R + E +P
Sbjct:   331 LAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP 390


>prf||2208359A protein kinase Dyrk [Rattus norvegicus]
            Length = 763

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.060, P = 0.058
 Identities = 22/60 (36%), Positives = 32/60 (53%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVP 595
             +A+D+WS GCI  EM  G  LF G + +DQ  K++  L + P      A   R + E +P
Sbjct:   340 LAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP 399


>sp|Q13627|MNB_HUMAN SERINE/THREONINE-SPECIFIC PROTEIN KINASE MINIBRAIN HOMOLOG
            (HP86) (DYRK) >gi|1381156 (U58496) hp86 [Homo sapiens]
            Length = 763

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.060, P = 0.058
 Identities = 22/60 (36%), Positives = 32/60 (53%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVP 595
             +A+D+WS GCI  EM  G  LF G + +DQ  K++  L + P      A   R + E +P
Sbjct:   340 LAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFENLP 399


>gi|1381158 (U58497) mp86 [Mus musculus]
            Length = 763

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.060, P = 0.058
 Identities = 22/60 (36%), Positives = 32/60 (53%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVP 595
             +A+D+WS GCI  EM  G  LF G + +DQ  K++  L + P      A   R + E +P
Sbjct:   340 LAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP 399


>gi|1663726 (U52373) MNB [Homo sapiens]
            Length = 763

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.060, P = 0.058
 Identities = 22/60 (36%), Positives = 32/60 (53%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVP 595
             +A+D+WS GCI  EM  G  LF G + +DQ  K++  L + P      A   R + E +P
Sbjct:   340 LAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP 399


>gnl|PID|e1169187 (X79769) Dual Specificity Yak1-related Kinase (Dyrk) [Rattus
            norvegicus]
            Length = 763

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.060, P = 0.058
 Identities = 22/60 (36%), Positives = 32/60 (53%), Frame = +2

Query:   416 VAVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVP 595
             +A+D+WS GCI  EM  G  LF G + +DQ  K++  L + P      A   R + E +P
Sbjct:   340 LAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP 399


>gi|402652 (X73653) tau-protein kinase [Rattus norvegicus]
           Length = 420

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.060, P = 0.059
 Identities = 20/61 (32%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             ++DVWS GC+  E++ G  +FPG+  +DQ  +++   VL       +     NY E   F
Sbjct:   237 SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK--VLGTPTREQIREMNPNYTEF-KF 293

Query:   599 P 601
             P
Sbjct:   294 P 294


>sp|P49841|KG3B_HUMAN GLYCOGEN SYNTHASE KINASE-3 BETA (GSK-3 BETA) >pir||S53324
            protein kinase - human >gi|529237 (L33801) protein kinase [Homo
            sapiens]
            Length = 420

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.060, P = 0.059
 Identities = 20/61 (32%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             ++DVWS GC+  E++ G  +FPG+  +DQ  +++   VL       +     NY E   F
Sbjct:   237 SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK--VLGTPTREQIREMNPNYTEF-KF 293

Query:   599 P 601
             P
Sbjct:   294 P 294


>pir||I51425 intracellular kinase - African clawed frog >gi|727190 (L38492)
            intracellular kinase [Xenopus laevis]
            Length = 420

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.060, P = 0.059
 Identities = 20/61 (32%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             ++DVWS GC+  E++ G  +FPG+  +DQ  +++   VL       +     NY E   F
Sbjct:   237 SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK--VLGTPTREQIREMNPNYTEF-KF 293

Query:   599 P 601
             P
Sbjct:   294 P 294


>pir||I51692 glycogen synthase kinase 3 beta - African clawed frog >gi|1000735
            (U31862) glycogen synthase kinase 3 beta [Xenopus laevis]
            Length = 420

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.060, P = 0.059
 Identities = 20/61 (32%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             ++DVWS GC+  E++ G  +FPG+  +DQ  +++   VL       +     NY E   F
Sbjct:   237 SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK--VLGTPTREQIREMNPNYTEF-KF 293

Query:   599 P 601
             P
Sbjct:   294 P 294


>gnl|PID|e338481 (AJ001275) cdc2-related kinase 3 [Leishmania mexicana]
            Length = 311

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.064, P = 0.062
 Identities = 24/63 (38%), Positives = 32/63 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVR--NYVEIV 592
             AVD+WS GCIF E+ R  VLF G+  I Q  ++   L    D   S     R  +Y ++ 
Sbjct:   201 AVDMWSVGCIFAELARRKVLFRGDSEIGQLFEIFQVLGTPTDTEGSWPGVSRLPDYRDVF 260

Query:   593 PFPW 604
             P  W
Sbjct:   261 P-KW 263


>pir||S71267 shaggy-like kinase etha - Arabidopsis thaliana >gnl|PID|e218591
            (X94939) shaggy-like kinase etha [Arabidopsis thaliana]
            >gnl|PID|e276295 (Y08947) shaggy-like kinase etha [Arabidopsis
            thaliana]
            Length = 380

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.069, P = 0.066
 Identities = 14/37 (37%), Positives = 25/37 (67%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             ++D+WS GC+  E++ G  LFPG + +DQ  +++  L
Sbjct:   221 SIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVL 257


>gnl|PID|e312305 (Y07822) Shaggy-like kinase tetha [Arabidopsis thaliana]
            Length = 472

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.071, P = 0.069
 Identities = 21/61 (34%), Positives = 31/61 (50%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             A+D+WS GC+  E++ G  LFPG   IDQ  +++   +L       +     NY E   F
Sbjct:   319 AIDMWSGGCVMAELLLGQPLFPGESGIDQLVEIIK--ILGTPTREEIRCMNPNYTEF-KF 375

Query:   599 P 601
             P
Sbjct:   376 P 376


>sp|P18265|KG3A_RAT GLYCOGEN SYNTHASE KINASE-3 ALPHA (GSK-3 ALPHA) (FACTOR A)
            (FA) >pir||TVRTKA protein kinase (EC 2.7.1.37) GSK-3-alpha - rat
            >gi|56332 (X53427) glycogen synthase kinase 3 alpha (AA 1 - 483)
            [Rattus norvegicus]
            Length = 483

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.074, P = 0.071
 Identities = 20/61 (32%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             ++DVWS GC+  E++ G  +FPG+  +DQ  +++   VL       +     NY E   F
Sbjct:   300 SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK--VLGTPTREQIREMNPNYTEF-KF 356

Query:   599 P 601
             P
Sbjct:   357 P 357


>sp|P49840|KG3A_HUMAN GLYCOGEN SYNTHASE KINASE-3 ALPHA (GSK-3 ALPHA) >gi|682745
            (L40027) glycogen synthase kinase 3 [Homo sapiens]
            Length = 483

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.074, P = 0.071
 Identities = 20/61 (32%), Positives = 32/61 (52%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVHASLAVTVRNYVEIVPF 598
             ++DVWS GC+  E++ G  +FPG+  +DQ  +++   VL       +     NY E   F
Sbjct:   300 SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK--VLGTPTREQIREMNPNYTEF-KF 356

Query:   599 P 601
             P
Sbjct:   357 P 357


>gi|1658064 (U74762) cdc2-related protein kinase 2 [Trypanosoma cruzi]
            Length = 301

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.079, P = 0.076
 Identities = 17/36 (47%), Positives = 23/36 (63%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             VD+WS GCIF EM+ G+ LF G +  DQ  ++   L
Sbjct:   184 VDIWSVGCIFAEMVIGAPLFAGKNDADQLLRIFRFL 219


>sp|P25859|CC2B_ARATH CELL DIVISION CONTROL PROTEIN 2 HOMOLOG B >pir||S23096
            protein kinase (EC 2.7.1.37) cdc2 homolog B - Arabidopsis thaliana
            >gnl|PID|d1002099 (D10851) p32 protein serine/threonine
            kinase-related protein [Arabidopsis thaliana]
            Length = 309

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.083, P = 0.080
 Identities = 16/28 (57%), Positives = 19/28 (67%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQ 505
             VD+WS GCIF EM+R   LFPG+    Q
Sbjct:   200 VDMWSVGCIFAEMVRRQALFPGDSEFQQ 227


>sp|P36005|KKQ1_YEAST PROBABLE SERINE/THREONINE-PROTEIN KINASE YKL161C
            >pir||S37790 probable serine/threonine-specific protein kinase (EC
            2.7.1.-) - yeast (Saccharomyces cerevisiae) >gi|407487 (Z26877)
            unknown [Saccharomyces cerevisiae] >gi|486281 (Z28161) ORF YKL161c
            [Saccharomyces cerevisiae] >prf||2118404E ORF [Saccharomyces
            cerevisiae]
            Length = 433

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.083, P = 0.080
 Identities = 20/57 (35%), Positives = 31/57 (54%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPD--VHASLAVTVRNYV 583
             AVD+WSTGCI  E++    +F G D++D    +L  L   P+  +    +  V NY+
Sbjct:   213 AVDIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQEIASQKVYNYI 269


>gi|1695919 (U73195) MO15-related protein kinase Pfmrk [Plasmodium falciparum]
            Length = 324

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.090, P = 0.086
 Identities = 16/33 (48%), Positives = 23/33 (69%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKL 517
             ++D+WS GCIF E++    LFPG + IDQ  K+
Sbjct:   205 SIDMWSFGCIFAELLLQKALFPGENEIDQLGKI 237


>sp|P27704|ERK3_RAT EXTRACELLULAR SIGNAL-REGULATED KINASE 3 (ERK3) (P55-MAPK)
            Length = 720

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.095, P = 0.091
 Identities = 19/44 (43%), Positives = 27/44 (61%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVH 550
             A+D+W+ GCIF EM+ G  LF G   ++Q   +L S+   P VH
Sbjct:   212 AIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESI---PVVH 252


>sp|Q16659|ERK3_HUMAN EXTRACELLULAR SIGNAL-REGULATED KINASE 3 (ERK3) (MAP
            KINASE ISOFORM P97) (P97-MAPK) >pir||A56352 mitogen-activated
            protein kinase p97(MAPK) (EC 2.7.1.-) - human >gi|763113 (X80692)
            p97mapk [Homo sapiens] >gi|1294779 (L77964) ERK3 protein kinase
            [Homo sapiens]
            Length = 721

  Plus Strand HSPs:

 Score = 100 (35.2 bits), Expect = 0.096, P = 0.091
 Identities = 19/44 (43%), Positives = 27/44 (61%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSLVLLPDVH 550
             A+D+W+ GCIF EM+ G  LF G   ++Q   +L S+   P VH
Sbjct:   212 AIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESI---PVVH 252


>pir||S10931 probable protein kinase zeste-white3 (EC 2.7.1.-) (clone cOV7) -
            fruit fly (Drosophila melanogaster) (fragment) >gi|8860 (X54005)
            protein kinase [Drosophila melanogaster] >prf||1611405A
            zeste-white3 gene [Drosophila sp.]
            Length = 289

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.098, P = 0.093
 Identities = 14/36 (38%), Positives = 24/36 (66%), Frame = +2

Query:   422 VDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             +DVWS GC+  E++ G  +FPG+  +DQ  +++  L
Sbjct:   236 IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVL 271


>dbj||D87271_1 (D87271) ERK2 [Mus musculus]
            Length = 291

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.099, P = 0.094
 Identities = 15/37 (40%), Positives = 23/37 (62%), Frame = +2

Query:   419 AVDVWSTGCIFGEMIRGSVLFPGNDHIDQWTKLLNSL 529
             ++D+WS GCI  EM+    +FPG  ++DQ   +L  L
Sbjct:   206 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL 242


WARNING:  HSPs involving 135 database sequences were not reported due to the
          limiting value of parameter B = 250.


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=6.00
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.352   0.152   0.551
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.347   0.154   0.519
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.365   0.158   0.671
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.354   0.154   0.587
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.355   0.156   0.531
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.342   0.143   0.472
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      203       203      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   +2      0      203       203      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   +1      0      203       203      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   -1      0      203       203      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   -2      0      203       203      10. 62 3  12 22   0.095 35
                                                  31    0.11 38
   -3      0      203       203      10. 62 3  12 22   0.095 35
                                                  31    0.11 38


Statistics:

  Database:  ../../_tempdbs/nrdb
    Title:  ../../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  385
  No. of states in DFA:  593 (58 KB)
  Total size of DFA:  248 KB (256 KB)
  Time to generate neighborhood:  0.03u 0.00s 0.03t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  146.04u 0.62s 146.66t  Elapsed: 00:00:29
  Total cpu time:  146.26u 0.73s 146.99t  Elapsed: 00:00:29
  Start:  Wed Feb  4 20:16:29 1998   End:  Wed Feb  4 20:16:58 1998

WARNINGS ISSUED:  1

Date: 17:19:50 on Mon 18 Dec 117.