blastx_gbnr_files/CBrugiaQ_2523_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CBrugiaQ_2523
        (792 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|1825580           (U88165) similar to troponins [Ca... +3   782  4.4e-77   1
A sp|Q09665|YS57_CAEEL HYPOTHETICAL CALCIUM-BINDING PROT... +3   432  5.3e-40   1
A sp|P15159|TPC_TACTR  TROPONIN C >pir||JX0072 troponin ... +3   349  3.3e-31   1
A sp|P29290|TPCA_HOMAM TROPONIN C, ISOFORM 2A >pir||S184... +3   345  8.9e-31   1
A sp|P47948|TPC2_DROME TROPONIN C, ISOFORM 47D >pir||S38... +3   342  1.8e-30   1
A sp|P47949|TPC3_DROME TROPONIN C, ISOFORM 73F >pir||S38... +3   340  3.0e-30   1
A sp|P29289|TPC1_HOMAM TROPONIN C, ISOFORM 1 >pir||S1839... +3   336  8.0e-30   1
A sp|P29291|TPCB_HOMAM TROPONIN C, ISOFORM 2B >pir||S184... +3   334  1.3e-29   1
A sp|P06707|TPC1_PONLE TROPONIN C, ISOTYPE ALPHA            +3   328  5.6e-29   1
A pir||A34380          troponin C alpha - narrow-fingere... +3   328  5.6e-29   1
A sp|P06708|TPC2_PONLE TROPONIN C, ISOTYPE GAMMA            +3   325  1.2e-28   1
A sp|P21798|TPC2_BALNU TROPONIN C, ISOFORM 2                +3   325  1.2e-28   1
A pir||B34380          troponin C gamma - narrow-fingere... +3   325  1.2e-28   1
A pir||B38397          troponin C-2 - giant barnacle        +3   325  1.2e-28   1
A sp|P21797|TPC1_BALNU TROPONIN C, ISOFORM 1 >pir||A3839... +3   323  1.9e-28   1
A sp|P47947|TPC1_DROME TROPONIN C, ISOFORM 41C >gi|45238... +3   314  1.7e-27   1
A sp|P02594|CALM_ELEEL CALMODULIN >pir||MCEE calmodulin ... +3   284  2.6e-24   1
A sp|P02593|CALM_HUMAN CALMODULIN >pir||MCHU calmodulin ... +3   284  2.6e-24   1
A pir||MCBO            calmodulin - bovine >pir||MCON ca... +3   284  2.6e-24   1
A pdb|1CDL|A           Homo sapiens >pdb|1CDL|B Homo sap... +3   284  2.6e-24   1
A pdb|1CDM|A           Bos taurus                           +3   283  3.3e-24   1
A sp|P04465|CALM_TRYBB CALMODULIN >pir||MCUTG calmodulin... +3   281  5.4e-24   1
A sp|P21251|CALM_STIJA CALMODULIN >pir||MCSFCU calmoduli... +3   281  5.4e-24   1
A sp|P18061|CALM_TRYCR CALMODULIN >pir||MCUTC calmodulin... +3   280  6.8e-24   1
A gi|208092            (M11334) synthetic calmodulin [Ar... +3   280  6.8e-24   1
A gnl|PID|e321197      (Y13578) calmodulin [Ciona intest... +3   279  8.7e-24   1
A pir||MCRB            calmodulin - rabbit >pdb|2CLN|  N... +3   279  8.7e-24   1
A gi|170076            (L01433) calmodulin [Glycine max]... +3   278  1.1e-23   1
A pir||S02690          calmodulin A - sea urchin (Arbaci... +3   278  1.1e-23   1
A pir||I49567          calmodulin - mouse >gi|469422 (M1... +3   278  1.1e-23   1
A sp|P11118|CALM_EUGGR CALMODULIN >pir||MCEG calmodulin ... +3   277  1.4e-23   1
A gi|2291247           (AF016429) similar to EF-hand cal... +3   277  1.4e-23   1
A sp|P07181|CALM_DROME CALMODULIN >pir||MCFF calmodulin ... +3   277  1.4e-23   1
A pir||MCLQ            calmodulin - migratory locust >pd... +3   277  1.4e-23   1
A gnl|PID|d1001665     (D10363) calmodulin [Oryzias lati... +3   277  1.4e-23   1
A pdb|1DEG|            Calmodulin Mutant With Glu 84 Del... +3   277  1.4e-23   1
A pir||MCJZR           calmodulin - sea pansy (Renilla r... +3   277  1.4e-23   1
A sp|Q03509|CAL6_ARATH CALMODULIN-6 >pir||S35187 calmodu... +3   276  1.8e-23   1
A prf||0409298A        troponin C-like protein [Bos taurus] +3   276  1.8e-23   1
A sp|P02597|CALS_CHICK CALMODULIN, STRIATED MUSCLE >pir|... +3   276  1.8e-23   1
A sp|P04352|CALM_CHLRE CALMODULIN >pir||MCKM calmodulin ... +3   276  1.8e-23   1
A sp|P11121|CALM_PYUSP CALMODULIN >pir||MCAZS calmodulin... +3   276  1.8e-23   1
A sp|P11120|CALM_PLECO CALMODULIN >pir||MCMRP calmodulin... +3   275  2.3e-23   1
A prf||1206346A        calmodulin [Chlamydomonas reinhar... +3   275  2.3e-23   1
A prf||0608335A        calmodulin [Bos taurus]              +3   275  2.3e-23   1
A gi|162030            (K02944) calmodulin A [Trypanosom... +3   274  3.0e-23   1
A sp|P04353|CALM_SPIOL CALMODULIN >pir||MCSP calmodulin ... +3   274  3.0e-23   1
A sp|P25069|CAL2_ARATH CALMODULIN-2/3/5 >pir||S22503 cal... +3   274  3.0e-23   1
A pir||MCDO            calmodulin - slime mold (Dictyost... +3   274  3.0e-23   1
A sp|P17928|CALM_MEDSA CALMODULIN >pir||MCAA calmodulin ... +3   273  3.8e-23   1
A sp|Q03510|CAL4_ARATH CALMODULIN-4 >pir||S35185 calmodu... +3   273  3.8e-23   1
A sp|P27164|CAL3_PETHY CALMODULIN-RELATED PROTEIN >gi|16... +3   273  3.8e-23   1
A sp|P27162|CAL1_PETHY CALMODULIN 1 >pir||MCPZDC calmodu... +3   273  3.8e-23   1
A sp|P19533|CALM_EMENI CALMODULIN >pir||MCAS calmodulin ... +3   273  3.8e-23   1
A sp|P04630|CALL_CAEEL CALMODULIN-LIKE PROTEIN >pir||A24... +3   273  3.8e-23   1
A gnl|PID|e255885      (Z77653) C13C12.1 [Caenorhabditis... +3   273  3.8e-23   1
A sp|P41041|CALM_PNECA CALMODULIN >pir||JN0722 calmoduli... +3   273  3.8e-23   1
A sp|P02596|CALM_METSE CALMODULIN >pir||MCXAM calmodulin... +3   273  3.8e-23   1
A gi|20186             (X65016) calmodulin [Oryza sativa]   +3   272  4.8e-23   1
A sp|P13565|CALM_HORVU CALMODULIN >sp|P29612|CALM_ORYSA ... +3   272  4.8e-23   1
A gi|1773321           (U79736) calmodulin [Helianthus a... +3   272  4.8e-23   1
A pir||S58311          calmodulin - Bidens pilosa >gi|93... +3   272  4.8e-23   1
A gi|166655            (M73712) calmodulin-3 [Arabidopsi... +3   272  4.8e-23   1
A gi|535428            (U13736) calmodulin-like protein ... +3   271  6.2e-23   1
A sp|P27165|CALM_PHYIN CALMODULIN >gi|169306 (M83535) ca... +3   271  6.2e-23   1
A sp|P02599|CALM_DICDI CALMODULIN >gi|290034 (M64089) ca... +3   271  6.2e-23   1
A gnl|PID|e248485      (X98404) calmodulin-2 [Capsicum a... +3   271  6.2e-23   1
A sp|P02595|CALM_PATSP CALMODULIN >pir||MCSW calmodulin ... +3   271  6.2e-23   1
A prf||1003191A        calmodulin [Oryctolagus cuniculus]   +3   271  6.2e-23   1
A gi|825635            (X52606) calmodulin [Homo sapiens]   +3   271  6.2e-23   1
A gnl|PID|e267602      (Y08373) calmodulin [Toxoplasma g... +3   270  7.9e-23   1
A gi|1835521           (U83402) calmodulin [Capsicum ann... +3   270  7.9e-23   1
A gi|1754999           (U48691) calmodulin TaCaM2-2 [Tri... +3   270  7.9e-23   1
A pir||JC1094          calmodulin - rice                    +3   270  7.9e-23   1
A pir||S53019          calmodulin - Macrocystis pyrifera... +3   270  7.9e-23   1
A sp|Q02052|CALM_NEUCR CALMODULIN >pir||S58709 calmoduli... +3   269  1.0e-22   1
A pir||S51933          calmodulin cam2 - maize >gi|74791... +3   269  1.0e-22   1
A pir||S22860          calmodulin 2 (clone lambda DASH) ... +3   269  1.0e-22   1
A pir||S60237          calmodulin (clone PCM5) - potato ... +3   269  1.0e-22   1
A pdb|1AHR|            Calmodulin Mutant With A Two Resi... +3   269  1.0e-22   1
A gi|289525            (L14071) calmodulin [Bryonia dioica] +3   268  1.3e-22   1
A bbs|150395           calmodulin {D to N substitution a... +3   268  1.3e-22   1
A sp|P05932|CALL_ARBPU CALMODULIN BETA >pir||S02691 calm... +3   268  1.3e-22   1
A gi|1235664           (U37936) novel calmodulin-like pr... +3   267  1.6e-22   1
A gnl|PID|d1014428     (D88977) troponin C [Branchiostom... +3   266  2.1e-22   1
A gi|1421816           (U62865) calmodulin-like protein ... +3   266  2.1e-22   1
A gi|168777            (L02963) calmodulin [Neurospora c... +3   266  2.1e-22   1
A sp|P41040|CALM_MAIZE CALMODULIN >pir||S40086 calmoduli... +3   266  2.1e-22   1
A sp|P27482|CALL_HUMAN CALMODULIN-RELATED PROTEIN NB-1 (... +3   266  2.1e-22   1
A sp|P04464|CALM_WHEAT CALMODULIN >pir||MCWT calmodulin ... +3   264  3.4e-22   1
A pir||S51932          calmodulin cam1 - maize >gi|74791... +3   264  3.4e-22   1
A sp|P53440|CALF_NAEGR CALMODULIN, FLAGELLAR (CAM-1) >gi... +3   264  3.4e-22   1
A gi|587454            (X80231) calmodulin [Sauroleishma... +3   263  4.3e-22   1
A sp|P27166|CALM_STYLE CALMODULIN >pir||JC1309 calmoduli... +3   263  4.3e-22   1
A sp|P24044|CALM_PLAFA CALMODULIN >pir||MCZQF calmodulin... +3   263  4.3e-22   1
A pir||MCTE            calmodulin - Tetrahymena pyriform... +3   263  4.3e-22   1
A sp|P02598|CALM_TETPY CALMODULIN                           +3   263  4.3e-22   1
A gnl|PID|e238630      (X97558) calmodulin-1 [Capsicum a... +3   263  4.3e-22   1
A pdb|1CLM|            Calmodulin (Paramecium Tetraureli... +3   263  4.3e-22   1
A gi|16225             (Z12023) calmodulin [Arabidopsis ... +3   263  4.3e-22   1
A gi|167676            (M13009) calmodulin [Dictyosteliu... +3   263  4.3e-22   1
A sp|P05419|CALN_CHICK NEO-CALMODULIN (NEOCAM) >pir||A29... +3   263  4.3e-22   1
A sp|P48976|CALM_MALDO CALMODULIN >gi|505152 (X60737) Ca... +3   263  4.3e-22   1
A pir||S58314          calmodulin - moss (Physcomitrella... +3   262  5.5e-22   1
A gi|2267084           (AF007889) calmodulin [Symbiodini... +3   262  5.5e-22   1
A pir||JC1033          calmodulin - garden pea              +3   260  9.0e-22   1
A sp|P07463|CALM_PARTE CALMODULIN >pir||MCPP calmodulin ... +3   260  9.0e-22   1
A pdb|1OSA|            Calmodulin                           +3   260  9.0e-22   1
A gi|2589016           (AB008556) troponin C [Lampetra j... +3   260  9.0e-22   1
A sp|P27163|CAL2_PETHY CALMODULIN 2 >pir||S70767 calmodu... +3   259  1.2e-21   1
A sp|P05933|CALM_SCHPO CALMODULIN >pir||MCZP calmodulin ... +3   259  1.2e-21   1
A prf||1803520B        calmodulin 1 [Arabidopsis thaliana]  +3   258  1.5e-21   1
A sp|P25854|CAL1_ARATH CALMODULIN-1 >gi|166649 (M38379) ... +3   258  1.5e-21   1
A gnl|PID|e238792      (X97612) CaMF-1 [Fagus sylvatica]    +3   257  1.9e-21   1
A sp|P27161|CALM_LYCES CALMODULIN >gi|170396 (M67472) ca... +3   257  1.9e-21   1
A gnl|PID|d1014427     (D88976) troponin C [Branchiostom... +3   256  2.4e-21   1
A gi|310563            (L19359) calmodulin [Glycine max]... +3   256  2.4e-21   1
A pir||JU0232          calmodulin - fungus (Fusarium oxy... +3   256  2.4e-21   1
A sp|P15094|CALM_ACHKL CALMODULIN >pir||MCUMAK calmoduli... +3   255  3.1e-21   1
A gnl|PID|e327459      (Z97336) calmodulin [Arabidopsis ... +3   253  5.0e-21   1
A sp|P14533|CABO_LOLPE SQUIDULIN (OPTIC LOBE CALCIUM-BIN... +3   252  6.3e-21   1
A gi|1572783           (U70851) similar to calmodulin-li... +3   251  8.1e-21   1
A gi|1399216           (U57550) calmodulin-like myosin-l... +3   250  1.0e-20   1
A gnl|PID|e330443      (Z82282) T07G12.1 [Caenorhabditis... +3   250  1.0e-20   1
A gi|9874              (X56950) calmodulin [Plasmodium f... +3   249  1.3e-20   1
A sp|Q06827|CATR_SCHDU CALTRACTIN (CENTRIN) >pir||S42551... +3   247  2.1e-20   1
A gi|2589014           (AB008555) troponin C [Lampetra j... +3   247  2.1e-20   1
A gnl|PID|d1020515     (AB003079) fast skeletal troponin... +3   245  3.5e-20   1
A gi|666076            (X83765) centrin [Micromonas pusi... +3   245  3.5e-20   1
A gnl|PID|d1020514     (AB003078) fast skeletal troponin... +3   244  4.5e-20   1
A prf||731112A         troponin C [Oryctolagus cuniculus]   +3   244  4.5e-20   1
A sp|P43646|CATR_TETST CALTRACTIN (CENTRIN)                 +3   243  5.7e-20   1
A sp|P02589|TPCS_RANES TROPONIN C, SKELETAL MUSCLE >pir|... +3   243  5.7e-20   1
A sp|P49258|CALL_DROME CALMODULIN RELATED PROTEIN 97A (A... +3   243  5.7e-20   1
A sp|P43645|CATR_SPESI CALTRACTIN (CENTRIN)                 +3   242  7.3e-20   1
A gnl|PID|e227640      (Z70034) C18E9.1 [Caenorhabditis ... +3   242  7.3e-20   1
A gi|1017791           (U37538) centrin [Xenopus laevis]    +3   242  7.3e-20   1
A sp|Q12798|CAT2_HUMAN CALTRACTIN, ISOFORM 2 (CENTRIN) >... +3   241  9.3e-20   1
A sp|P02586|TPCS_RABIT TROPONIN C, SKELETAL MUSCLE >pir|... +3   240  1.2e-19   1
A sp|P02585|TPCS_HUMAN TROPONIN C, SKELETAL MUSCLE >pir|... +3   239  1.5e-19   1
A sp|P80322|TPC_BRALA  TROPONIN C >pir||S43240 troponin ... +3   238  1.9e-19   1
A prf||0408496A        troponin C [Oryctolagus cuniculus]   +3   238  1.9e-19   1
A sp|P09860|TPCC_CHICK TROPONIN C, SLOW SKELETAL AND CAR... +3   238  1.9e-19   1
A gi|1220372           (M22307) troponin C [Homo sapiens]   +3   238  1.9e-19   1
A pdb|5TNC|            Troponin-C                           +3   238  1.9e-19   1
A pdb|1TNC|            Troponin (Calcium-Binding Compone... +3   237  2.5e-19   1
A sp|P19123|TPCC_MOUSE TROPONIN C, SLOW SKELETAL AND CAR... +3   237  2.5e-19   1
A sp|P02591|TPCC_RABIT TROPONIN C, SLOW SKELETAL AND CAR... +3   237  2.5e-19   1
A sp|P02590|TPCC_HUMAN TROPONIN C, SLOW SKELETAL AND CAR... +3   237  2.5e-19   1
A gi|508526            (L31642) calmodulin [Mus musculus]   +3   236  3.1e-19   1
A sp|P54213|CATR_DUNSA CALTRACTIN (CENTRIN) >gi|1293682 ... +3   236  3.1e-19   1
A sp|P23286|CALM_CANAL CALMODULIN                           +3   236  3.1e-19   1
A sp|P20801|TPCS_MOUSE TROPONIN C, SKELETAL MUSCLE (STNC... +3   236  3.1e-19   1
A sp|P41209|CATR_MOUSE CALTRACTIN (CENTRIN) >pir||S38531... +3   235  4.0e-19   1
A pir||TPPGCS          troponin C, skeletal muscle - pig    +3   235  4.0e-19   1
A sp|P02587|TPCS_PIG   TROPONIN C, SKELETAL MUSCLE          +3   235  4.0e-19   1
A pdb|1TOP|            Troponin C >pdb|1NCY|  Troponin-C... +3   235  4.0e-19   1
A sp|P10246|TPCS_MELGA TROPONIN C, SKELETAL MUSCLE >pir|... +3   235  4.0e-19   1
A sp|P02588|TPCS_CHICK TROPONIN C, SKELETAL MUSCLE >pir|... +3   235  4.0e-19   1
A gi|665656            (X83766) centrin [Pterosperma cri... +3   234  5.1e-19   1
A sp|P41208|CAT1_HUMAN CALTRACTIN, ISOFORM 1 (CENTRIN) >... +3   234  5.1e-19   1
A pir||MCCKA           calmodulin - yeast (Candida albic... +3   233  6.5e-19   1
A gi|1754997           (U48690) calmodulin TaCaM2-1 [Tri... +3   233  6.5e-19   1
A pdb|4TNC|            Troponin C                           +3   233  6.5e-19   1
A gnl|PID|d1020516     (AB003080) cardiac troponin C [Xe... +3   233  6.5e-19   1
A pir||S60234          calmodulin (clone PCM2) - potato ... +3   232  8.4e-19   1
A gi|2460249           (AF020769) cardiac ventricular tr... +3   232  8.4e-19   1
A gi|212778            (M19027) troponin C [Gallus gallus]  +3   232  8.4e-19   1
A pdb|1TNX|            Ef-Hand Mol_id: 1; Molecule: Trop... +3   232  8.4e-19   1
A gnl|PID|e238629      (X97546) CaMF gene product [Fagus... +3   231  1.1e-18   1
A sp|P41210|CATR_ATRNU CALTRACTIN (CENTRIN) >prf||190639... +3   229  1.7e-18   1
A bbs|154098           troponin C, TnC [Anguilla anguill... +3   228  2.2e-18   1
A gi|1785955           (U38786) calmodulin [Trichomonas ... +3   228  2.2e-18   1
A gi|1666242           (U59300) centrin [Giardia intesti... +3   227  2.8e-18   1
A sp|P05936|TPCC_COTJA TROPONIN C, SLOW SKELETAL AND CAR... +3   227  2.8e-18   1
A gi|972430            (F14583) calmodulin [Sus scrofa]     +3   226  3.6e-18   1
A gnl|PID|d1014325     (D88494) troponin C [Halocynthia ... +3   225  4.6e-18   1
A gnl|PID|e314005      (Y12473) centrin [Homo sapiens]      +3   224  5.9e-18   1
A gnl|PID|e314006      (Y12474) centrin [Mus musculus]      +3   224  5.9e-18   1
A gnl|PID|d1014326     (D88495) troponin C [Halocynthia ... +3   224  5.9e-18   1
A sp|P53441|CATR_NAEGR CALTRACTIN (CENTRIN) >gi|972963 (... +3   223  7.5e-18   1
A sp|Q11083|YT67_CAEEL HYPOTHETICAL CALCIUM-BINDING PROT... +3   220  1.6e-17   1
A pir||S60235          calmodulin (clone PCM3) - potato ... +3   220  1.6e-17   1
A gi|213622            (M29722) troponin C [Coturnix cot... +3   220  1.6e-17   1
A sp|Q24956|CATR_GIALA CALTRACTIN (CENTRIN) >gi|1399341 ... +3   215  5.3e-17   1
A gnl|PID|d1008877     (D45848) calmodulin-related prote... +3   214  6.8e-17   1
A gi|598067            (L34546) calmodulin-related prote... +3   214  6.8e-17   1
A gnl|PID|e340031      (Y14764) calmodulin [Lycopersicon... +3   214  6.8e-17   1
A gi|2213610           (AC000103) F21J9.4 [Arabidopsis t... +3   213  8.6e-17   1
A gnl|PID|e353158      (Z99707) caltractin [Arabidopsis ... +3   213  8.6e-17   1
A sp|P05434|CATR_CHLRE CALTRACTIN (CENTRIN) (20 KD CALCI... +3   212  1.1e-16   1
A sp|P14649|MLEY_HUMAN MYOSIN LIGHT CHAIN 1, SLOW-TWITCH... +3   208  2.9e-16   1
A gi|2583169           (AF026473) calmodulin-related pro... +3   207  3.7e-16   1
A sp|P15845|SM20_SCHMA 20 KD CALCIUM-BINDING PROTEIN (AN... +3   205  6.1e-16   1
A gnl|PID|e333742      (AJ001092) calmodulin-like protei... +3   203  9.9e-16   1
A gi|17352             (Z18162) calmodulin 1 [Arabidopsi... +3   203  9.9e-16   1
A sp|P06706|TPC_HALRO  TROPONIN C, BODY WALL MUSCLE >pir... +3   203  9.9e-16   1
A sp|P30187|CBP2_ARATH 22 KD CALMODULIN-LIKE CALCIUM-BIN... +3   200  2.1e-15   1
A gi|2288981           (AC002335) calcium binding protei... +3   198  3.3e-15   1
A pir||S45681          troponin C - scallop (Chlamys nip... +3   198  3.3e-15   1
A sp|P06704|CC31_YEAST CELL DIVISION CONTROL PROTEIN 31 ... +3   193  1.1e-14   1
A gnl|PID|e340032      (Y14765) calmodulin [Lycopersicon... +3   192  1.4e-14   1
A gi|1339865           (D85139) fast skeletal myosin lig... +3   192  1.4e-14   1
A sp|P05976|MLE1_HUMAN MYOSIN LIGHT CHAIN 1, SKELETAL MU... +3   191  1.8e-14   1
A gi|1276637           (U35396) centrin ICL1c [Parameciu... +3   190  2.4e-14   1
A gi|1276639           (U35397) centrin ICL1b [Parameciu... +3   190  2.4e-14   1
A gi|1667586           (U76540) ICL1d centrin [Parameciu... +3   190  2.4e-14   1
A sp|Q27179|CAT2_PARTE CALTRACTIN ICL1B (CENTRIN)           +3   190  2.4e-14   1
A sp|Q27178|CAT3_PARTE CALTRACTIN ICL1C (CENTRIN)           +3   190  2.4e-14   1
A sp|Q27177|CAT1_PARTE CALTRACTIN ICL1A (CENTRIN) >gi|12... +3   189  3.0e-14   1
A sp|P54357|MLE2_DROME MYOSIN II ESSENTIAL LIGHT CHAIN (... +3   189  3.0e-14   1
A gi|1181841           (U45430) fast-twitch myosin light... +3   189  3.0e-14   1
A gi|1339869           (D85141) fast skeletal myosin lig... +3   188  3.8e-14   1
A sp|P35622|TPC_PATYE  TROPONIN C (TN-C) >pir||A53051 tr... +3   187  4.9e-14   1
A sp|P02604|MLE1_CHICK MYOSIN LIGHT CHAIN 1, SKELETAL MU... +3   187  4.9e-14   1
A gi|602988            (L38596) MLC1f/3f gene product [X... +3   187  4.9e-14   1
A pir||MOCHLA          myosin alkali light chain 1, fast... +3   187  4.9e-14   1
A gi|2183227           (AF001981) calmodulin-like protei... +3   186  6.3e-14   1
A gi|171189            (M14078) Ca2+-binding protein [Sa... +3   186  6.3e-14   1
A prf||2112200A        myosin:SUBUNIT=light chain 1 [Bos... +3   186  6.3e-14   1
A gi|1339867           (D85140) fast skeletal myosin lig... +3   186  6.3e-14   1
A gi|1654359           (U67860) myosin IC light chain [A... +3   185  8.0e-14   1
A prf||1810397A        myosin:SUBUNIT=light chain:ISOTYP... +3   184  1.0e-13   1
A sp|P02602|MLE1_RABIT MYOSIN LIGHT CHAIN 1, SKELETAL MU... +3   184  1.0e-13   1
A gi|188590            (M31212) myosin light chain 3 [Ho... +3   184  1.0e-13   1
A sp|P06741|MLE3_HUMAN MYOSIN LIGHT CHAIN 3, SKELETAL MU... +3   184  1.0e-13   1
A gi|212347            (J00887) myosin a1 light chain (p... +3   184  1.0e-13   1
A sp|P42322|CALB_NAEGR CALCINEURIN B SUBUNIT (PROTEIN PH... +3   183  1.3e-13   1
A bbs|166470           (S77858) non-muscle myosin alkali... +3   183  1.3e-13   1
A gi|205474            (L00088) myosin light chain [Ratt... +3   182  1.7e-13   1
A sp|P02600|MLE1_RAT   MYOSIN LIGHT CHAIN 1, SKELETAL MU... +3   182  1.7e-13   1
A pir||MORTA1          myosin alkali light chain 1, fast... +3   182  1.7e-13   1
A sp|P16475|MLEN_HUMAN MYOSIN LIGHT CHAIN ALKALI, NON-MU... +3   182  1.7e-13   1
A sp|P24572|MLES_HUMAN MYOSIN LIGHT CHAIN ALKALI, SMOOTH... +3   182  1.7e-13   1
A sp|P02605|MLE3_CHICK MYOSIN LIGHT CHAIN 3, SKELETAL MU... +3   182  1.7e-13   1
A pir||JC5174          calcineurin B - fruit fly (Drosop... +3   180  2.7e-13   1
A pir||I57590          myosin light chain MLC1-f - rat >... +3   180  2.7e-13   1
A sp|P02607|MLES_CHICK MYOSIN LIGHT CHAIN ALKALI, SMOOTH... +3   180  2.7e-13   1
A sp|P08296|MLEN_CHICK MYOSIN LIGHT CHAIN ALKALI, NON-MU... +3   180  2.7e-13   1
A gi|1314712           (U54615) calcium-dependent protei... +3   179  3.5e-13   1
A pir||JC1221          calcineurin B beta-2 - mouse >bbs... +3   179  3.5e-13   1
A sp|P05977|MLE1_MOUSE MYOSIN LIGHT CHAIN 1, SKELETAL MU... +3   179  3.5e-13   1
A gi|212349            (J00888) myosin a2 light chain [G... +3   179  3.5e-13   1
A pir||MOCH6N          myosin alkali light chain 6, nonm... +3   179  3.5e-13   1
A gnl|PID|e311091      (Z93780) myosin light chain [Fugu... +3   179  3.5e-13   1
A pir||MOCHG2          myosin alkali light chain 6, smoo... +3   179  3.5e-13   1
A gnl|PID|e353289      (AJ001919) calmodulin [Branchiost... +3   178  4.4e-13   1
A sp|P48451|CALB_DROME CALCINEURIN B SUBUNIT, ISOFORM 1 ... +3   178  4.4e-13   1
A sp|P02603|MLE3_RABIT MYOSIN LIGHT CHAIN 3, SKELETAL MU... +3   177  5.6e-13   1
pir||MOCHA2          myosin alkali light chain 1, fast... +3   177  5.6e-13   1
pir||JX0214          myosin catalytic light chain LC17... +3   176  7.2e-13   1
pir||JX0215          myosin catalytic light chain LC17... +3   176  7.2e-13   1
gi|602760            (L38595) MLC1f/3f gene product [X... +3   176  7.2e-13   1
pir||A23253          myosin A1 catalytic light chain, ... +3   176  7.2e-13   1
gi|1118128           (U41625) Similar to calmodulin ca... +3   183  8.2e-13   1
gnl|PID|e246045      (X94689) myosin light chain [Sus ... +3   175  9.2e-13   1
sp|P28470|CBLP_RAT   CALCINEURIN B-LIKE PROTEIN (CBLP)... +3   174  1.2e-12   1
sp|P16409|MLEV_RAT   MYOSIN LIGHT CHAIN 1, SLOW-TWITCH... +3   174  1.2e-12   1
sp|P02606|MLEC_CHICK MYOSIN LIGHT CHAIN 1, CARDIAC MUS... +3   174  1.2e-12   1
pdb|2MYS|C           Gallus gallus                        +3   174  1.2e-12   1
sp|Q24214|CALC_DROME CALCINEURIN B SUBUNIT, ISOFORM 2 ... +3   173  1.5e-12   1
pir||MOHU6E          myosin alkali light chain 6, eye ... +3   172  1.9e-12   1
sp|P02601|MLE3_RAT   MYOSIN LIGHT CHAIN 3, SKELETAL MU... +3   172  1.9e-12   1
sp|P07462|MLE_HALRO  MYOSIN CATALYTIC LIGHT CHAIN, SMO... +3   172  1.9e-12   1
gi|212330            (K02610) myosin light chain 1f [G... +3   172  1.9e-12   1
pir||MORTA2          myosin alkali light chain 1, fast... +3   172  1.9e-12   1
gi|1065541           (U40423) Similar to EF-hand calci... +3   171  2.4e-12   1
gnl|PID|e314740      (Y12814) calcineurin regulatory s... +3   171  2.4e-12   1
gi|435585            (U04443) non-muscle myosin light ... +3   170  3.1e-12   1
pir||I77418          myosin light chain MLC3-f - rat >... +3   170  3.1e-12   1
pir||S71196          calcium-dependent protein kinase ... +3   187  3.1e-12   1
pdb|1CMG|            Nmr Solution Structure Of Calcium... +3   169  4.0e-12   1
sp|P25296|CALB_YEAST CALCINEURIN B SUBUNIT (PROTEIN PH... +3   169  4.0e-12   1
sp|P05978|MLE3_MOUSE MYOSIN LIGHT CHAIN 3, SKELETAL MU... +3   169  4.0e-12   1
pdb|1TRC|A           Bos taurus                           +3   168  5.3e-12   1
sp|Q03975|LPSB_LYTPI CALCIUM-BINDING PROTEIN LPS1-BETA    +3   174  6.6e-12   1
pir||A40394          spec-related protein LpS1-beta lo... +3   174  6.6e-12   1
pir||S71775          calcium-dependent protein kinase ... +3   185  6.9e-12   1
sp|P21788|SP15_HEMPU 15 KD CALCIUM-BINDING PROTEIN (CA... +3   167  7.0e-12   1
prf||1004301A        myosin LC1 [Gallus gallus]           +3   167  7.0e-12   1
gi|2501766           (U69174) calmodulin-like domain p... +3   185  8.3e-12   1
sp|P48593|E631_DROME CALCIUM-BINDING PROTEIN E63-1 >gi... +3   166  9.1e-12   1
gnl|PID|e318964      (Z28189) ORF YKL190w [Saccharomyc... +3   166  9.1e-12   1
pir||B23253          myosin A2 catalytic light chain, ... +3   166  9.1e-12   1
gnl|PID|e348615      (Z81053) E02A10.3 [Caenorhabditis... +3   165  1.2e-11   1
sp|P05934|CALM_STRPU CALMODULIN                           +3   165  1.2e-11   1
pir||PS0261          phosphoprotein phosphatase (EC 3.... +3   164  1.6e-11   1
sp|P09541|MLEF_MOUSE MYOSIN LIGHT CHAIN 1, ATRIAL/FOET... +3   164  1.6e-11   1
gi|2501764           (U69173) calmodulin-like domain p... +3   182  1.9e-11   1
pdb|1TRC|B           Bos taurus                           +3   163  2.2e-11   1
gnl|PID|e275905      (Z81120) T12D8.f [Caenorhabditis ... +3   163  2.2e-11   1
sp|P09485|LPSA_LYTPI CALCIUM-BINDING PROTEIN LPS1-ALPHA   +3   178  2.2e-11   1
sp|P02612|MLRM_CHICK MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   162  2.8e-11   1
pir||I50384          myosin light chain 3f - chicken >... +3   162  2.8e-11   1
prf||1803425B        myosin:SUBUNIT=essential light ch... +3   162  2.8e-11   1
pir||A31797          Spec-related protein (clone LpS1)... +3   177  3.0e-11   1
sp|P17209|MLEF_RAT   MYOSIN LIGHT CHAIN 1, ATRIAL ISOF... +3   161  3.7e-11   1
gnl|PID|e222188      (X14428) myosin alkali light chai... +3   160  4.9e-11   1
pir||A45940          calmodulin - sea urchin (Strongyl... +3   159  6.4e-11   1
gnl|PID|e325352      (Z97210) calmodulin [Schizosaccha... +3   159  6.4e-11   1
sp|P29269|MLRN_PIG   MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   159  6.4e-11   1
sp|P09540|MLEX_CHICK MYOSIN LIGHT CHAIN, EMBRYONIC (L2... +3   159  6.4e-11   1
prf||1803425A        myosin:SUBUNIT=essential light ch... +3   159  6.4e-11   1
prf||1405342A        ventricular myosin L1 [Homo sapiens] +3   159  6.4e-11   1
sp|P80164|MLR_LUMTE  MYOSIN REGULATORY LIGHT CHAIN, ST... +3   158  8.4e-11   1
sp|P08590|MLEV_HUMAN MYOSIN LIGHT CHAIN 1, SLOW-TWITCH... +3   158  8.4e-11   1
gi|34866             (X07373) ventricular myosin light... +3   158  8.4e-11   1
pir||MOCH4E          myosin alkali light chain 4, embr... +3   158  8.4e-11   1
prf||2001201A        myosin:SUBUNIT=light chain:ISOTYP... +3   158  8.4e-11   1
gi|1841960           (U64727) similar to nonmuscle myo... +3   158  8.4e-11   1
sp|P24844|MLRN_HUMAN MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   157  1.1e-10   1
sp|P05945|MLE_TODPA  MYOSIN CATALYTIC LIGHT CHAIN LC-1... +3   157  1.1e-10   1
prf||1004301B        myosin LC3 [Gallus gallus]           +3   157  1.1e-10   1
pir||A25571          myosin LC1 catalytic light chain ... +3   157  1.1e-10   1
gi|2271459           (AF009560) calcium-dependent prot... +3   176  1.3e-10   1
pir||A61034          myosin regulatory light chain, ce... +3   156  1.4e-10   1
sp|P24032|MLRN_CHICK MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   156  1.4e-10   1
pir||I51690          cytoplasmic myosin II regulatory ... +3   156  1.4e-10   1
gi|161233            (J03499) myosin calcium-binding l... +3   156  1.4e-10   1
sp|P08053|MLR_PHYPO  MYOSIN REGULATORY LIGHT CHAIN (CA... +3   156  1.4e-10   1
pir||A29910          myosin calcium-binding light chai... +3   156  1.4e-10   1
sp|Q64122|MLRN_RAT   MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   155  1.9e-10   1
pir||A44977          calmodulin homolog - fluke (Schis... +3   154  2.5e-10   1
gi|395235            (X74151) orf2; homologous to S.ce... +3   154  2.5e-10   1
sp|Q17133|MLE_BRAFL  MYOSIN, ESSENTIAL LIGHT CHAIN (MY... +3   154  2.5e-10   1
sp|P12829|MLEF_HUMAN MYOSIN LIGHT CHAIN 1, EMBRYONIC M... +3   153  3.2e-10   1
pir||S71777          calcium-dependent protein kinase ... +3   172  4.0e-10   1
gnl|PID|d1020181     (AB001688) calcium vector protein... +3   152  4.2e-10   1
gnl|PID|d1020182     (AB001689) calcium vector protein... +3   152  4.2e-10   1
sp|P04573|CAVP_BRALA CALCIUM VECTOR PROTEIN (CAVP) >pi... +3   152  4.2e-10   1
sp|P18666|MLRB_RAT   MYOSIN REGULATORY LIGHT CHAIN 2-B... +3   152  4.2e-10   1
pir||S71198          calcium-dependent protein kinase ... +3   172  5.0e-10   1
sp|P19105|MLRM_HUMAN MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   151  5.6e-10   1
sp|P13832|MLRA_RAT   MYOSIN REGULATORY LIGHT CHAIN 2-A... +3   151  5.6e-10   1
gnl|PID|e290276      (X13864) cardiac myosin alkali li... +3   151  5.6e-10   1
pir||S11632          myosin regulatory light chain B -... +3   150  7.2e-10   1
gi|1899175           (U90262) calcium-dependent calmod... +3   171  7.7e-10   1
prf||1805343A        myosin:SUBUNIT=regulatory light c... +3   149  9.5e-10   1
pir||S45709          myosin regulatory light chain 2, ... +3   149  9.5e-10   1
gi|1389843           (U59290) Placopecten magellanicus... +3   148  1.2e-09   1
gi|169406            (M96933) calmodulin [Pneumocystis... +3   147  1.6e-09   1
sp|P28583|CDPK_SOYBN CALCIUM-DEPENDENT PROTEIN KINASE ... +3   167  2.0e-09   1
sp|P13833|MLR_DICDI  MYOSIN REGULATORY LIGHT CHAIN (RM... +3   145  2.7e-09   1
gi|2605594           (D50372) myosin regulatory light ... +3   145  2.7e-09   1
pdb|1SMG|            Calcium-Bound E41a Mutant Of The ... +3   143  4.7e-09   1
sp|Q09011|CAST_SOLTU CALCIUM-BINDING PROTEIN CAST >gi|... +3   145  5.5e-09   1
pdb|1TNQ|            Ef-Hand Mol_id: 1; Molecule: Trop... +3   142  6.0e-09   1
pdb|1TRF|            Troponin C (Tr1c Fragment) (Apo F... +3   142  6.0e-09   1
sp|P07291|MLE_AEQIR  MYOSIN ESSENTIAL LIGHT CHAIN, STR... +3   142  6.0e-09   1
gi|1389847           (U59292) Placopecten magellanicus... +3   142  6.0e-09   1
gnl|PID|e274737      (X99763) CDPK2 [Plasmodium falcip... +3   163  6.3e-09   1
gnl|PID|d1013016     (D84408) calcium dependent protei... +3   162  7.7e-09   1
gnl|PID|e334241      (AJ001093) calmodulin-like protei... +3   141  7.8e-09   1
pdb|1WDC|C           Argopecten irradians                 +3   141  7.8e-09   1
gi|2262160           (AC002329) CDPK6 (calmodulin-doma... +3   161  9.9e-09   1
pdb|1SCM|C           Argopecten irradians                 +3   140  1.0e-08   1
sp|P07290|MLE_PATYE  MYOSIN, ESSENTIAL LIGHT CHAIN, AD... +3   140  1.0e-08   1
pir||S71197          calcium-dependent protein kinase ... +3   161  1.1e-08   1
pir||S71774          calcium-dependent protein kinase ... +3   161  1.1e-08   1
sp|P02613|MLR_PATSP  MYOSIN REGULATORY LIGHT CHAIN (ED... +3   139  1.3e-08   1
sp|P04112|MLRB_PATYE MYOSIN REGULATORY LIGHT CHAIN B, ... +3   139  1.3e-08   1
pir||A53729          myosin light chain, cardiac muscl... +3   138  1.7e-08   1
gi|160971            (L00992) essential myosin light c... +3   138  1.7e-08   1
pir||I52831          myosin regulatory light chain - r... +3   138  1.7e-08   1
gi|2315983           (U82087) calmodulin-like domain p... +3   160  1.8e-08   1
gnl|PID|d1013921     (D87042) Calcium-dependent protei... +3   159  2.2e-08   1
pdb|1AK8|            Nmr Solution Structure Of Cerium-... +3   137  2.3e-08   1
sp|P53014|MLE_CAEEL  MYOSIN, ESSENTIAL LIGHT CHAIN (MY... +3   136  2.9e-08   1
sp|P04110|SP2A_STRPU SPEC 2A PROTEIN >pir||S01770 Spec... +3   135  3.8e-08   1
gi|189015            (M24121) myosin light chain [Homo... +3   141  3.9e-08   1
sp|P53141|YGK6_YEAST HYPOTHETICAL CALCIUM-BINDING PROT... +3   134  4.9e-08   1
gi|1871195           (U90439) Ca++ dependent protein k... +3   155  6.0e-08   1
sp|P25071|TCH3_ARATH CALMODULIN-RELATED PROTEIN 3, TOU... +3   132  8.3e-08   1
gi|1785953           (U38787) calmodulin [Naegleria fo... +3   132  8.3e-08   1
sp|P08051|MLR_SPISA  MYOSIN REGULATORY LIGHT CHAIN, SM... +3   132  8.3e-08   1
gnl|PID|e229821      (Z70267) K04C1.4 [Caenorhabditis ... +3   132  8.3e-08   1
sp|Q07167|SM16_SCHMA 16 KD CALCIUM-BINDING PROTEIN (EG... +3   131  1.1e-07   1
prf||1803425C        myosin:SUBUNIT=regulatory light c... +3   131  1.1e-07   1
gi|1785958           (U38788) calmodulin [Acrasis rosea]  +3   131  1.1e-07   1
gi|496145            (M19436) myosin light chain [Mus ... +3   131  1.1e-07   1
pir||MCUR2A          Spec 2a protein - sea urchin (Str... +3   130  1.4e-07   1
pir||A53718          myosin light chain-2 isoform MLC-... +3   130  1.4e-07   1
sp|P42325|NCAH_DROME NEUROCALCIN HOMOLOG >pir||A55666 ... +3   136  1.5e-07   1
gi|861246            (U28731) similar to calmodulin [C... +3   129  1.8e-07   1
bbs|178277           myosin light chain 2a, MLC2a=myos... +3   129  1.8e-07   1
sp|P53684|CDP3_ORYSA CALCIUM-DEPENDENT PROTEIN KINASE,... +3   151  1.9e-07   1
gi|575508            (M23663) calbindin [Mus musculus]    +3   128  2.3e-07   1
gi|2317758           (AF013802) calcium binding protei... +3   127  3.0e-07   1
sp|P06787|CALM_YEAST CALMODULIN >pir||MCBY calmodulin ... +3   127  3.0e-07   1
sp|P07461|MLR_HALRO  MYOSIN REGULATORY LIGHT CHAIN, SM... +3   127  3.0e-07   1
gi|189020            (M22918) non-muscle myosin light ... +3   127  3.0e-07   1
gi|189022            (M22920) smooth muscle mysoin lig... +3   127  3.0e-07   1
sp|P09402|MLE_DICDI  MYOSIN, ESSENTIAL LIGHT CHAIN (MY... +3   126  3.9e-07   1
pir||A28127          myosin light chain, nonmuscle - s... +3   126  3.9e-07   1
sp|P43187|BTV3_BETVE ALLERGEN BET V 3 (BET V III) >pir... +3    92  4.9e-07   2
sp|P41049|EFH2_TRYCR EF-HAND PROTEIN 5 VARIANT 2 (EFH5... +3   137  5.0e-07   1
sp|P08052|MLR_TODPA  MYOSIN REGULATORY LIGHT CHAIN LC-... +3   125  5.1e-07   1
pir||A44451          myosin regulatory light chain 2A,... +3   127  6.0e-07   1
sp|Q39584|DYL3_CHLRE DYNEIN 18 KD LIGHT CHAIN, FLAGELL... +3   124  6.6e-07   1
prf||1803425D        myosin:SUBUNIT=regulatory light c... +3   124  6.6e-07   1
gi|189017            (M22919) smooth muscle myosin lig... +3   123  8.5e-07   1
pir||S56717          calcium-dependent protein kinase ... +3   144  9.1e-07   1
sp|Q24621|MLEL_DROPS MYOSIN LIGHT CHAIN ALKALI, LARVA ... +3   122  1.1e-06   1
gi|2315325           (AF016435) No definition line fou... +3   135  1.1e-06   1
gnl|PID|e276131      (Z81072) F30A10.1 [Caenorhabditis... +3   140  1.2e-06   1
bbs|178090           (S82200) GCAP2=guanylate cyclase ... +3   132  1.6e-06   1
sp|P04466|MLRS_RAT   MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   123  1.7e-06   1
bbs|178275           myosin light chain 2f, MLC2f=myos... +3   123  1.7e-06   1
gi|971760            (F14531) microtubule-organizing c... +3   120  1.9e-06   1
sp|Q24654|MLEL_DROSI MYOSIN LIGHT CHAIN ALKALI, LARVA ... +3   120  1.9e-06   1
gi|157946            (K01567) myosin light chain [Dros... +3   119  2.4e-06   1
sp|P05095|AACT_DICDI ALPHA-ACTININ 3, NON MUSCULAR (F-... +3   136  2.5e-06   2
sp||CART_MOUSE_2     [Segment 2 of 2] CALRETININ (CR) ... +3   129  2.7e-06   1
sp|P41048|EFH1_TRYCR EF-HAND PROTEIN 5 VARIANT 1 (EFH5... +3   131  3.2e-06   1
pir||A56785          calmodulin - pig (fragment)          +3   117  4.0e-06   1
sp|P12658|CABV_MOUSE CALBINDIN (VITAMIN D-DEPENDENT CA... +3   133  5.1e-06   1
sp|P07171|CABV_RAT   CALBINDIN (VITAMIN D-DEPENDENT CA... +3   133  5.1e-06   1
sp|Q24620|MLEP_DROPS MYOSIN LIGHT CHAIN ALKALI, PUPA F... +3   116  5.2e-06   1
sp|Q24653|MLEP_DROSI MYOSIN LIGHT CHAIN ALKALI, PUPA F... +3   115  6.7e-06   1
sp|P05937|CABV_HUMAN CALBINDIN (VITAMIN D-DEPENDENT CA... +3   132  6.8e-06   1
sp|P04354|CABV_CHICK CALBINDIN (VITAMIN D-DEPENDENT CA... +3   131  9.0e-06   1
sp|Q24756|MLEL_DROVI MYOSIN LIGHT CHAIN ALKALI, LARVA ... +3   113  1.1e-05   1
gi|832882            (L42454) EF-hand protein [Schizos... +3   113  1.1e-05   1
gnl|PID|e236263      (Z70753) F40F9.8 [Caenorhabditis ... +3   113  1.1e-05   1
gnl|PID|e236380      (Z70783) ZK856.8 [Caenorhabditis ... +3   124  1.7e-05   1
sp|P47728|CART_RAT   CALRETININ (CR) >pir||S25006 calr... +3   129  1.7e-05   1
sp|P41691|MLR5_FELCA SUPERFAST MYOSIN REGULATORY LIGHT... +3   120  1.9e-05   1
pir||JC1310          calmodulin-related calcium-bindin... +3   111  1.9e-05   1
sp|P02608|MLRS_RABIT MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   119  1.9e-05   1
gi|1220346           (M21812) myosin light chain 2 [Ho... +3   119  1.9e-05   1
gi|1220479           (M21983) myosin light chain 2 [Or... +3   119  1.9e-05   1
pir||S20992          myosin regulatory light chain 2 -... +3   124  2.2e-05   1
gi|1916312           (U91630) neurocalcin [Gallus gallus] +3   123  2.2e-05   1
sp|P29554|NECD_BOVIN NEUROCALCIN DELTA >pir||JH0616 ne... +3   123  2.2e-05   1
sp|Q16982|NECX_APLCA NEUROCALCIN >gi|1421769 (U61223) ... +3   123  2.2e-05   1
pir||S22715          myosin regulatory light chain 2 -... +3   124  2.3e-05   1
pdb|1BOD|            Calbindin D9k Mutant With Ala 14 ... +3   110  2.4e-05   1
sp|P04467|CABV_BOVIN CALBINDIN (VITAMIN D-DEPENDENT CA... +3   127  2.6e-05   1
sp|P24732|MLRT_RABIT MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   118  3.1e-05   1
pir||I54042          calbindin-d28k - rat >gi|203237 (... +3   126  3.5e-05   1
sp|P07090|CART_CHICK CALRETININ (CR) >pir||A27067 calr... +3   126  3.9e-05   1
sp|P80026|PRVM_CHICK PARVALBUMIN, MUSCLE >pir||PVCHA p... +3   108  4.0e-05   1
sp|P30188|CALL_ARATH CALMODULIN-LIKE PROTEIN >pir||S29... +3   123  4.1e-05   1
sp|P02609|MLRS_CHICK MYOSIN REGULATORY LIGHT CHAIN 2, ... +3   116  4.1e-05   1
sp|P53682|CDP1_ORYSA CALCIUM-DEPENDENT PROTEIN KINASE,... +3   130  5.0e-05   1
gi|406661            (Z26706) Calcium-binding protein ... +3   107  5.2e-05   1
bbs|67140            parvalbumin [chickens, muscle, Pe... +3   107  5.2e-05   1
pdb|2PAS|            Parvalbumin (Alpha Lineage, Pi 5.... +3   107  5.2e-05   1
sp|P02628|PRVA_ESOLU PARVALBUMIN ALPHA >pir||PVPK parv... +3   107  5.2e-05   1
gi|2271461           (AF009561) calcium-dependent prot... +3   129  5.8e-05   1
gi|1065559           (U40427) Similar to EF-hand calci... +3   123  6.0e-05   1
sp|P02626|PRVA_AMPME PARVALBUMIN ALPHA >pir||PVNESA pa... +3   106  6.7e-05   1
prf||2119321A        EF hand protein [Schizosaccharomy... +3   106  6.7e-05   1
sp|P02611|MLRB_CHICK MYOSIN REGULATORY LIGHT CHAIN 2B,... +3   114  6.9e-05   1
sp|P34057|RECO_MOUSE RECOVERIN (CANCER ASSOCIATED RETI... +3   120  7.2e-05   1
pir||S47565          BDR-1 protein - human                +3   119  7.4e-05   1
sp|P06742|MLEL_DROME MYOSIN LIGHT CHAIN ALKALI, LARVA ... +3   111  7.5e-05   1
sp|Q02045|MLR5_HUMAN SUPERFAST MYOSIN REGULATORY LIGHT... +3   116  7.7e-05   1
gi|161572            (M32449) ec2d [Strongylocentrotus... +3   105  8.6e-05   1
sp|P42324|VIS3_CHICK REM-1 PROTEIN >pir||I50676 gene R... +3   118  0.00010   1
sp|P37236|FREQ_DROME FREQUENIN (D-FRQ) >gi|404035 (L08... +3   117  0.00011   1
sp|P06743|MLEP_DROME MYOSIN LIGHT CHAIN ALKALI, PUPA F... +3   110  0.00012   1
sp|P22676|CART_HUMAN CALRETININ (CR) (29 KD CALBINDIN)... +3   121  0.00015   1
bbs|178088           (S82199) GCAP1=guanylate cyclase ... +3   117  0.00016   1
sp|P80079|PRVA_FELCA PARVALBUMIN ALPHA                    +3   102  0.00019   1
pir||S27209          Parvalbumin - Cat                    +3   102  0.00019   1
sp|P38505|CABP_ENTHI CALCIUM-BINDING PROTEIN (CABP) >g... +3   102  0.00019   1
sp|P20472|PRVA_HUMAN PARVALBUMIN ALPHA >pir||S07531 pa... +3   102  0.00019   1
pdb|1OMD|            Oncomodulin >pdb|1RRO|  Rat Oncom... +3   102  0.00019   1
sp|P51879|ONCO_MOUSE ONCOMODULIN (OM) (PARVALBUMIN BET... +3   102  0.00019   1
sp|P02631|ONCO_RAT   ONCOMODULIN (OM) (PARVALBUMIN BET... +3   102  0.00019   1
prf||1206380B        parvalbumin II [Electrophorus sp.]   +3   102  0.00019   1
sp|P34368|YLJ5_CAEEL HYPOTHETICAL CALCIUM-BINDING PROT... +3   114  0.00020   1
sp|P32848|PRVA_MOUSE PARVALBUMIN ALPHA >pir||A37414 pa... +3   101  0.00024   1
gi|16775             (Z17617) calmodulin-1 [Arabidopsi... +3   101  0.00024   1
sp|Q24755|MLEP_DROVI MYOSIN LIGHT CHAIN ALKALI, PUPA F... +3   108  0.00028   1
sp|P35243|RECO_HUMAN RECOVERIN (CANCER ASSOCIATED RETI... +3   115  0.00030   1
pir||S57854          myosin regulatory light chain 2 (... +3   100  0.00031   1
pir||I50393          myosin light chain type 2 (LC2f) ... +3   111  0.00032   1
sp|P37235|VIS3_HUMAN VISININ-LIKE PROTEIN 3 (VILIP-3) ... +3   114  0.00033   1
pdb|1RTP|1           Rattus rattus >pdb|1RTP|2 Rattus ... +3    99  0.00040   1
sp|P02625|PRVA_RAT   PARVALBUMIN ALPHA >pir||PVRTA par... +3    99  0.00040   1
sp|P02615|PRVB_BOACO PARVALBUMIN BETA >pir||PVSNBB par... +3    99  0.00040   1
gi|161577            (K01649) Spec 1a protein [Strongy... +3    99  0.00040   1
sp|P02624|PRVA_RABIT PARVALBUMIN ALPHA >pir||PVRB parv... +3    99  0.00040   1
sp|P32930|ONCO_HUMAN ONCOMODULIN (OM) (PARVALBUMIN BET... +3    99  0.00040   1
sp|P35467|S10A_RAT   S-100 PROTEIN, ALPHA CHAIN >gi|83... +3    99  0.00040   1
sp|P35333|VIS3_RAT   VISININ-LIKE PROTEIN 3 (VILIP-3) ... +3   113  0.00043   1
sp|P80050|PRVA_MACFU PARVALBUMIN ALPHA (PARVALBUMIN, M... +3    98  0.00052   1
sp|P30563|PRVA_TRISE PARVALBUMIN ALPHA >pdb|5PAL|  Par... +3    98  0.00052   1
gi|623018            (Z47401) calmodulin [Arabidopsis ... +3    98  0.00052   1
gi|577243            (L37317) myosin alkali light chai... +3    98  0.00052   1
pir||A61567          myosin light chain 2, slow skelet... +3   106  0.00054   1
gi|34846             (X66141) cardiac ventricular myos... +3   109  0.00056   1
pir||S65149          pollen allergen Bra n I (clone 43... +3    97  0.00066   1
sp|P05941|PRVB_OPSTA PARVALBUMIN BETA (PARVALBUMIN III... +3    97  0.00066   1
sp|P02639|S10A_BOVIN S-100 PROTEIN, ALPHA CHAIN >pir||... +3    97  0.00066   1
bbs|144276           (S69022) myosin light chain-2, ML... +3   108  0.00072   1
sp|Q06389|NCS1_YEAST CALCIUM-BINDING PROTEIN NCS-1 >pi... +3   111  0.00073   1
sp|Q91614|NCS1_XENLA NEURONAL CALCIUM SENSOR 1 (NCS-1)... +3   111  0.00073   1


WARNING:  Descriptions of 322 database sequences were not reported due to the
          limiting value of parameter V = 500.



>gi|1825580 (U88165) similar to troponins [Caenorhabditis elegans]
            Length = 161

  Plus Strand HSPs:

 Score = 782 (275.3 bits), Expect = 4.4e-77, P = 4.4e-77
 Identities = 151/161 (93%), Positives = 157/161 (97%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             MAEDI+EILAEIDGSQIEEYQKFFD FDRGKQGYIMATQIGQIMH MEQDFDEK LRKLI
Sbjct:     1 MAEDIEEILAEIDGSQIEEYQKFFDAFDRGKQGYIMATQIGQIMHGMEQDFDEKTLRKLI 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
             RKFDADGSGKLEFDEFCALVYTVANTVDKETL+KELREAFRLFDKEGNGYISRPTLKALL
Sbjct:    61 RKFDADGSGKLEFDEFCALVYTVANTVDKETLEKELREAFRLFDKEGNGYISRPTLKALL 120

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             KEIADDL+D+QLE AVDEIDEDGSGKIEFEEFWELMAG++D
Sbjct:   121 KEIADDLTDQQLEEAVDEIDEDGSGKIEFEEFWELMAGESD 161


>sp|Q09665|YS57_CAEEL HYPOTHETICAL CALCIUM-BINDING PROTEIN ZK673.7 IN
            CHROMOSOME II >gi|695492 (Z48585) ZK673.7 [Caenorhabditis elegans]
            Length = 160

  Plus Strand HSPs:

 Score = 432 (152.1 bits), Expect = 5.3e-40, P = 5.3e-40
 Identities = 78/160 (48%), Positives = 123/160 (76%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M + + + L ++   QIE+++K+F+MFD+  +GYI ATQ+GQI+  M Q F+E+ L++LI
Sbjct:     1 MGDVVADALEKLSADQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLI 60

Query:   279 RKFDADGSGKLEFDEFCALVYT-VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
             ++FDADGSG++EF+EF A+V   V N  + E L++ELREAFRL+DKEGNGYI+   L+ +
Sbjct:    61 KEFDADGSGEIEFEEFAAMVANFVVNNENDEGLEEELREAFRLYDKEGNGYINVSDLRDI 120

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGD 575
             L+ + D++S+E+L+  + EID DGSG ++F+EF E+M+G+
Sbjct:   121 LRALDDNVSEEELDEMIAEIDADGSGTVDFDEFMEMMSGE 160

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 31/107 (28%), Positives = 62/107 (57%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E+ L++L  +     + E +F+   A++A  +  +  E D    EE ++ F ++D+   G
Sbjct:    53 ERDLKQLIKEFDADGSGEIEFEEFAAMVANFV--VNNENDEGLEEELREAFRLYDKEGNG 110

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
             YI  + +  I+ A++ +  E++L ++I + DADGSG ++FDEF  ++
Sbjct:   111 YINVSDLRDILRALDDNVSEEELDEMIAEIDADGSGTVDFDEFMEMM 157

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 28/77 (36%), Positives = 46/77 (59%), Frame = +3

Query:   345 VANTVDKETLQK--ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEID 518
             VA+ ++K +  +  + R+ F +FDKEG GYI    +  +L+ +     +  L+  + E D
Sbjct:     5 VADALEKLSADQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKEFD 64

Query:   519 EDGSGKIEFEEFWELMA 569
              DGSG+IEFEEF  ++A
Sbjct:    65 ADGSGEIEFEEFAAMVA 81

 Score = 93 (32.7 bits), Expect = 0.060, P = 0.059
 Identities = 28/117 (23%), Positives = 61/117 (52%), Frame = +3

Query:   225 IMHAMEQ-DFDE-KQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAF 398
             +  A+E+   D+ +Q RK    FD +G G +   +   ++ T+    ++  L++ ++E  
Sbjct:     5 VADALEKLSADQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKE-- 62

Query:   399 RLFDKEGNGYISRPTLKALLKE-IADDLSDEQLEAAVDEI----DEDGSGKIEFEEFWEL 563
               FD +G+G I      A++   + ++ +DE LE  + E     D++G+G I   +  ++
Sbjct:    63 --FDADGSGEIEFEEFAAMVANFVVNNENDEGLEEELREAFRLYDKEGNGYINVSDLRDI 120

Query:   564 M 566
             +
Sbjct:   121 L 121


>sp|P15159|TPC_TACTR TROPONIN C >pir||JX0072 troponin C, striated muscle -
            horseshoe crab (Tachypleus tridentatus) >prf||1508214A troponin C
            [Tachypleus tridentatus]
            Length = 153

  Plus Strand HSPs:

 Score = 349 (122.9 bits), Expect = 3.3e-31, P = 3.3e-31
 Identities = 65/148 (43%), Positives = 99/148 (66%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   Q++  +K FDMFDR K+G I    +  I+  + Q F+EK L+ LI + D DGSG+
Sbjct:     6 DLSKEQVQMLRKAFDMFDRDKKGVIHTNMVSTILRTLGQTFEEKDLKDLIAEIDQDGSGE 65

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             LEF+EF AL        D E +Q+ELREAFRL+DK+G G+I+   L+ +L+ + D L+++
Sbjct:    66 LEFEEFMALAARFLVEEDAEAMQEELREAFRLYDKQGQGFINVSDLRDILRALDDKLTED 125

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +L+  + EID DGSG ++F+EF E+M G
Sbjct:   126 ELDEMIAEIDTDGSGTVDFDEFMEMMTG 153


>sp|P29290|TPCA_HOMAM TROPONIN C, ISOFORM 2A >pir||S18434 troponin C isoform 2a
            - American lobster
            Length = 150

  Plus Strand HSPs:

 Score = 345 (121.4 bits), Expect = 8.9e-31, P = 8.9e-31
 Identities = 67/147 (45%), Positives = 97/147 (65%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             +D  QI   QK FD FD   +G+I    +G I+  M     EK L+++I + D DGSG+L
Sbjct:     4 LDEEQIGALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVIAETDEDGSGEL 63

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF+EF  L        D+E L+ ELREAFR++DKEGNGYI+   LK +L+E+ + L++E 
Sbjct:    64 EFEEFVELAAKFLIEEDEEALKTELREAFRVYDKEGNGYITTDVLKEILRELDNRLTEED 123

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L++ ++E+DEDGSG ++F EF E+M G
Sbjct:   124 LDSIIEEVDEDGSGTLDFNEFMEMMNG 150


>sp|P47948|TPC2_DROME TROPONIN C, ISOFORM 47D >pir||S38877 troponin C isoform
            47D - fruit fly (Drosophila melanogaster) >gi|429074 (X76044)
            troponin-C [Drosophila melanogaster] >prf||2021248C troponin C
            [Drosophila melanogaster]
            Length = 155

  Plus Strand HSPs:

 Score = 342 (120.4 bits), Expect = 1.8e-30, P = 1.8e-30
 Identities = 67/155 (43%), Positives = 98/155 (63%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             +D I  ++   QI   QK F+ FD  K G I    +  I+  M Q FD + L +L+ + D
Sbjct:     1 MDNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELMHEVD 60

Query:   291 ADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIA 470
              D SG+LEF+EF  L        D E +QK++REAFRL+DK+GNGYI    LK +LKE+ 
Sbjct:    61 EDKSGRLEFEEFVQLAAKFIVEEDDEAMQKDVREAFRLYDKQGNGYIPTSCLKEILKELD 120

Query:   471 DDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGD 575
             D L++++L+  ++EID DGSG ++F+EF E+M G+
Sbjct:   121 DQLTEQELDIMIEEIDSDGSGTVDFDEFMEMMTGE 155


>sp|P47949|TPC3_DROME TROPONIN C, ISOFORM 73F >pir||S38878 troponin C isoform
            73F - fruit fly (Drosophila melanogaster) >gi|429076 (X76042)
            troponin-C [Drosophila melanogaster] >prf||2021248A troponin C
            [Drosophila melanogaster]
            Length = 155

  Plus Strand HSPs:

 Score = 340 (119.7 bits), Expect = 3.0e-30, P = 3.0e-30
 Identities = 69/155 (44%), Positives = 97/155 (62%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             +DE   ++   QI   QK F+ FD  K G I    +  I+  M Q FD+K L +LI + D
Sbjct:     4 VDE---DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVD 60

Query:   291 ADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIA 470
              D SG+LEF EF  L        D E +QKEL EAFRL+DK+GNG+I    LK +LKE+ 
Sbjct:    61 EDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELAEAFRLYDKQGNGFIPTTCLKEILKELD 120

Query:   471 DDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGD 575
             D L++++L+  ++EID DGSG ++F+EF E+M G+
Sbjct:   121 DQLTEQELDIMIEEIDSDGSGTVDFDEFMEMMTGE 155


>sp|P29289|TPC1_HOMAM TROPONIN C, ISOFORM 1 >pir||S18394 troponin C isoform 1 -
            American lobster >bbs|61761 troponin C isoform 1,  TnC-1 [lobsters,
            Peptide, 150 aa]
            Length = 150

  Plus Strand HSPs:

 Score = 336 (118.3 bits), Expect = 8.0e-30, P = 8.0e-30
 Identities = 61/147 (41%), Positives = 101/147 (68%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             +D  Q++  QK F+ FD   +G+I    +G I+  M     ++ L+++I + D DGSG++
Sbjct:     4 LDEDQVQALQKAFNSFDTDDKGFITPDTVGVILRMMGVKISDRHLQEVISETDEDGSGEI 63

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF+EF AL     +  D+E L+KEL+EAFR++D+ GNGYI+  TLK +L+E+ + L+++ 
Sbjct:    64 EFEEFAALAAKFLSEEDEEALKKELKEAFRIYDRGGNGYITVHTLKEILRELDNKLTEDN 123

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L++ ++E+DEDGSG I+F EF ++M G
Sbjct:   124 LDSIIEEVDEDGSGTIDFNEFMKMMNG 150


>sp|P29291|TPCB_HOMAM TROPONIN C, ISOFORM 2B >pir||S18435 troponin C isoform 2b
            - American lobster
            Length = 150

  Plus Strand HSPs:

 Score = 334 (117.6 bits), Expect = 1.3e-29, P = 1.3e-29
 Identities = 63/147 (42%), Positives = 96/147 (65%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             +D  Q+   QK FD FD   +G+I    +G I+  M     EK L+++I + D DGSG+L
Sbjct:     4 LDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDGSGEL 63

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF+EF  L        D+E L+ ELREAFR++D+ GNGYI+   LK +L+E+ + L++E 
Sbjct:    64 EFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEED 123

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L++ ++E+DEDGSG ++F EF ++M G
Sbjct:   124 LDSIIEEVDEDGSGTLDFNEFMQMMNG 150


>sp|P06707|TPC1_PONLE TROPONIN C, ISOTYPE ALPHA
            Length = 150

  Plus Strand HSPs:

 Score = 328 (115.5 bits), Expect = 5.6e-29, P = 5.6e-29
 Identities = 61/147 (41%), Positives = 97/147 (65%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             +D  Q+   QK FD FD   +G+I    +G I+  M     E+ L+++I + D DGSG++
Sbjct:     4 LDEEQVSALQKAFDSFDTDSKGFITPETVGIILRMMGVKISERHLQQVISETDEDGSGEI 63

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF+EF  L     +  D+E L+KEL+EAFR++D+ G+GYI+   L+ +LKE+ + L+++ 
Sbjct:    64 EFEEFAELAAKFLSEEDEEALKKELKEAFRIYDRGGDGYITTQVLREILKELDNRLTEDN 123

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L+  ++EIDEDGSG I+F EF ++M G
Sbjct:   124 LDEIIEEIDEDGSGTIDFMEFMKMMTG 150


>pir||A34380 troponin C alpha - narrow-fingered crayfish
            Length = 150

  Plus Strand HSPs:

 Score = 328 (115.5 bits), Expect = 5.6e-29, P = 5.6e-29
 Identities = 61/147 (41%), Positives = 97/147 (65%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             +D  Q+   QK FD FD   +G+I    +G I+  M     E+ L+++I + D DGSG++
Sbjct:     4 LDEEQVSALQKAFDSFDTDSKGFITPETVGIILRMMGVKISERHLQEVISETDEDGSGEI 63

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF+EF  L     +  D+E L+KEL+EAFR++D+ G+GYI+   L+ +LKE+ + L+++ 
Sbjct:    64 EFEEFAELAAKFLSEEDEEALKKELKEAFRIYDRGGDGYITTQVLREILKELDNRLTEDN 123

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L+  ++EIDEDGSG I+F EF ++M G
Sbjct:   124 LDEIIEEIDEDGSGTIDFMEFMKMMTG 150


>sp|P06708|TPC2_PONLE TROPONIN C, ISOTYPE GAMMA
            Length = 150

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 1.2e-28, P = 1.2e-28
 Identities = 60/147 (40%), Positives = 97/147 (65%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             +D  Q+   +K FD FD   +G+I    +G I+  M     EK L+++I + D DGSG+L
Sbjct:     4 LDEEQLSALKKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQQVIAETDEDGSGEL 63

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF+EF  L        D+E L+ EL+EAFR++DK G+GYI+   L+ +L+E+ + L+++ 
Sbjct:    64 EFEEFVELAAKFLIEEDEEALKAELKEAFRIYDKGGDGYITTDVLREILRELDNRLTEDD 123

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L+  ++E+DEDGSG ++F+EF E+M+G
Sbjct:   124 LDGIIEEVDEDGSGTLDFDEFMEMMSG 150


>sp|P21798|TPC2_BALNU TROPONIN C, ISOFORM 2
            Length = 151

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 1.2e-28, P = 1.2e-28
 Identities = 67/151 (44%), Positives = 94/151 (62%), Frame = +3

Query:   120 ILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             ++ E+D  QI   +K FD FD  K+G I    +  I+  M Q ++ + L++LI + DADG
Sbjct:     1 MMDELDKDQIAMLKKAFDGFDHEKKGAINCDVVATILRMMGQAYNAQTLKELIDEVDADG 60

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
             SG LEF+EF  L        D E + KEL+EAFRL+DK G GYI    LK +LKE+ + L
Sbjct:    61 SGMLEFEEFVTLAAKFIIDDDAEAMAKELKEAFRLYDKAGKGYIPTSALKDILKELDETL 120

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             + E L+  + EID DGSG ++F+EF E+M G
Sbjct:   121 NAEDLDNIIGEIDTDGSGTVDFDEFMEMMTG 151


>pir||B34380 troponin C gamma - narrow-fingered crayfish
            Length = 150

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 1.2e-28, P = 1.2e-28
 Identities = 60/147 (40%), Positives = 97/147 (65%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             +D  Q+   +K FD FD   +G+I    +G I+  M     EK L+++I + D DGSG+L
Sbjct:     4 LDEEQLSALKKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVIAETDEDGSGEL 63

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF+EF  L        D+E L+ EL+EAFR++DK G+GYI+   L+ +L+E+ + L+++ 
Sbjct:    64 EFEEFVELAAKFLIEEDEEALKAELKEAFRIYDKGGDGYITTDVLREILRELDNRLTEDD 123

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L+  ++E+DEDGSG ++F+EF E+M+G
Sbjct:   124 LDGIIEEVDEDGSGTLDFDEFMEMMSG 150


>pir||B38397 troponin C-2 - giant barnacle
            Length = 151

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 1.2e-28, P = 1.2e-28
 Identities = 67/151 (44%), Positives = 94/151 (62%), Frame = +3

Query:   120 ILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             ++ E+D  QI   +K FD FD  K+G I    +  I+  M Q ++ + L++LI + DADG
Sbjct:     1 MMDELDKDQIAMLKKAFDGFDHEKKGAINCDVVATILRMMGQAYNAQTLKELIDEVDADG 60

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
             SG LEF+EF  L        D E + KEL+EAFRL+DK G GYI    LK +LKE+ + L
Sbjct:    61 SGMLEFEEFVTLAAKFLIDDDAEAMAKELKEAFRLYDKAGKGYIPTSALKDILKELDETL 120

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             + E L+  + EID DGSG ++F+EF E+M G
Sbjct:   121 NAEDLDNIIGEIDTDGSGTVDFDEFMEMMTG 151


>sp|P21797|TPC1_BALNU TROPONIN C, ISOFORM 1 >pir||A38397 troponin C-1 - giant
            barnacle
            Length = 158

  Plus Strand HSPs:

 Score = 323 (113.7 bits), Expect = 1.9e-28, P = 1.9e-28
 Identities = 63/147 (42%), Positives = 91/147 (61%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             ++  QI   ++ FD FDR K+GYI    +  I+  M         +++I + D DGSG++
Sbjct:    12 LEKEQIVVLRRAFDSFDRDKKGYISPETVSDILRMMGIKVSSTSFKQIIEEIDEDGSGQI 71

Query:   312 EFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQ 491
             EF EF  L        D+E + KEL+EAFRL+DKEGNGYI+  TLK +L E+   L+ E+
Sbjct:    72 EFSEFLQLAAKFLIEEDEEAMMKELKEAFRLYDKEGNGYITTQTLKEILHELDARLTAEE 131

Query:   492 LEAAVDEIDEDGSGKIEFEEFWELMAG 572
             L   ++EIDEDGSG ++F+EF  +M G
Sbjct:   132 LVGIIEEIDEDGSGTVDFDEFMAMMTG 158

 Score = 120 (42.2 bits), Expect = 1.9e-06, P = 1.9e-06
 Identities = 21/73 (28%), Positives = 45/73 (61%), Frame = +3

Query:   120 ILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             ++ E + + ++E ++ F ++D+   GYI    + +I+H ++     ++L  +I + D DG
Sbjct:    84 LIEEDEEAMMKELKEAFRLYDKEGNGYITTQTLKEILHELDARLTAEELVGIIEEIDEDG 143

Query:   300 SGKLEFDEFCALV 338
             SG ++FDEF A++
Sbjct:   144 SGTVDFDEFMAMM 156


>sp|P47947|TPC1_DROME TROPONIN C, ISOFORM 41C >gi|452388 (X76043) troponin-C
            [Drosophila melanogaster] >prf||2021248B troponin C [Drosophila
            melanogaster]
            Length = 153

  Plus Strand HSPs:

 Score = 314 (110.5 bits), Expect = 1.7e-27, P = 1.7e-27
 Identities = 60/148 (40%), Positives = 90/148 (60%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   Q    +  F+ FD  K GYI    +G I+  +    D+  L  +I + D DGSG+
Sbjct:     4 ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQ 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             +EF+EF  L        D E +  EL+EAFRL+DKEGNGYI+   L+ +L+E+ D L+++
Sbjct:    64 IEFEEFTTLAARFLVEEDAERMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTND 123

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELMAG 572
              L+  ++EID DGSG ++F+EF E+M G
Sbjct:   124 DLDMMIEEIDSDGSGTVDFDEFMEVMTG 151


>sp|P02594|CALM_ELEEL CALMODULIN >pir||MCEE calmodulin - electric eel
            >gi|213130 (M36168) calmodulin [Electrophorus electricus]
            Length = 149

  Plus Strand HSPs:

 Score = 284 (100.0 bits), Expect = 2.6e-24, P = 2.6e-24
 Identities = 52/146 (35%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMAKKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   121 EVDEMIREADIDGDGQVNYEEFVQMM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVQMM 146

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 32/110 (29%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + K++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMAKKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 110

 Score = 85 (29.9 bits), Expect = 0.46, P = 0.37
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAKKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 138


>sp|P02593|CALM_HUMAN CALMODULIN >pir||MCHU calmodulin - human >pir||MCRT
            calmodulin - rat >pir||MCCH calmodulin - chicken >pir||JC1305
            calmodulin - Japanese medaka >pir||S37707 calmodulin - mouse
            >pir||I51402 calmodulin - African clawed frog >pir||I51202
            calmodulin - unclassified vertebrate >gi|50274 (X61432) calmodulin
            [Mus musculus] >gi|55867 (X14265) calmodulin III [Rattus
            norvegicus] >gi|57041 (X13933) calmodulin [Rattus rattus] >gi|57835
            (X13817) calmodulin [Rattus norvegicus] >gi|179810 (M27319)
            calmodulin [Homo sapiens] >gi|179884 (M19311) calmodulin [Homo
            sapiens] >gi|179888 (J04046) calmodulin [Homo sapiens] >gi|192365
            (M27844) calmodulin synthesis [Mus musculus] >gi|203256 (M19312)
            calmodulin [Rattus norvegicus] >gi|203258 (M17069) calmodulin
            [Rattus norvegicus] >gi|203260 (M16659) calmodulin [Rattus
            norvegicus] >gi|207977 (J04729) calmodulin [Artificial gene]
            >gi|211386 (M36167) calmodulin [Gallus gallus] >gi|211398 (L00101)
            calmodulin [Gallus gallus] >gi|214017 (K01944) calmodulin (cDNA
            clone 11G2) [Xenopus laevis] >gi|214019 (K01945) calmodulin (cDNA
            clone 71) [Xenopus laevis] >gi|469420 (M19380) calmodulin [Mus
            musculus] >gi|531827 (U12022) calmodulin [Homo sapiens]
            >gnl|PID|d1008897 (D45887) calmodulin [Homo sapiens] >gi|818020
            (X13833) calmodulin II [Rattus norvegicus] >gnl|PID|d1012563
            (D83350) calmodulin [Anas platyrhynchos] >gnl|PID|e10120 (X13931)
            calmodulin [Rattus rattus] >gi|2055425 (U94728) calmodulin [Homo
            sapiens]
            Length = 149

  Plus Strand HSPs:

 Score = 284 (100.0 bits), Expect = 2.6e-24, P = 2.6e-24
 Identities = 52/146 (35%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   121 EVDEMIREADIDGDGQVNYEEFVQMM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVQMM 146

 Score = 106 (37.3 bits), Expect = 0.00034, P = 0.00034
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 110

 Score = 85 (29.9 bits), Expect = 0.46, P = 0.37
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 138


>pir||MCBO calmodulin - bovine >pir||MCON calmodulin - salmon >pdb|1CLL|
           Calmodulin (Vertebrate) >pdb|1CTR|  Calmodulin Complexed With
           Trifluoperazine (1:1 Complex) >pdb|1CFD|  Calcium-Free Calmodulin
           Mol_id: 1; Molecule: Calmodulin; Chain: Null >pdb|1CFC|
           Calcium-Free Calmodulin Mol_id: 1; Molecule: Calmodulin; Chain: Null
           >pdb|1LIN|  Calmodulin Complexed With Trifluoperazine (1:4 Complex)
           Mol_id: 1; Molecule: Calmodulin; Chain: Null; Heterogen:
           Trifluoperazine (Tfp)
           Length = 148

  Plus Strand HSPs:

 Score = 284 (100.0 bits), Expect = 2.6e-24, P = 2.6e-24
 Identities = 52/146 (35%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVQMM 145

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVQMM 145

 Score = 105 (37.0 bits), Expect = 0.00043, P = 0.00043
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 109

 Score = 85 (29.9 bits), Expect = 0.45, P = 0.36
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>pdb|1CDL|A Homo sapiens >pdb|1CDL|B Homo sapiens >pdb|1CDL|C Homo sapiens
            >pdb|1CDL|D Homo sapiens
            Length = 147

  Plus Strand HSPs:

 Score = 284 (100.0 bits), Expect = 2.6e-24, P = 2.6e-24
 Identities = 52/146 (35%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVQMM 145

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVQMM 145

 Score = 105 (37.0 bits), Expect = 0.00035, P = 0.00035
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 109

 Score = 85 (29.9 bits), Expect = 0.43, P = 0.35
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>pdb|1CDM|A Bos taurus
            Length = 144

  Plus Strand HSPs:

 Score = 283 (99.6 bits), Expect = 3.3e-24, P = 3.3e-24
 Identities = 52/141 (36%), Positives = 91/141 (64%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     5 QIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 64

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE+++  
Sbjct:    65 FLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEM 121

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G++ +EEF ++M
Sbjct:   122 IREADIDGDGQVNYEEFVQMM 142

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     8 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 67

Query:   561 LMA 569
             +MA
Sbjct:    68 MMA 70

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    75 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 134

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   135 YEEFVQMM 142

 Score = 105 (37.0 bits), Expect = 8.6e-05, P = 8.6e-05
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     8 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 63

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    64 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 106

 Score = 85 (29.9 bits), Expect = 0.39, P = 0.32
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    24 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 83

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    84 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 134


>sp|P04465|CALM_TRYBB CALMODULIN >pir||MCUTG calmodulin - Trypanosoma brucei
            gambiense >pir||A48111 calmodulin C - Trypanosoma brucei >gi|10386
            (X56511) calmodulin [Trypanosoma (Trypanozoon) brucei]
            Length = 149

  Plus Strand HSPs:

 Score = 281 (98.9 bits), Expect = 5.4e-24, P = 5.4e-24
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + D DGSG 
Sbjct:     4 QLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +E++EAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTLMARKMQDSDSE---EEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKMM 146

 Score = 147 (51.7 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 28/75 (37%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ +  E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D+D
Sbjct:     1 MADQLSNEQIS-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQD 59

Query:   525 GSGKIEFEEFWELMA 569
             GSG I+F EF  LMA
Sbjct:    60 GSGTIDFPEFLTLMA 74

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  IM  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVKMM 146

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 27/102 (26%), Positives = 52/102 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D++G+G I  P
Sbjct:    12 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFP 67

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ D  S+E+++ A    D+DG+G I   E   +M
Sbjct:    68 EFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIM 110

 Score = 89 (31.3 bits), Expect = 0.14, P = 0.13
 Identities = 30/113 (26%), Positives = 56/113 (49%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D+   G I   +   +M    QD D E++++
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDGNGFISAAE---LRHIMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|P21251|CALM_STIJA CALMODULIN >pir||MCSFCU calmodulin - sea cucumber
            (Stichopus japonicus)
            Length = 148

  Plus Strand HSPs:

 Score = 281 (98.9 bits), Expect = 5.4e-24, P = 5.4e-24
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVTMM 145

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVTMM 145

 Score = 105 (37.0 bits), Expect = 0.00043, P = 0.00043
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 109

 Score = 85 (29.9 bits), Expect = 0.45, P = 0.36
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>sp|P18061|CALM_TRYCR CALMODULIN >pir||MCUTC calmodulin - Trypanosoma cruzi
            >gi|10604 (X52096) calmodulin (AA 1-149) [Trypanosoma cruzi]
            Length = 149

  Plus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 6.8e-24, P = 6.8e-24
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + D DGSG 
Sbjct:     4 QLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +E++EAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTLMARKMQDSDSE---EEIKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKMM 146

 Score = 147 (51.7 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 28/75 (37%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ +  E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D+D
Sbjct:     1 MADQLSNEQIS-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQD 59

Query:   525 GSGKIEFEEFWELMA 569
             GSG I+F EF  LMA
Sbjct:    60 GSGTIDFPEFLTLMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DSDSEEEIKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVKMM 146

 Score = 104 (36.6 bits), Expect = 0.00090, P = 0.00090
 Identities = 27/102 (26%), Positives = 52/102 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D++G+G I  P
Sbjct:    12 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFP 67

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ D  S+E+++ A    D+DG+G I   E   +M
Sbjct:    68 EFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHVM 110

 Score = 90 (31.7 bits), Expect = 0.11, P = 0.10
 Identities = 30/113 (26%), Positives = 56/113 (49%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D+   G I   +   +M    QD D E++++
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>gi|208092 (M11334) synthetic calmodulin [Artificial gene] >gi|208412 (M26151)
           camodulin [Artificial sequence]
           Length = 149

  Plus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 6.8e-24, P = 6.8e-24
 Identities = 52/146 (35%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQVNYEEFVQVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 32/109 (29%), Positives = 56/109 (51%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             +Q  DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     3 DQLTDEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 58

Query:   414 EGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P  L  + +++ D  S+E+L+ A    D+DG+G I   E   +M
Sbjct:    59 DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVM 110

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 18/64 (28%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 86 (30.3 bits), Expect = 0.35, P = 0.29
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQVN 138


>gnl|PID|e321197 (Y13578) calmodulin [Ciona intestinalis]
            Length = 149

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 8.7e-24, P = 8.7e-24
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   121 EVDEMIREADVDGDGQVNYEEFVNMM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 18/64 (28%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM 110

 Score = 85 (29.9 bits), Expect = 0.46, P = 0.37
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQVN 138


>pir||MCRB calmodulin - rabbit >pdb|2CLN|  Nz115 Trimethylcalmodulin Complex
           With Trifluoperazine (Theoretical Model) >pdb|3CLN|  Calmodulin
           >pdb|1DMO|  Calmodulin, Nmr, 30 Structures Calcium-Induced
           Conformational Change, Calcium-Binding Protein Mol_id: 1; Molecule:
           Calmodulin; Chain: Null; Engineered: Yes
           Length = 148

  Plus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 8.7e-24, P = 8.7e-24
 Identities = 51/146 (34%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E + DG G++ +EEF ++M
Sbjct:   120 EVDEMIREANIDGDGQVNYEEFVQMM 145

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 105 (37.0 bits), Expect = 0.00043, P = 0.00043
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 109

 Score = 104 (36.6 bits), Expect = 0.00078, P = 0.00078
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ + DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVQMM 145

 Score = 80 (28.2 bits), Expect = 1.9, P = 0.85
 Identities = 28/113 (24%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  + +G+G ++
Sbjct:    87 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREANIDGDGQVN 137


>gi|170076 (L01433) calmodulin [Glycine max] >prf||2121384D calmodulin [Glycine
           max]
           Length = 150

  Plus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.1e-23, P = 1.1e-23
 Identities = 54/150 (36%), Positives = 98/150 (65%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             +IL+E    QI ++++ F +FD+   G I   ++  ++ +++Q+  E++L+ +I + DAD
Sbjct:     3 DILSE---EQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDAD 59

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             G+G +EFDEF +L+       D E   +EL+EAF++FDK+ NGYIS   L+ ++  + + 
Sbjct:    60 GNGTIEFDEFLSLMAKKVKDTDAE---EELKEAFKVFDKDQNGYISASELRHVMINLGEK 116

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             L+DE++E  + E D DG G++ +EEF ++M
Sbjct:   117 LTDEEVEQMIKEADLDGDGQVNYEEFVKMM 146

 Score = 145 (51.0 bits), Expect = 2.7e-09, P = 2.7e-09
 Identities = 28/75 (37%), Positives = 51/75 (68%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  + +EAF LFDK+G+G I+   L  +++ +  + ++E+L+  + E+D D
Sbjct:     1 MADILSEEQIV-DFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G IEF+EF  LMA
Sbjct:    60 GNGTIEFDEFLSLMA 74

 Score = 132 (46.5 bits), Expect = 8.3e-08, P = 8.3e-08
 Identities = 27/110 (24%), Positives = 65/110 (59%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E++L+ + +++    N   +F    ++MA+ + +  AE      EE ++ F +FD+ + G
Sbjct:    46 EEELQDMISEVDADGNGTIEFDEFLSLMAKKVKDTDAE------EELKEAFKVFDKDQNG 99

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             YI A+++  +M  + +   ++++ ++I++ D DG G++ ++EF  ++ TV
Sbjct:   100 YISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTV 149

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 33/109 (30%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             EQ  D K+   L   FD DG G +  +E      TV  ++D+   ++EL++     D +G
Sbjct:     8 EQIVDFKEAFGL---FDKDGDGCITVEELA----TVIRSLDQNPTEEELQDMISEVDADG 60

Query:   420 NGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             NG I      +L+ K++ D  ++E+L+ A    D+D +G I   E   +M
Sbjct:    61 NGTIEFDEFLSLMAKKVKDTDAEEELKEAFKVFDKDQNGYISASELRHVM 110


>pir||S02690 calmodulin A - sea urchin (Arbacia punctulata) (fragment)
            Length = 141

  Plus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.1e-23, P = 1.1e-23
 Identities = 51/142 (35%), Positives = 90/142 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEF 554
             +++  + E D DG G++ +EEF
Sbjct:   120 EVDEMIREADIDGDGQVNYEEF 141

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 108 (38.0 bits), Expect = 4.0e-05, P = 4.0e-05
 Identities = 19/64 (29%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEF 326
             ++EF
Sbjct:   138 YEEF 141

 Score = 105 (37.0 bits), Expect = 8.6e-05, P = 8.6e-05
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 109

 Score = 85 (29.9 bits), Expect = 0.35, P = 0.29
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>pir||I49567 calmodulin - mouse >gi|469422 (M19381) calmodulin [Mus musculus]
            Length = 149

  Plus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.1e-23, P = 1.1e-23
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+     I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDNTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   121 EVDEMIREADIDGDGQVNYEEFVQMM 146

 Score = 132 (46.5 bits), Expect = 8.3e-08, P = 8.3e-08
 Identities = 25/75 (33%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+  I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDNTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVQMM 146

 Score = 100 (35.2 bits), Expect = 0.0040, P = 0.0040
 Identities = 30/110 (27%), Positives = 53/110 (48%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG   +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDNTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 110

 Score = 85 (29.9 bits), Expect = 0.46, P = 0.37
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 138


>sp|P11118|CALM_EUGGR CALMODULIN >pir||MCEG calmodulin - Euglena gracilis
            Length = 148

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 52/141 (36%), Positives = 91/141 (64%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + D DGSG ++F E
Sbjct:     8 QIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPE 67

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+    +  D E   +E++EAFR+FDK+GNG+IS   L+ ++  + + L+DE+++  
Sbjct:    68 FLTLMSRKMHDTDTE---EEIKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEM 124

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G+I +EEF ++M
Sbjct:   125 IREADVDGDGQINYEEFVKMM 145

 Score = 141 (49.6 bits), Expect = 7.8e-09, P = 7.8e-09
 Identities = 25/63 (39%), Positives = 44/63 (69%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D+DGSG I+F EF  
Sbjct:    11 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLT 70

Query:   561 LMA 569
             LM+
Sbjct:    71 LMS 73

 Score = 106 (37.3 bits), Expect = 0.00027, P = 0.00027
 Identities = 17/63 (26%), Positives = 40/63 (63%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ ++EF 
Sbjct:    83 EEIKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 142

Query:   330 ALV 338
              ++
Sbjct:   143 KMM 145

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 26/102 (25%), Positives = 52/102 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D++G+G I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFP 66

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ D  ++E+++ A    D+DG+G I   E   +M
Sbjct:    67 EFLTLMSRKMHDTDTEEEIKEAFRVFDKDGNGFISAAELRHVM 109

 Score = 86 (30.3 bits), Expect = 0.34, P = 0.29
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D+   G I   +   +M     D D E++++
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLTLMSRKMHDTDTEEEIK 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    87 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 137


>gi|2291247 (AF016429) similar to EF-hand calcium binding proteins; most
            similar to calmodulin [Caenorhabditis elegans]
            Length = 149

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   121 EVDEMIREADIDGDGQVNYEEFVTMM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/70 (27%), Positives = 42/70 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 138

Query:   315 FDEFCALVYT 344
             ++EF  ++ T
Sbjct:   139 YEEFVTMMTT 148

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM 110

 Score = 84 (29.6 bits), Expect = 0.63, P = 0.47
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 138


>sp|P07181|CALM_DROME CALMODULIN >pir||MCFF calmodulin - fruit fly (Drosophila
            melanogaster) >pir||MCGAC calmodulin - California sea hare >gi|5572
            (X56888) Calmodulin [Aplysia californica] >gnl|PID|e293331 (Y09863)
            calmodulin protein [Branchiostoma floridae] >gnl|PID|e293340
            (Y09880) calmodulin [Branchiostoma lanceolatum] >gnl|PID|d1020568
            (AB003081) calmodulin [Branchiostoma lanceolatum] >gnl|PID|d1020569
            (AB003082) calmodulin [Branchiostoma floridae] >gnl|PID|d1020570
            (AB003083) calmodulin [Halocynthia roretzi]
            Length = 149

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   121 EVDEMIREADIDGDGQVNYEEFVTMM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 106 (37.3 bits), Expect = 0.00034, P = 0.00034
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVTMM 146

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM 110

 Score = 84 (29.6 bits), Expect = 0.63, P = 0.47
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 138


>pir||MCLQ calmodulin - migratory locust >pdb|4CLN|  Calmodulin >pdb|2BBM|A
           Drosophila melanogaster >pdb|2BBN|A Drosophila melanogaster >gi|7688
           (Y00133) calmodulin (148 AA); pid:g7688 [Drosophila melanogaster]
           Length = 148

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVTMM 145

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 106 (37.3 bits), Expect = 0.00027, P = 0.00027
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVTMM 145

 Score = 104 (36.6 bits), Expect = 0.00078, P = 0.00078
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM 109

 Score = 84 (29.6 bits), Expect = 0.61, P = 0.46
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>gnl|PID|d1001665 (D10363) calmodulin [Oryzias latipes] >gnl|PID|d1001666
            (D10364) calmodulin [Oryzias latipes] >gnl|PID|d1001667 (D10365)
            calmodulin [Oryzias latipes] >gnl|PID|d1001668 (D10366) calmodulin
            [Oryzias latipes]
            Length = 136

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 51/137 (37%), Positives = 88/137 (64%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     2 QIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 61

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE+++  
Sbjct:    62 FLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEM 118

Query:   504 VDEIDEDGSGKIEFEEF 554
             + E D DG G++ +EEF
Sbjct:   119 IREADIDGDGQVNYEEF 135

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     5 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 64

Query:   561 LMA 569
             +MA
Sbjct:    65 MMA 67

 Score = 108 (38.0 bits), Expect = 4.0e-05, P = 4.0e-05
 Identities = 19/64 (29%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    72 DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 131

Query:   315 FDEF 326
             ++EF
Sbjct:   132 YEEF 135

 Score = 105 (37.0 bits), Expect = 8.6e-05, P = 8.6e-05
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     5 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 60

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    61 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 103

 Score = 85 (29.9 bits), Expect = 0.28, P = 0.24
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    21 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 80

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    81 EAFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 131


>pdb|1DEG|  Calmodulin Mutant With Glu 84 Deleted (Del E84)
            Length = 142

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 52/141 (36%), Positives = 94/141 (66%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     4 QIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 63

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++   A  + K+T  +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE+++  
Sbjct:    64 FLTMM---ARKM-KDTDSEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEM 119

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E + DG G++ +EEF ++M
Sbjct:   120 IREANIDGDGQVNYEEFVQMM 140

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     7 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 66

Query:   561 LMA 569
             +MA
Sbjct:    67 MMA 69

 Score = 103 (36.3 bits), Expect = 0.00029, P = 0.00029
 Identities = 17/63 (26%), Positives = 40/63 (63%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ + DG G++ ++EF 
Sbjct:    78 EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFV 137

Query:   330 ALV 338
              ++
Sbjct:   138 QMM 140

 Score = 102 (35.9 bits), Expect = 0.00056, P = 0.00056
 Identities = 26/102 (25%), Positives = 45/102 (44%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     7 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 62

Query:   441 TLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 ++     D   E++  A    D+DG+G I   E   +M
Sbjct:    63 EFLTMMARKMKDTDSEEIREAFRVFDKDGNGYISAAELRHVM 104

 Score = 84 (29.6 bits), Expect = 0.50, P = 0.40
 Identities = 27/113 (23%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D +++R+
Sbjct:    23 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEIRE 82

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
               R FD DG+G +   E   L + + N  +K T  +E+ E  R  + +G+G ++
Sbjct:    83 AFRVFDKDGNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREANIDGDGQVN 132


>pir||MCJZR calmodulin - sea pansy (Renilla reniformis) (tentative sequence)
            Length = 147

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 51/147 (34%), Positives = 93/147 (63%), Frame = +3

Query:   126 AEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSG 305
             A++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG G
Sbjct:     1 ADLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGBG 60

Query:   306 KLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSD 485
              ++F EF  ++       D E   +E+REAFR+FDK+G+G+IS   L+ ++  + + L+D
Sbjct:    61 TIDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTD 117

Query:   486 EQLEAAVDEIDEDGSGKIEFEEFWELM 566
             E+++  + E D DG G++ +EEF ++M
Sbjct:   118 EEVDEMIREADIDGDGQVNYEEFVKMM 144

 Score = 135 (47.5 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 24/63 (38%), Positives = 42/63 (66%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG G I+F EF  
Sbjct:    10 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGBGTIDFPEFLT 69

Query:   561 LMA 569
             +MA
Sbjct:    70 MMA 72

 Score = 105 (37.0 bits), Expect = 0.00035, P = 0.00035
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    77 DTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 136

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   137 YEEFVKMM 144

 Score = 103 (36.3 bits), Expect = 0.0010, P = 0.0010
 Identities = 30/107 (28%), Positives = 53/107 (49%), Frame = +3

Query:   246 DFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKE 416
             D  E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     D +
Sbjct:     2 DLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDAD 57

Query:   417 GNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             G+G I  P  L  + +++ D  S+E++  A    D+DG G I   E   +M
Sbjct:    58 GBGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVM 108

 Score = 83 (29.2 bits), Expect = 0.79, P = 0.54
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    26 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGBGTIDFPEFLTMMARKMKDTDSEEEIR 85

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    86 EAFRVFDKDGDGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 136


>sp|Q03509|CAL6_ARATH CALMODULIN-6 >pir||S35187 calmodulin 6 - Arabidopsis
            thaliana >gi|16227 (Z12024) calmodulin [Arabidopsis thaliana]
            Length = 149

  Plus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 1.8e-23, P = 1.8e-23
 Identities = 53/146 (36%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + LSDE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 77 (27.1 bits), Expect = 4.6, P = 0.99
 Identities = 26/113 (23%), Positives = 53/113 (46%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   ++  +   +  E + + +REA    D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEMIREA----DVDGDGQIN 138


>prf||0409298A troponin C-like protein [Bos taurus]
            Length = 148

  Plus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 1.8e-23, P = 1.8e-23
 Identities = 50/146 (34%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGBGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+G+GYIS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGBGYISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E + DG G++ +EEF ++M
Sbjct:   120 EVDEMIREANIDGDGEVNYEEFVQMM 145

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGBGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 104 (36.6 bits), Expect = 0.00078, P = 0.00078
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ + DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGBGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGEVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVQMM 145

 Score = 104 (36.6 bits), Expect = 0.00078, P = 0.00078
 Identities = 28/102 (27%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGBGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGBGYISAAELRHVM 109

 Score = 78 (27.5 bits), Expect = 3.4, P = 0.97
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG G +   E   L + + N  +K T  +E+ E  R  + +G+G ++
Sbjct:    87 EAFRVFDKDGBGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREANIDGDGEVN 137


>sp|P02597|CALS_CHICK CALMODULIN, STRIATED MUSCLE >pir||MCCHM calmodulin,
            striated muscle - chicken >gi|211542 (K02907) calmodulin-like
            protein [Gallus gallus]
            Length = 149

  Plus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 1.8e-23, P = 1.8e-23
 Identities = 54/148 (36%), Positives = 94/148 (63%), Frame = +3

Query:   123 LAE-IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             +AE +   QI E+++ F +FDR   G I   ++G +M ++ Q+  E +L+ ++ + DADG
Sbjct:     1 MAERLSEEQIAEFKEAFSLFDRDGDGCITTMELGTVMRSLGQNPTEAELQDMVGEVDADG 60

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
             SG ++F EF +L+       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L
Sbjct:    61 SGTIDFPEFLSLMARKMRDSDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKL 117

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +DE+++  + E D +  G++ +EEF  +M
Sbjct:   118 TDEEVDEMIKEADCNNDGQVNYEEFVRMM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 28/75 (37%), Positives = 48/75 (64%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A  + +E +  E +EAF LFD++G+G I+   L  +++ +  + ++ +L+  V E+D D
Sbjct:     1 MAERLSEEQIA-EFKEAFSLFDRDGDGCITTMELGTVMRSLGQNPTEAELQDMVGEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             GSG I+F EF  LMA
Sbjct:    60 GSGTIDFPEFLSLMA 74

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 16/68 (23%), Positives = 40/68 (58%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++I++ D +  G++ 
Sbjct:    79 DSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIKEADCNNDGQVN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVRMM 146

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 30/110 (27%), Positives = 56/110 (50%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M +   E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MAERLSEEQIAEFKEAFSLFDRDGDGCITTME----LGTVMRSLGQNPTEAELQDMVGEV 56

Query:   408 DKEGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +G+G I  P   +L+ +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGSGTIDFPEFLSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVM 110


>sp|P04352|CALM_CHLRE CALMODULIN >pir||MCKM calmodulin - Chlamydomonas
            reinhardtii >gi|167411 (M20729) calmodulin [Chlamydomonas
            reinhardtii]
            Length = 163

  Plus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 1.8e-23, P = 1.8e-23
 Identities = 56/160 (35%), Positives = 97/160 (60%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             MA + +++  E    QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I
Sbjct:     1 MAANTEQLTEE----QIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI 56

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + DADG+G ++F EF  L+       D E    ELREAF++FDK+GNG+IS   L+ ++
Sbjct:    57 SEVDADGNGTIDFPEFLMLMARKMKETDHED---ELREAFKVFDKDGNGFISAAELRHVM 113

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDA 578
               + + LS+E+++  + E D DG G++ +EEF  +M   A
Sbjct:   114 TNLGEKLSEEEVDEMIREADVDGDGQVNYEEFVRMMTSGA 153

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 29/75 (38%), Positives = 46/75 (61%), Frame = +3

Query:   348 ANTVDKETLQ-KELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             ANT      Q  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  + E+D D
Sbjct:     3 ANTEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMISEVDAD 62

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    63 GNGTIDFPEFLMLMA 77

 Score = 114 (40.1 bits), Expect = 6.9e-05, P = 6.9e-05
 Identities = 21/73 (28%), Positives = 45/73 (61%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             +E ++ F +FD+   G+I A ++  +M  + +   E+++ ++IR+ D DG G++ ++EF 
Sbjct:    87 DELREAFKVFDKDGNGFISAAELRHVMTNLGEKLSEEEVDEMIREADVDGDGQVNYEEFV 146

Query:   330 ALVYTVANTVDKE 368
              ++ T   T DK+
Sbjct:   147 RMM-TSGATDDKD 158

 Score = 97 (34.1 bits), Expect = 0.021, P = 0.020
 Identities = 30/113 (26%), Positives = 55/113 (48%), Frame = +3

Query:   228 MHAMEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAF 398
             M A  +   E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++  
Sbjct:     1 MAANTEQLTEEQIAEFKEAFALFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMI 56

Query:   399 RLFDKEGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                D +GNG I  P    L+ +++ +   +++L  A    D+DG+G I   E   +M
Sbjct:    57 SEVDADGNGTIDFPEFLMLMARKMKETDHEDELREAFKVFDKDGNGFISAAELRHVM 113

 Score = 85 (29.9 bits), Expect = 0.65, P = 0.48
 Identities = 28/132 (21%), Positives = 60/132 (45%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  +  +  E E Q      D    G I   +   +M   M++   E +LR
Sbjct:    31 ITTKELGTVMRSLGQNPTEAELQDMISEVDADGNGTIDFPEFLMLMARKMKETDHEDELR 90

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLK 449
             +  + FD DG+G +   E   ++  +   + +E + + +REA    D +G+G ++     
Sbjct:    91 EAFKVFDKDGNGFISAAELRHVMTNLGEKLSEEEVDEMIREA----DVDGDGQVNYEEFV 146

Query:   450 ALLKEIADDLSDEQ 491
              ++   A D  D++
Sbjct:   147 RMMTSGATDDKDKK 160


>sp|P11121|CALM_PYUSP CALMODULIN >pir||MCAZS calmodulin - sea squirt
            Length = 148

  Plus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 1.8e-23, P = 1.8e-23
 Identities = 51/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVTMM 145

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 26/74 (35%), Positives = 48/74 (64%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
              G I+F EF  +MA
Sbjct:    60 DGTIDFPEFLTMMA 73

 Score = 106 (37.3 bits), Expect = 0.00027, P = 0.00027
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVTMM 145

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 27/102 (26%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +G+G I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM 109

 Score = 84 (29.6 bits), Expect = 0.61, P = 0.46
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>sp|P11120|CALM_PLECO CALMODULIN >pir||MCMRP calmodulin - cornucopia mushroom
            Length = 148

  Plus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.3e-23, P = 2.3e-23
 Identities = 50/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E++EAF++FDK+GNGYIS   L+ ++  + + L+D 
Sbjct:    63 IDFPEFLTMMARKMRDTDSE---EEIKEAFKVFDKDGNGYISAAELRHVMTNLGEKLTDN 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   120 EVDEMIREADIDGDGQINYEEFVKMM 145

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLSEEQIS-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 19/68 (27%), Positives = 40/68 (58%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   + ++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGEKLTDNEVDEMIREADIDGDGQIN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVKMM 145

 Score = 107 (37.7 bits), Expect = 0.00010, P = 0.00010
 Identities = 28/102 (27%), Positives = 51/102 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+++ A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVM 109

 Score = 79 (27.8 bits), Expect = 2.5, P = 0.92
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++++
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMRDTDSEEEIK 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T   E+ E  R  D +G+G I+
Sbjct:    87 EAFKVFDKDGNGYISAAE---LRHVMTNLGEKLT-DNEVDEMIREADIDGDGQIN 137


>prf||1206346A calmodulin [Chlamydomonas reinhardtii]
            Length = 162

  Plus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.3e-23, P = 2.3e-23
 Identities = 53/150 (35%), Positives = 92/150 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     6 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMISEVDADGNGT 65

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E    ELREAF++FDK+GNG+IS   L+ ++  + + LS+E
Sbjct:    66 IDFPEFLMLMARKMKETDHED---ELREAFKVFDKDGNGFISAAELRHVMTNLGEKLSEE 122

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELMAGDA 578
             +++  + E D DG G++ +EEF  +M   A
Sbjct:   123 EVDEMIREADVDGDGQVNYEEFVRMMTSGA 152

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 29/75 (38%), Positives = 46/75 (61%), Frame = +3

Query:   348 ANTVDKETLQ-KELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             ANT      Q  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  + E+D D
Sbjct:     2 ANTEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMISEVDAD 61

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    62 GNGTIDFPEFLMLMA 76

 Score = 114 (40.1 bits), Expect = 6.0e-05, P = 6.0e-05
 Identities = 21/73 (28%), Positives = 45/73 (61%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             +E ++ F +FD+   G+I A ++  +M  + +   E+++ ++IR+ D DG G++ ++EF 
Sbjct:    86 DELREAFKVFDKDGNGFISAAELRHVMTNLGEKLSEEEVDEMIREADVDGDGQVNYEEFV 145

Query:   330 ALVYTVANTVDKE 368
              ++ T   T DK+
Sbjct:   146 RMM-TSGATDDKD 157

 Score = 95 (33.4 bits), Expect = 0.036, P = 0.036
 Identities = 29/109 (26%), Positives = 54/109 (49%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             EQ  +E+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     5 EQLTEEQIAEFKEAFALFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMISEVDA 60

Query:   414 EGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P    L+ +++ +   +++L  A    D+DG+G I   E   +M
Sbjct:    61 DGNGTIDFPEFLMLMARKMKETDHEDELREAFKVFDKDGNGFISAAELRHVM 112

 Score = 85 (29.9 bits), Expect = 0.64, P = 0.47
 Identities = 28/132 (21%), Positives = 60/132 (45%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  +  +  E E Q      D    G I   +   +M   M++   E +LR
Sbjct:    30 ITTKELGTVMRSLGQNPTEAELQDMISEVDADGNGTIDFPEFLMLMARKMKETDHEDELR 89

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLK 449
             +  + FD DG+G +   E   ++  +   + +E + + +REA    D +G+G ++     
Sbjct:    90 EAFKVFDKDGNGFISAAELRHVMTNLGEKLSEEEVDEMIREA----DVDGDGQVNYEEFV 145

Query:   450 ALLKEIADDLSDEQ 491
              ++   A D  D++
Sbjct:   146 RMMTSGATDDKDKK 159


>prf||0608335A calmodulin [Bos taurus]
            Length = 148

  Plus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.3e-23, P = 2.3e-23
 Identities = 51/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+G+GYIS   L  ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGDGYISAAELTHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVQMM 145

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 26/74 (35%), Positives = 48/74 (64%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
              G I+F EF  +MA
Sbjct:    60 DGTIDFPEFLTMMA 73

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGDGYISAAELTHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVQMM 145

 Score = 100 (35.2 bits), Expect = 0.0037, P = 0.0037
 Identities = 27/102 (26%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +G+G I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGDGYISAAELTHVM 109

 Score = 87 (30.6 bits), Expect = 0.25, P = 0.22
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGDGYISAAE---LTHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>gi|162030 (K02944) calmodulin A [Trypanosoma brucei] >gi|162031 (K02944)
           calmodulin B [Trypanosoma brucei] >gi|162032 (K02944) calmodulin C
           [Trypanosoma brucei]
           Length = 149

  Plus Strand HSPs:

 Score = 274 (96.5 bits), Expect = 3.0e-23, P = 3.0e-23
 Identities = 51/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + D DGSG 
Sbjct:     4 QLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +E++EAFR+FDK+GNG+ S   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTLMARKMQDSDSE---EEIKEAFRVFDKDGNGFNSAAELRHIMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKMM 146

 Score = 147 (51.7 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 28/75 (37%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ +  E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D+D
Sbjct:     1 MADQLSNEQIS-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQD 59

Query:   525 GSGKIEFEEFWELMA 569
             GSG I+F EF  LMA
Sbjct:    60 GSGTIDFPEFLTLMA 74

 Score = 103 (36.3 bits), Expect = 0.0013, P = 0.0013
 Identities = 18/68 (26%), Positives = 40/68 (58%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+  A ++  IM  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DSDSEEEIKEAFRVFDKDGNGFNSAAELRHIMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVKMM 146

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 24/91 (26%), Positives = 48/91 (52%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D++G+G I  P
Sbjct:    12 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFP 67

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSG 533
                 L+ +++ D  S+E+++ A    D+DG+G
Sbjct:    68 EFLTLMARKMQDSDSEEEIKEAFRVFDKDGNG 99

 Score = 93 (32.7 bits), Expect = 0.040, P = 0.039
 Identities = 30/113 (26%), Positives = 56/113 (49%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D+   G I   +   +M    QD D E++++
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G   F+    L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDGNG---FNSAAELRHIMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|P04353|CALM_SPIOL CALMODULIN >pir||MCSP calmodulin - spinach
            Length = 148

  Plus Strand HSPs:

 Score = 274 (96.5 bits), Expect = 3.0e-23, P = 3.0e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 ZLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   120 EVDEMIREADVDGDGQINYEEFVKVM 145

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    11 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 70

Query:   561 LMA 569
             LMA
Sbjct:    71 LMA 73

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 137

Query:   315 FDEF 326
             ++EF
Sbjct:   138 YEEF 141

 Score = 100 (35.2 bits), Expect = 0.0037, P = 0.0037
 Identities = 30/109 (27%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             ++  DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     2 ZZLTDEQIAEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 57

Query:   414 EGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P  L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    58 DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 109

 Score = 79 (27.8 bits), Expect = 2.5, P = 0.92
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    87 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 137


>sp|P25069|CAL2_ARATH CALMODULIN-2/3/5 >pir||S22503 calmodulin - Arabidopsis
            thaliana >pir||S53006 calmodulin - leaf mustard >pir||S71513
            calmodulin - Arabidopsis thaliana >gi|166651 (M38380) calmodulin-2
            [Arabidopsis thaliana] >gi|166653 (M73711) calmodulin-3
            [Arabidopsis thaliana] >gi|474183 (X67273) calmodulin [Arabidopsis
            thaliana] >gi|497992 (U10150) calmodulin [Brassica napus]
            >gi|899058 (M88307) calmodulin [Brassica juncea] >gnl|PID|d1008878
            (D45848) calmodulin [Arabidopsis thaliana] >prf||1803520A
            calmodulin 2 [Arabidopsis thaliana]
            Length = 149

  Plus Strand HSPs:

 Score = 274 (96.5 bits), Expect = 3.0e-23, P = 3.0e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIKEADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 106 (37.3 bits), Expect = 0.00034, P = 0.00034
 Identities = 17/64 (26%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++I++ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110


>pir||MCDO calmodulin - slime mold (Dictyostelium discoideum)
           Length = 151

  Plus Strand HSPs:

 Score = 274 (96.5 bits), Expect = 3.0e-23, P = 3.0e-23
 Identities = 49/146 (33%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     5 ZLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGN 64

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAF++FDK+GNGYIS   L+ ++  + + L++E
Sbjct:    65 IDFPEFLTMMARKMQDTDTE---EEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNE 121

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ ++EF ++M
Sbjct:   122 EVDEMIREADLDGDGQVNYDEFVKMM 147

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    13 EFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLT 72

Query:   561 LMA 569
             +MA
Sbjct:    73 MMA 75

 Score = 114 (40.1 bits), Expect = 8.6e-06, P = 8.6e-06
 Identities = 19/63 (30%), Positives = 40/63 (63%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE ++ F +FD+   GYI A ++  +M ++ +    +++ ++IR+ D DG G++ +DEF 
Sbjct:    85 EEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREADLDGDGQVNYDEFV 144

Query:   330 ALV 338
              ++
Sbjct:   145 KMM 147

 Score = 108 (38.0 bits), Expect = 0.00016, P = 0.00016
 Identities = 30/111 (27%), Positives = 56/111 (50%), Frame = +3

Query:   234 AMEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRL 404
             A  ++  E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++    
Sbjct:     1 ASSZZLTEEQIAEFKEAFSLFDKDGDGSITTKE----LGTVMRSLGQNPTEAELQDMINE 56

Query:   405 FDKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              D +GNG I  P  L  + +++ D  ++E++  A    D+DG+G I   E   +M
Sbjct:    57 VDADGNGNIDFPEFLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVM 111

 Score = 87 (30.6 bits), Expect = 0.28, P = 0.24
 Identities = 26/114 (22%), Positives = 56/114 (49%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQL 266
             +I  +++  ++  +  +  E E Q   +  D    G I   +   +M    QD D E+++
Sbjct:    28 SITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLTMMARKMQDTDTEEEI 87

Query:   267 RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             R+  + FD DG+G +   E   ++ ++   +  E + + +REA    D +G+G ++
Sbjct:    88 REAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREA----DLDGDGQVN 139


>sp|P17928|CALM_MEDSA CALMODULIN >pir||MCAA calmodulin - alfalfa >gi|19579
            (X52398) calmodulin (AA 1-149) [Medicago sativa] >gi|170070
            (L01430) calmodulin [Glycine max] >gi|170074 (L01432) calmodulin
            [Glycine max] >gi|506852 (L20507) calmodulin [Vigna radiata]
            >prf||2121384A calmodulin [Glycine max] >prf||2121384C calmodulin
            [Glycine max]
            Length = 149

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/75 (36%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ +  E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTDEQIS-EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLNLMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 100 (35.2 bits), Expect = 0.0040, P = 0.0040
 Identities = 31/109 (28%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             +Q  DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     3 DQLTDEQISEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 58

Query:   414 EGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P  L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    59 DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|Q03510|CAL4_ARATH CALMODULIN-4 >pir||S35185 calmodulin 4 - Arabidopsis
            thaliana >gi|16223 (Z12022) calmodulin [Arabidopsis thaliana]
            Length = 149

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 53/146 (36%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMAKKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++E  + E D DG G+I  EEF ++M
Sbjct:   121 EVEEMIREADVDGDGQINHEEFVKIM 146

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/75 (36%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ +  E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTDEQIS-EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLNLMA 74

 Score = 108 (38.0 bits), Expect = 8.0e-05, P = 8.0e-05
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQIN 138

Query:   315 FDEFCALV 338
              +EF  ++
Sbjct:   139 HEEFVKIM 146

 Score = 103 (36.3 bits), Expect = 0.0013, P = 0.0013
 Identities = 32/109 (29%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             +Q  DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     3 DQLTDEQISEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 58

Query:   414 EGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P  L  + K++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    59 DGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 81 (28.5 bits), Expect = 1.5, P = 0.78
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVEEMIREADVDGDGQIN 138


>sp|P27164|CAL3_PETHY CALMODULIN-RELATED PROTEIN >gi|169205 (M80831)
            calmodulin-related protein [Petunia hybrida]
            Length = 184

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 113 (39.8 bits), Expect = 0.00033, P = 0.00033
 Identities = 23/97 (23%), Positives = 53/97 (54%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNG 425
             ++EF  ++  +AN   +  +++  R       +  NG
Sbjct:   139 YEEFVKVM--MANR-RRRRIEESKRSVNSNISRSNNG 172

 Score = 98 (34.5 bits), Expect = 0.026, P = 0.026
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 80 (28.2 bits), Expect = 3.7, P = 0.98
 Identities = 33/147 (22%), Positives = 65/147 (44%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTL 446
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+    +
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQINYEEFV 143

Query:   447 KALLKEIADDLSDEQLEAAVDEIDEDGSGK 536
             K ++        +E   +    I    +G+
Sbjct:   144 KVMMANRRRRRIEESKRSVNSNISRSNNGR 173


>sp|P27162|CAL1_PETHY CALMODULIN 1 >pir||MCPZDC calmodulin - carrot
            >pir||S22971 calmodulin - trumpet lily >pir||S40301 calmodulin -
            Red bryony >pir||S70768 calmodulin CAM81 - garden petunia >gi|18326
            (X59751) calmodulin [Daucus carota] >gi|19447 (Z12839) calmodulin
            [Lilium longiflorum] >gi|169207 (M80836) calmodulin [Petunia
            hybrida] >gi|308900 (L18912) calmodulin [Lilium longiflorum]
            >gi|505154 (X60738) Calmodulin [Malus domestica] >gi|535444
            (U13882) calmodulin [Pisum sativum] >prf||1909349A calmodulin
            [Daucus carota]
            Length = 149

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|P19533|CALM_EMENI CALMODULIN >pir||MCAS calmodulin - Emericella nidulans
            >pir||JC4216 calmodulin - Aspergillus oryzae >gi|168031 (J05545)
            calmodulin [Emericella nidulans] >gi|521146 (U12505) calmodulin
            [Ajellomyces capsulatus] >gnl|PID|d1008508 (D44468) calmodulin
            [Aspergillus oryzae]
            Length = 149

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 48/141 (34%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q+ EY++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD +G ++F E
Sbjct:     9 QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAF++FD++ NG+IS   L+ ++  I + L+D++++  
Sbjct:    69 FLTMMARKMKDTDSE---EEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEM 125

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D+DG G+I++ EF +LM
Sbjct:   126 IREADQDGDGRIDYNEFVQLM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+++ +E +  E +EAF LFDK+G+G I+   L  +++ +  + S+ +L+  ++E+D D
Sbjct:     1 MADSLTEEQVS-EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
              +G I+F EF  +MA
Sbjct:    60 NNGTIDFPEFLTMMA 74

 Score = 117 (41.2 bits), Expect = 4.0e-06, P = 4.0e-06
 Identities = 26/107 (24%), Positives = 58/107 (54%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++   +N    F     +MA  + +  +E      EE ++ F +FDR   G
Sbjct:    46 ESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSE------EEIREAFKVFDRDNNG 99

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
             +I A ++  +M ++ +   + ++ ++IR+ D DG G+++++EF  L+
Sbjct:   100 FISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQLM 146

 Score = 94 (33.1 bits), Expect = 0.030, P = 0.029
 Identities = 29/110 (26%), Positives = 52/110 (47%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G++   E    + TV  ++ +   + EL++     
Sbjct:     1 MADSLTEEQVSEYKEAFSLFDKDGDGQITTKE----LGTVMRSLGQNPSESELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D + NG I  P  L  + +++ D  S+E++  A    D D +G I   E   +M
Sbjct:    57 DADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVM 110

 Score = 76 (26.8 bits), Expect = 6.1, P = 1.0
 Identities = 24/112 (21%), Positives = 54/112 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
             +  + FD D +G +   E   ++ ++   +  + + + +REA    D++G+G I
Sbjct:    88 EAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREA----DQDGDGRI 137


>sp|P04630|CALL_CAEEL CALMODULIN-LIKE PROTEIN >pir||A24921 calmodulin-like
            protein - Caenorhabditis elegans >gi|6658 (X04259) cal-1
            [Caenorhabditis elegans]
            Length = 161

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 50/152 (32%), Positives = 98/152 (64%), Frame = +3

Query:   114 DEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDA 293
             ++I+ ++   +I+E+++ F MFD+   G I   ++G  M ++ Q+  E+++ ++I + D 
Sbjct:    12 EDIIKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDI 71

Query:   294 DGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIAD 473
             DG+G++EF EFC ++  +     KET  + +REAFR+FDK+GNG I+    +  +  +  
Sbjct:    72 DGNGQIEFPEFCVMMKRMM----KETDSEMIREAFRVFDKDGNGVITAQEFRYFMVHMGM 127

Query:   474 DLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
               S+E+++  + E+D DG G+I++EEF ++M+
Sbjct:   128 QFSEEEVDEMIKEVDVDGDGEIDYEEFVKMMS 159

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 25/62 (40%), Positives = 42/62 (67%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E REAF +FDK+GNG IS   L   ++ +  + +++++   ++E+D DG+G+IEF EF  
Sbjct:    25 EFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNGQIEFPEFCV 84

Query:   561 LM 566
             +M
Sbjct:    85 MM 86

 Score = 107 (37.7 bits), Expect = 0.00077, P = 0.00077
 Identities = 27/104 (25%), Positives = 48/104 (46%), Frame = +3

Query:   243 QDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGN 422
             ++ DE   R+    FD DG+G +   E    +     ++ +   ++E+ E     D +GN
Sbjct:    21 EEIDE--FREAFMMFDKDGNGTISTKELGIAM----RSLGQNPTEQEILEMINEVDIDGN 74

Query:   423 GYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             G I  P    ++K +  +   E +  A    D+DG+G I  +EF
Sbjct:    75 GQIEFPEFCVMMKRMMKETDSEMIREAFRVFDKDGNGVITAQEF 118

 Score = 103 (36.3 bits), Expect = 0.0030, P = 0.0030
 Identities = 21/73 (28%), Positives = 40/73 (54%), Frame = +3

Query:   120 ILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             ++ E D   I E    F +FD+   G I A +    M  M   F E+++ ++I++ D DG
Sbjct:    89 MMKETDSEMIREA---FRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDG 145

Query:   300 SGKLEFDEFCALV 338
              G+++++EF  ++
Sbjct:   146 DGEIDYEEFVKMM 158

 Score = 77 (27.1 bits), Expect = 5.9, P = 1.0
 Identities = 22/94 (23%), Positives = 43/94 (45%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             +E  +  +  D    G I   +   +M  M ++ D + +R+  R FD DG+G +   EF 
Sbjct:    60 QEILEMINEVDIDGNGQIEFPEFCVMMKRMMKETDSEMIREAFRVFDKDGNGVITAQEFR 119

Query:   330 ALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
               +  +     +E + + ++E     D +G+G I
Sbjct:   120 YFMVHMGMQFSEEEVDEMIKEV----DVDGDGEI 149


>gnl|PID|e255885 (Z77653) C13C12.1 [Caenorhabditis elegans]
            Length = 218

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 50/152 (32%), Positives = 98/152 (64%), Frame = +3

Query:   114 DEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDA 293
             ++I+ ++   +I+E+++ F MFD+   G I   ++G  M ++ Q+  E+++ ++I + D 
Sbjct:    69 EDIIKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDI 128

Query:   294 DGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIAD 473
             DG+G++EF EFC ++  +     KET  + +REAFR+FDK+GNG I+    +  +  +  
Sbjct:   129 DGNGQIEFPEFCVMMKRMM----KETDSEMIREAFRVFDKDGNGVITAQEFRYFMVHMGM 184

Query:   474 DLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
               S+E+++  + E+D DG G+I++EEF ++M+
Sbjct:   185 QFSEEEVDEMIKEVDVDGDGEIDYEEFVKMMS 216

 Score = 137 (48.2 bits), Expect = 7.2e-07, P = 7.2e-07
 Identities = 25/62 (40%), Positives = 42/62 (67%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E REAF +FDK+GNG IS   L   ++ +  + +++++   ++E+D DG+G+IEF EF  
Sbjct:    82 EFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNGQIEFPEFCV 141

Query:   561 LM 566
             +M
Sbjct:   142 MM 143

 Score = 107 (37.7 bits), Expect = 0.0037, P = 0.0037
 Identities = 27/104 (25%), Positives = 48/104 (46%), Frame = +3

Query:   243 QDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGN 422
             ++ DE   R+    FD DG+G +   E    +     ++ +   ++E+ E     D +GN
Sbjct:    78 EEIDE--FREAFMMFDKDGNGTISTKELGIAM----RSLGQNPTEQEILEMINEVDIDGN 131

Query:   423 GYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             G I  P    ++K +  +   E +  A    D+DG+G I  +EF
Sbjct:   132 GQIEFPEFCVMMKRMMKETDSEMIREAFRVFDKDGNGVITAQEF 175

 Score = 103 (36.3 bits), Expect = 0.011, P = 0.011
 Identities = 21/73 (28%), Positives = 40/73 (54%), Frame = +3

Query:   120 ILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             ++ E D   I E    F +FD+   G I A +    M  M   F E+++ ++I++ D DG
Sbjct:   146 MMKETDSEMIREA---FRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDG 202

Query:   300 SGKLEFDEFCALV 338
              G+++++EF  ++
Sbjct:   203 DGEIDYEEFVKMM 215


>sp|P41041|CALM_PNECA CALMODULIN >pir||JN0722 calmodulin - Pneumocystis carinii
            >gi|169404 (L05572) calmodulin [Pneumocystis carinii]
            Length = 151

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 51/141 (36%), Positives = 91/141 (64%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ ++ + DADG+G ++F E
Sbjct:    11 QISEFKEAFSLFDKDGDGSITTKELGIVMRSLGQNPTEAELQDMVNEVDADGNGTIDFPE 70

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F A++      VD E   +E+REAF++FDK+GNG IS   L+ ++  + + L+DE+++  
Sbjct:    71 FLAMMARKMKDVDSE---EEIREAFKVFDKDGNGIISAAELRHVMTNLGEKLTDEEVDEM 127

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G I++ EF ++M
Sbjct:   128 IREADVDGDGVIDYSEFVKMM 148

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  V+E+D DG+G I+F EF  
Sbjct:    14 EFKEAFSLFDKDGDGSITTKELGIVMRSLGQNPTEAELQDMVNEVDADGNGTIDFPEFLA 73

Query:   561 LMA 569
             +MA
Sbjct:    74 MMA 76

 Score = 108 (38.0 bits), Expect = 0.00016, P = 0.00016
 Identities = 31/109 (28%), Positives = 56/109 (51%), Frame = +3

Query:   240 EQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFD 410
             EQ+  E+Q+   ++    FD DG G +   E    +  V  ++ +   + EL++     D
Sbjct:     4 EQNLTEEQISEFKEAFSLFDKDGDGSITTKE----LGIVMRSLGQNPTEAELQDMVNEVD 59

Query:   411 KEGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              +GNG I  P   A++ +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    60 ADGNGTIDFPEFLAMMARKMKDVDSEEEIREAFKVFDKDGNGIISAAELRHVM 112

 Score = 106 (37.3 bits), Expect = 0.00047, P = 0.00047
 Identities = 25/107 (23%), Positives = 56/107 (52%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++    N    F    A+MA  + ++ +E      EE ++ F +FD+   G
Sbjct:    48 EAELQDMVNEVDADGNGTIDFPEFLAMMARKMKDVDSE------EEIREAFKVFDKDGNG 101

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
              I A ++  +M  + +   ++++ ++IR+ D DG G +++ EF  ++
Sbjct:   102 IISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGVIDYSEFVKMM 148

 Score = 81 (28.5 bits), Expect = 1.6, P = 0.79
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQL 266
             +I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++
Sbjct:    29 SITTKELGIVMRSLGQNPTEAELQDMVNEVDADGNGTIDFPEFLAMMARKMKDVDSEEEI 88

Query:   267 RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
             R+  + FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G I
Sbjct:    89 REAFKVFDKDGNGIISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGVI 139


>sp|P02596|CALM_METSE CALMODULIN >pir||MCXAM calmodulin - sea anemone
            (Metridium senile) (tentative sequence)
            Length = 148

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 3.8e-23, P = 3.8e-23
 Identities = 50/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+G+G+IS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF ++M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVKMM 145

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 26/74 (35%), Positives = 48/74 (64%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
              G I+F EF  +MA
Sbjct:    60 DGTIDFPEFLTMMA 73

 Score = 105 (37.0 bits), Expect = 0.00043, P = 0.00043
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVKMM 145

 Score = 98 (34.5 bits), Expect = 0.0077, P = 0.0077
 Identities = 27/102 (26%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +G+G I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVM 109

 Score = 83 (29.2 bits), Expect = 0.81, P = 0.56
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGDGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>gi|20186 (X65016) calmodulin [Oryza sativa]
          Length = 149

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 100 (35.2 bits), Expect = 0.0040, P = 0.0040
 Identities = 31/109 (28%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             +Q  DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     3 DQLTDEQIAEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 58

Query:   414 EGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P  L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    59 DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|P13565|CALM_HORVU CALMODULIN >sp|P29612|CALM_ORYSA CALMODULIN >pir||MCBH
            calmodulin - barley >pir||S24952 calmodulin 1 (clone lambda DASH) -
            rice >gi|20188 (Z12827) calmodulin [Oryza sativa] >gi|167008
            (M27303) calmodulin [Hordeum vulgare] >gi|170072 (L01431)
            calmodulin [Glycine max] >gi|310315 (L18913) calmodulin [Oryza
            sativa] >gi|506850 (L20691) calmodulin [Vigna radiata] >bbs|176852
            (S81594) auxin-regulated calmodulin, arCaM [Vigna radiata=mung
            bean, Wilczek, seedling, Peptide, 149 aa] [Vigna radiata]
            >gnl|PID|e1168898 (Y09853) CaM protein [Cicer arietinum]
            >gi|1754991 (U48242) calmodulin TaCaM1-1 [Triticum aestivum]
            >gi|1754993 (U48688) calmodulin TaCaM1-2 [Triticum aestivum]
            >gi|1754995 (U48689) calmodulin TaCaM1-3 [Triticum aestivum]
            >gi|1755003 (U48693) calmodulin TaCaM3-1 [Triticum aestivum]
            >gi|1755005 (U49103) calmodulin TaCaM3-2 [Triticum aestivum]
            >gi|1755007 (U49104) calmodulin TaCaM3-3 [Triticum aestivum]
            >gi|1755009 (U49105) calmodulin TaCaM4-1 [Triticum aestivum]
            >prf||1604476A calmodulin [Hordeum vulgare var. distichum]
            >prf||2121384B calmodulin [Glycine max]
            Length = 149

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>gi|1773321 (U79736) calmodulin [Helianthus annuus]
            Length = 149

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>pir||S58311 calmodulin - Bidens pilosa >gi|939860 (X89890) Calmodulin [Bidens
            pilosa]
            Length = 149

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISARELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 108 (38.0 bits), Expect = 8.0e-05, P = 8.0e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISARELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 99 (34.8 bits), Expect = 0.0056, P = 0.0056
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISARELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISARE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>gi|166655 (M73712) calmodulin-3 [Arabidopsis thaliana]
           Length = 143

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 52/141 (36%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     3 QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 62

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE+++  
Sbjct:    63 FLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 119

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G+I +EEF ++M
Sbjct:   120 IKEADVDGDGQINYEEFVKVM 140

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     6 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 65

Query:   561 LMA 569
             LMA
Sbjct:    66 LMA 68

 Score = 106 (37.3 bits), Expect = 6.7e-05, P = 6.7e-05
 Identities = 17/64 (26%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++I++ D DG G++ 
Sbjct:    73 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQIN 132

Query:   315 FDEF 326
             ++EF
Sbjct:   133 YEEF 136

 Score = 98 (34.5 bits), Expect = 0.0052, P = 0.0051
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     6 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 61

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    62 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 104


>gi|535428 (U13736) calmodulin-like protein [Pisum sativum]
           Length = 150

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 6.2e-23, P = 6.2e-23
 Identities = 52/149 (34%), Positives = 97/149 (65%), Frame = +3

Query:   120 ILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             IL+E    QI ++++ F +FD+   G +   ++  ++ +++Q+  E++L+ +I + DADG
Sbjct:     4 ILSE---EQIVDFKEAFGLFDKDGDGCVTVEELATVIRSLDQNPTEEELQDMISEVDADG 60

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
             +G +EFDEF  L+       D E   +ELREAF++FDK+ NGYIS   L+ ++  + + L
Sbjct:    61 NGTIEFDEFLNLMARKMKDTDAE---EELREAFKVFDKDQNGYISPSELRHVMMNLGEKL 117

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             SDE+++  + E D DG G++++++F ++M
Sbjct:   118 SDEEVKQMIKEADMDGDGQVDYDDFVKMM 146

 Score = 144 (50.7 bits), Expect = 3.6e-09, P = 3.6e-09
 Identities = 27/75 (36%), Positives = 51/75 (68%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  + +EAF LFDK+G+G ++   L  +++ +  + ++E+L+  + E+D D
Sbjct:     1 MAHILSEEQIV-DFKEAFGLFDKDGDGCVTVEELATVIRSLDQNPTEEELQDMISEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G IEF+EF  LMA
Sbjct:    60 GNGTIEFDEFLNLMA 74

 Score = 122 (42.9 bits), Expect = 1.1e-06, P = 1.1e-06
 Identities = 24/110 (21%), Positives = 63/110 (57%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E++L+ + +++    N   +F     +MA  + +  AE      EE ++ F +FD+ + G
Sbjct:    46 EEELQDMISEVDADGNGTIEFDEFLNLMARKMKDTDAE------EELREAFKVFDKDQNG 99

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             YI  +++  +M  + +   +++++++I++ D DG G++++D+F  ++  +
Sbjct:   100 YISPSELRHVMMNLGEKLSDEEVKQMIKEADMDGDGQVDYDDFVKMMMAI 149

 Score = 100 (35.2 bits), Expect = 0.0043, P = 0.0043
 Identities = 32/109 (29%), Positives = 53/109 (48%), Frame = +3

Query:   240 EQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             EQ  D K+   L   FD DG G +  +E      TV  ++D+   ++EL++     D +G
Sbjct:     8 EQIVDFKEAFGL---FDKDGDGCVTVEELA----TVIRSLDQNPTEEELQDMISEVDADG 60

Query:   420 NGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             NG I     L  + +++ D  ++E+L  A    D+D +G I   E   +M
Sbjct:    61 NGTIEFDEFLNLMARKMKDTDAEEELREAFKVFDKDQNGYISPSELRHVM 110


>sp|P27165|CALM_PHYIN CALMODULIN >gi|169306 (M83535) calmodulin [Phytophthora
            infestans]
            Length = 149

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 6.2e-23, P = 6.2e-23
 Identities = 50/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+ EAF++FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEILEAFKVFDKDGNGFISAAELRHIMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADIDGDGQINYEEFVKMM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 19/68 (27%), Positives = 40/68 (58%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE  + F +FD+   G+I A ++  IM  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEILEAFKVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIREADIDGDGQIN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVKMM 146

 Score = 104 (36.6 bits), Expect = 0.00090, P = 0.00090
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEILEAFKVFDKDGNGFISAAELRHIM 110


>sp|P02599|CALM_DICDI CALMODULIN >gi|290034 (M64089) calmodulin [Dictyostelium
            discoideum]
            Length = 152

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 6.2e-23, P = 6.2e-23
 Identities = 49/141 (34%), Positives = 91/141 (64%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:    11 QIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPE 70

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAF++FDK+GNGYIS   L+ ++  + + L++E+++  
Sbjct:    71 FLTMMARKMQDTDTE---EEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEM 127

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G++ ++EF ++M
Sbjct:   128 IREADLDGDGQVNYDEFVKMM 148

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    14 EFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLT 73

Query:   561 LMA 569
             +MA
Sbjct:    74 MMA 76

 Score = 114 (40.1 bits), Expect = 8.6e-06, P = 8.6e-06
 Identities = 19/63 (30%), Positives = 40/63 (63%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE ++ F +FD+   GYI A ++  +M ++ +    +++ ++IR+ D DG G++ +DEF 
Sbjct:    86 EEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREADLDGDGQVNYDEFV 145

Query:   330 ALV 338
              ++
Sbjct:   146 KMM 148

 Score = 108 (38.0 bits), Expect = 0.00020, P = 0.00020
 Identities = 30/111 (27%), Positives = 56/111 (50%), Frame = +3

Query:   234 AMEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRL 404
             A ++   E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++    
Sbjct:     2 ASQESLTEEQIAEFKEAFSLFDKDGDGSITTKE----LGTVMRSLGQNPTEAELQDMINE 57

Query:   405 FDKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              D +GNG I  P  L  + +++ D  ++E++  A    D+DG+G I   E   +M
Sbjct:    58 VDADGNGNIDFPEFLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVM 112

 Score = 87 (30.6 bits), Expect = 0.29, P = 0.25
 Identities = 26/114 (22%), Positives = 56/114 (49%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQL 266
             +I  +++  ++  +  +  E E Q   +  D    G I   +   +M    QD D E+++
Sbjct:    29 SITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLTMMARKMQDTDTEEEI 88

Query:   267 RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             R+  + FD DG+G +   E   ++ ++   +  E + + +REA    D +G+G ++
Sbjct:    89 REAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREA----DLDGDGQVN 140


>gnl|PID|e248485 (X98404) calmodulin-2 [Capsicum annuum]
            Length = 149

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 6.2e-23, P = 6.2e-23
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLILMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I ++EF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYDEFVKVM 146

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLI 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 19/64 (29%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             +DEF
Sbjct:   139 YDEF 142

 Score = 97 (34.1 bits), Expect = 0.011, P = 0.011
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLILMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 76 (26.8 bits), Expect = 6.1, P = 1.0
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLILMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|P02595|CALM_PATSP CALMODULIN >pir||MCSW calmodulin - scallop (Patinopecten
            sp.) >prf||0711223A calmodulin [Patinopecten sp.]
            Length = 148

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 6.2e-23, P = 6.2e-23
 Identities = 50/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+G+G+IS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGQVNYEEFVTMM 145

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 26/74 (35%), Positives = 48/74 (64%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
              G I+F EF  +MA
Sbjct:    60 DGTIDFPEFLTMMA 73

 Score = 106 (37.3 bits), Expect = 0.00027, P = 0.00027
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVTMM 145

 Score = 98 (34.5 bits), Expect = 0.0077, P = 0.0077
 Identities = 27/102 (26%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +G+G I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVM 109

 Score = 83 (29.2 bits), Expect = 0.81, P = 0.56
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGDGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 137


>prf||1003191A calmodulin [Oryctolagus cuniculus]
            Length = 148

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 6.2e-23, P = 6.2e-23
 Identities = 49/146 (33%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L  +I + DA+G G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELZBMINEVDABGBGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+G+GYIS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGDGYISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E + DG G++ +EEF ++M
Sbjct:   120 EVDEMIREANIDGDGQVNYEEFVQMM 145

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 25/74 (33%), Positives = 48/74 (64%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D +G
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELZBMINEVDABG 59

Query:   528 SGKIEFEEFWELMA 569
              G I+F EF  +MA
Sbjct:    60 BGTIDFPEFLTMMA 73

 Score = 104 (36.6 bits), Expect = 0.00078, P = 0.00078
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ + DG G++ 
Sbjct:    78 DTDSEEEIREAFRVFDKDGDGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVN 137

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   138 YEEFVQMM 145

 Score = 98 (34.5 bits), Expect = 0.0077, P = 0.0077
 Identities = 27/102 (26%), Positives = 48/102 (47%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL +     D +G+G I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELZBMINEVDABGBGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFRVFDKDGDGYISAAELRHVM 109

 Score = 78 (27.5 bits), Expect = 3.4, P = 0.97
 Identities = 27/113 (23%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E +   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELZBMINEVDABGBGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG G +   E   L + + N  +K T  +E+ E  R  + +G+G ++
Sbjct:    87 EAFRVFDKDGDGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREANIDGDGQVN 137


>gi|825635 (X52606) calmodulin [Homo sapiens]
           Length = 152

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 6.2e-23, P = 6.2e-23
 Identities = 52/146 (35%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD---G 299
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD   G
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADDLPG 63

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
             +G ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L
Sbjct:    64 NGTIDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKL 120

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +DE+++  + E D DG G++ +EEF ++M
Sbjct:   121 TDEEVDEMIREADIDGDGQVNYEEFVQMM 149

 Score = 125 (44.0 bits), Expect = 5.1e-07, P = 5.1e-07
 Identities = 26/77 (33%), Positives = 50/77 (64%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 ---GSGKIEFEEFWELMA 569
                G+G I+F EF  +MA
Sbjct:    60 DLPGNGTIDFPEFLTMMA 77


>gnl|PID|e267602 (Y08373) calmodulin [Toxoplasma gondii]
            Length = 146

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 7.9e-23, P = 7.9e-23
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL EAF++FD++GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTLMARKMKDTDTE---EELIEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKMM 146

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/75 (36%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLTLMA 74

 Score = 106 (37.3 bits), Expect = 0.00013, P = 0.00013
 Identities = 18/63 (28%), Positives = 39/63 (61%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  + F +FDR   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ ++EF 
Sbjct:    84 EELIEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143

Query:   330 ALV 338
              ++
Sbjct:   144 KMM 146

 Score = 102 (35.9 bits), Expect = 0.0013, P = 0.0013
 Identities = 31/110 (28%), Positives = 53/110 (48%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P    L+ +++ D  ++E+L  A    D DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTLMARKMKDTDTEEELIEAFKVFDRDGNGFISAAELRHVM 110

 Score = 78 (27.5 bits), Expect = 3.3, P = 0.96
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L 
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTLMARKMKDTDTEEELI 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFKVFDRDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>gi|1835521 (U83402) calmodulin [Capsicum annuum]
            Length = 149

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 7.9e-23, P = 7.9e-23
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I ++EF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYDEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 19/64 (29%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             +DEF
Sbjct:   139 YDEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>gi|1754999 (U48691) calmodulin TaCaM2-2 [Triticum aestivum] >gi|1755001
            (U48692) calmodulin TaCaM2-3 [Triticum aestivum]
            Length = 149

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 7.9e-23, P = 7.9e-23
 Identities = 52/146 (35%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  V E D DG G+I ++EF ++M
Sbjct:   121 EVDEMVREADVDGDGQINYDEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 112 (39.4 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ +++R+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVDGDGQIN 138

Query:   315 FDEF 326
             +DEF
Sbjct:   139 YDEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 78 (27.5 bits), Expect = 3.5, P = 0.97
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMVREADVDGDGQIN 138


>pir||JC1094 calmodulin - rice
            Length = 148

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 7.9e-23, P = 7.9e-23
 Identities = 52/141 (36%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     9 QIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE+++  
Sbjct:    69 FLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 125

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G+I +EEF ++M
Sbjct:   126 IREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 30/105 (28%), Positives = 53/105 (50%), Frame = +3

Query:   252 DEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNG 425
             DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG
Sbjct:     7 DEQIAEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNG 62

Query:   426 YISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              I  P  L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    63 TIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.5, P = 0.92
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>pir||S53019 calmodulin - Macrocystis pyrifera >gi|728609 (X85091) calmodulin
            [Macrocystis pyrifera]
            Length = 149

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 7.9e-23, P = 7.9e-23
 Identities = 50/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+ EAF++FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEIIEAFKVFDKDGNGFISAAELRHIMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADIDGDGQINYEEFVKMM 146

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 104 (36.6 bits), Expect = 0.00090, P = 0.00090
 Identities = 19/68 (27%), Positives = 40/68 (58%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE  + F +FD+   G+I A ++  IM  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEIIEAFKVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIREADIDGDGQIN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVKMM 146

 Score = 104 (36.6 bits), Expect = 0.00090, P = 0.00090
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIIEAFKVFDKDGNGFISAAELRHIM 110


>sp|Q02052|CALM_NEUCR CALMODULIN >pir||S58709 calmodulin - Neurospora crassa
            >gi|5542 (X70923) calmodulin [Neurospora crassa] >gi|168767
            (L02964) calmodulin [Neurospora crassa] >gi|562117 (U15993)
            calmodulin [Colletotrichum trifolii]
            Length = 149

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 47/141 (33%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q+ E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD +G ++F E
Sbjct:     9 QVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAF++FD++ NG+IS   L+ ++  I + L+D++++  
Sbjct:    69 FLTMMARKMKDTDSE---EEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEM 125

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D+DG G+I++ EF +LM
Sbjct:   126 IREADQDGDGRIDYNEFVQLM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+++ +E +  E +EAF LFDK+G+G I+   L  +++ +  + S+ +L+  ++E+D D
Sbjct:     1 MADSLTEEQVS-EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
              +G I+F EF  +MA
Sbjct:    60 NNGTIDFPEFLTMMA 74

 Score = 117 (41.2 bits), Expect = 4.0e-06, P = 4.0e-06
 Identities = 26/107 (24%), Positives = 58/107 (54%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++   +N    F     +MA  + +  +E      EE ++ F +FDR   G
Sbjct:    46 ESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSE------EEIREAFKVFDRDNNG 99

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
             +I A ++  +M ++ +   + ++ ++IR+ D DG G+++++EF  L+
Sbjct:   100 FISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQLM 146

 Score = 94 (33.1 bits), Expect = 0.030, P = 0.029
 Identities = 26/102 (25%), Positives = 48/102 (47%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G++   E    + TV  ++ +   + EL++     D + NG I  P
Sbjct:    12 EFKEAFSLFDKDGDGQITTKE----LGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D D +G I   E   +M
Sbjct:    68 EFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVM 110

 Score = 76 (26.8 bits), Expect = 6.1, P = 1.0
 Identities = 24/112 (21%), Positives = 54/112 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
             +  + FD D +G +   E   ++ ++   +  + + + +REA    D++G+G I
Sbjct:    88 EAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREA----DQDGDGRI 137


>pir||S51933 calmodulin cam2 - maize >gi|747917 (X77397) calmodulin [Zea mays]
            Length = 149

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I ++EF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYDEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 19/64 (29%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             +DEF
Sbjct:   139 YDEF 142

 Score = 100 (35.2 bits), Expect = 0.0040, P = 0.0040
 Identities = 31/109 (28%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             +Q  DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     3 DQLTDEQIAEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 58

Query:   414 EGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P  L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    59 DGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>pir||S22860 calmodulin 2 (clone lambda DASH) - rice >gi|20190 (Z12828)
            calmodulin [Oryza sativa] >gi|310313 (L18914) calmodulin [Oryza
            sativa]
            Length = 149

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I ++EF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYDEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 19/64 (29%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             +DEF
Sbjct:   139 YDEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>pir||S60237 calmodulin (clone PCM5) - potato >gi|677903 (U20295) calmodulin
            [Solanum tuberosum] >gi|687704 (U20294) calmodulin [Solanum
            tuberosum] >gi|687706 (U20296) calmodulin [Solanum tuberosum]
            >gi|687708 (U20297) calmodulin [Solanum tuberosum]
            Length = 149

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 51/146 (34%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I ++EF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYDEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 19/64 (29%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             +DEF
Sbjct:   139 YDEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>pdb|1AHR|  Calmodulin Mutant With A Two Residue Deletion In The Central Helix
            Calmodulin, Calcium-Binding Protein Mol_id: 1; Molecule:
            Calmodulin; Chain: Null; Engineered: Yes; Mutation: Del(T79),
            Del(D80)
            Length = 146

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 51/146 (34%), Positives = 96/146 (65%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++   A  + K++ ++E+REAFR+FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLTMM---ARKM-KDS-EEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 117

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   118 EVDEMIREADIDGDGQVNYEEFVTMM 143

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 26/74 (35%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  +MA
Sbjct:    60 NGTIDFPEFLTMMA 73

 Score = 105 (37.0 bits), Expect = 0.00026, P = 0.00026
 Identities = 17/63 (26%), Positives = 40/63 (63%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ ++EF 
Sbjct:    81 EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFV 140

Query:   330 ALV 338
              ++
Sbjct:   141 TMM 143

 Score = 99 (34.8 bits), Expect = 0.0044, P = 0.0044
 Identities = 27/102 (26%), Positives = 47/102 (46%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 TLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 ++     D S+E++  A    D+DG+G I   E   +M
Sbjct:    67 EFLTMMARKMKD-SEEEIREAFRVFDKDGNGFISAAELRHVM 107

 Score = 80 (28.2 bits), Expect = 1.8, P = 0.84
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D  E+++R+
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKD-SEEEIRE 85

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
               R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    86 AFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 135


>gi|289525 (L14071) calmodulin [Bryonia dioica]
           Length = 149

  Plus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.3e-22, P = 1.3e-22
 Identities = 51/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+  +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQTNYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 106 (37.3 bits), Expect = 0.00034, P = 0.00034
 Identities = 18/64 (28%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G+  
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQTN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 75 (26.4 bits), Expect = 8.2, P = 1.0
 Identities = 28/110 (25%), Positives = 52/110 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNG 425
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDG 135


>bbs|150395 calmodulin {D to N substitution at residue 50, G to E substitution
            at residue 40} [Paramecium tetraurelia, stocks 51s and nd-6,
            Peptide Mutant, 148 aa]
            Length = 148

  Plus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.3e-22, P = 1.3e-22
 Identities = 50/146 (34%), Positives = 94/146 (64%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++EQ+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLEQNPTEAELQNMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF +L+   A  + ++  ++EL EAF++FD++GNG IS   L+ ++  + + L+D+
Sbjct:    63 IDFPEFLSLM---ARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDD 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G I +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGHINYEEFVRMM 145

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    11 EFKEAFALFDKDGDGTITTKELGTVMRSLEQNPTEAELQNMINEVDADGNGTIDFPEFLS 70

Query:   561 LMA 569
             LMA
Sbjct:    71 LMA 73

 Score = 105 (37.0 bits), Expect = 0.00043, P = 0.00043
 Identities = 31/109 (28%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             EQ  +E+  + ++    FD DG G +   E    + TV  ++++   + EL+      D 
Sbjct:     2 EQLTEEQIAEFKEAFALFDKDGDGTITTKE----LGTVMRSLEQNPTEAELQNMINEVDA 57

Query:   414 EGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P   +L+ +++ +  S+E+L  A    D DG+G I   E   +M
Sbjct:    58 DGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVM 109

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 26/107 (24%), Positives = 53/107 (49%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++    N    F    ++MA  + E  +E      EE  + F +FDR   G
Sbjct:    45 EAELQNMINEVDADGNGTIDFPEFLSLMARKMKEQDSE------EELIEAFKVFDRDGNG 98

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
              I A ++  +M  + +   + ++ ++IR+ D DG G + ++EF  ++
Sbjct:    99 LISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMM 145

 Score = 83 (29.2 bits), Expect = 0.81, P = 0.56
 Identities = 28/113 (24%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  ++ +  E E Q   +  D    G I   +   +M   M++   E++L 
Sbjct:    27 ITTKELGTVMRSLEQNPTEAELQNMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELI 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T   E+ E  R  D +G+G+I+
Sbjct:    87 EAFKVFDRDGNGLISAAE---LRHVMTNLGEKLT-DDEVDEMIREADIDGDGHIN 137


>sp|P05932|CALL_ARBPU CALMODULIN BETA >pir||S02691 calmodulin B - sea urchin
            (Arbacia punctulata) (fragment)
            Length = 138

  Plus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.3e-22, P = 1.3e-22
 Identities = 49/138 (35%), Positives = 88/138 (63%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  
Sbjct:     1 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 60

Query:   333 LVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++  + + L+DE+++  + E
Sbjct:    61 MMARKMKETDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 117

Query:   513 IDEDGSGKIEFEEFWELM 566
              D DG G++ +EEF  +M
Sbjct:   118 ADIDGDGQVNYEEFVAMM 135

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     1 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 60

Query:   561 LMA 569
             +MA
Sbjct:    61 MMA 63

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 26/107 (24%), Positives = 57/107 (53%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++    N    F     +MA  + E  +E      EE ++ F +FD+   G
Sbjct:    35 EAELQDMINEVDADGNGTIDFPEFLTMMARKMKETDSE------EEIREAFRVFDKDGNG 88

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
             +I A ++  +M  + +   ++++ ++IR+ D DG G++ ++EF A++
Sbjct:    89 FISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVAMM 135

 Score = 100 (35.2 bits), Expect = 0.00062, P = 0.00062
 Identities = 27/102 (26%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     1 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 56

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ +  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 EFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVM 99

 Score = 84 (29.6 bits), Expect = 0.43, P = 0.35
 Identities = 29/121 (23%), Positives = 58/121 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M   M++   E+++R
Sbjct:    17 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKETDSEEEIR 76

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLK 449
             +  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G ++     
Sbjct:    77 EAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVNYEEFV 132

Query:   450 ALL 458
             A++
Sbjct:   133 AMM 135


>gi|1235664 (U37936) novel calmodulin-like protein [Oryza sativa]
            Length = 187

  Plus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 1.6e-22, P = 1.6e-22
 Identities = 53/146 (36%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD +G 
Sbjct:     4 QLSEEQIVEFREAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDADSNGN 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             +EF EF  L+       DK++ ++EL+EAFR+FDK+ NG+IS   L+ ++  I + L+DE
Sbjct:    64 IEFKEFLGLM--ARKLRDKDS-EEELKEAFRVFDKDQNGFISAAELRHVMANIGERLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++   + E D DG G+I +EEF + M
Sbjct:   121 EVGEMISEADVDGDGQINYEEFVKCM 146

 Score = 141 (49.6 bits), Expect = 7.8e-09, P = 7.8e-09
 Identities = 28/75 (37%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E REAF LFDK+G+G I+   L  +++ +  + ++ +L+  + E+D D
Sbjct:     1 MADQLSEEQIV-EFREAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
              +G IEF+EF  LMA
Sbjct:    60 SNGNIEFKEFLGLMA 74

 Score = 104 (36.6 bits), Expect = 0.0052, P = 0.0051
 Identities = 23/103 (22%), Positives = 57/103 (55%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ + +++    N   +F+    +MA  + +  +E      EE ++ F +FD+ + G
Sbjct:    46 EAELQDMISEVDADSNGNIEFKEFLGLMARKLRDKDSE------EELKEAFRVFDKDQNG 99

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             +I A ++  +M  + +   ++++ ++I + D DG G++ ++EF
Sbjct:   100 FISAAELRHVMANIGERLTDEEVGEMISEADVDGDGQINYEEF 142

 Score = 98 (34.5 bits), Expect = 0.028, P = 0.027
 Identities = 31/111 (27%), Positives = 54/111 (48%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   R+    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLSEEQIVEFREAFSLFDKDGDGSITTKE----LGTVMRSLGQNPTEAELQDMISEV 56

Query:   408 DKEGNGYIS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
             D + NG I  +  L  + +++ D  S+E+L+ A    D+D +G I   E   +MA
Sbjct:    57 DADSNGNIEFKEFLGLMARKLRDKDSEEELKEAFRVFDKDQNGFISAAELRHVMA 111


>gnl|PID|d1014428 (D88977) troponin C [Branchiostoma floridae]
            Length = 164

  Plus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.1e-22, P = 2.1e-22
 Identities = 54/157 (34%), Positives = 90/157 (57%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M++D  +        QI E++  FDMFD    G I   ++G IM  +      ++L+++I
Sbjct:     1 MSDDYVKARVMFKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMI 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++F+EF  ++       ++E    ELR AFR+ DK G+G+I +   +AL 
Sbjct:    61 EEVDEDGSGTIDFEEFLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALA 120

Query:   459 KEIA-DDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              E A DDL+D++L   +DE D +  G+ ++EE+ EL+
Sbjct:   121 SECAGDDLTDDELHEFMDEYDGNRDGRFDYEEWKELI 157

 Score = 212 (74.6 bits), Expect = 1.1e-16, P = 1.1e-16
 Identities = 50/154 (32%), Positives = 82/154 (53%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M++D  +        QI E++  FDMFD    G I   ++G IM  +      ++L+++I
Sbjct:     1 MSDDYVKARVMFKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMI 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++F+EF  ++       ++E    ELR AFR+ DK G+G+I +   +AL 
Sbjct:    61 EEVDEDGSGTIDFEEFLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALA 120

Query:   459 KEIADDLSDEQLEAAVDEIDE-DGSGKIEFE-EFWE 560
              E A D  D   +   + +DE DG+    F+ E W+
Sbjct:   121 SECAGD--DLTDDELHEFMDEYDGNRDGRFDYEEWK 154

 Score = 167 (58.8 bits), Expect = 7.0e-12, P = 7.0e-12
 Identities = 33/77 (42%), Positives = 49/77 (63%), Frame = +3

Query:   339 YTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEID 518
             Y  A  + KE    E + AF +FD++G G IS   L  ++K +   +S E+L+  ++E+D
Sbjct:     5 YVKARVMFKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMIEEVD 64

Query:   519 EDGSGKIEFEEFWELMA 569
             EDGSG I+FEEF E+MA
Sbjct:    65 EDGSGTIDFEEFLEMMA 81

 Score = 110 (38.7 bits), Expect = 0.00034, P = 0.00034
 Identities = 34/125 (27%), Positives = 64/125 (51%), Frame = +3

Query:   249 FDEKQLRKL---IRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             F E+Q+ +       FD DG G +   E   ++  +  ++ +E LQ+ + E     D++G
Sbjct:    12 FKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMIEEV----DEDG 67

Query:   420 NGYIS-RPTLKALLKEIAD---DLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*T 587
             +G I     L+ + + + D   ++ D++L AA   +D++G G I+ +EF  L +  A   
Sbjct:    68 SGTIDFEEFLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALASECAGDD 127

Query:   588 ITVDNF*PF 614
             +T D    F
Sbjct:   128 LTDDELHEF 136


>gi|1421816 (U62865) calmodulin-like protein [Dunaliella salina]
            Length = 164

  Plus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.1e-22, P = 2.1e-22
 Identities = 49/146 (33%), Positives = 92/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M +++Q+  E +L+  I + DADG+G 
Sbjct:    16 QLTEDQIAEFKEAFALFDKDGDGTITTKELGTVMRSLDQNPTEAELQDTINEVDADGNGT 75

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D+E   +ELREAF++FD++GNG+IS   L+ ++  + + LS++
Sbjct:    76 IDFPEFLMLMARKMKETDQE---EELREAFKVFDRDGNGFISAAELRHVMTNLGEKLSEQ 132

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++E  + E D D  G++ ++EF  +M
Sbjct:   133 EVEEMIREADVDNDGQVNYDEFVNMM 158

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    24 EFKEAFALFDKDGDGTITTKELGTVMRSLDQNPTEAELQDTINEVDADGNGTIDFPEFLM 83

Query:   561 LMA 569
             LMA
Sbjct:    84 LMA 86

 Score = 114 (40.1 bits), Expect = 7.8e-05, P = 7.8e-05
 Identities = 20/61 (32%), Positives = 38/61 (62%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q EE ++ F +FDR   G+I A ++  +M  + +   E+++ ++IR+ D D  G++ +DE
Sbjct:    94 QEEELREAFKVFDRDGNGFISAAELRHVMTNLGEKLSEQEVEEMIREADVDNDGQVNYDE 153

Query:   324 F 326
             F
Sbjct:   154 F 154

 Score = 106 (37.3 bits), Expect = 0.0013, P = 0.0013
 Identities = 28/102 (27%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++D+   + EL++     D +GNG I  P
Sbjct:    24 EFKEAFALFDKDGDGTITTKE----LGTVMRSLDQNPTEAELQDTINEVDADGNGTIDFP 79

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ +   +E+L  A    D DG+G I   E   +M
Sbjct:    80 EFLMLMARKMKETDQEEELREAFKVFDRDGNGFISAAELRHVM 122

 Score = 83 (29.2 bits), Expect = 1.2, P = 0.69
 Identities = 27/113 (23%), Positives = 56/113 (49%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  +D +  E E Q   +  D    G I   +   +M   M++   E++LR
Sbjct:    40 ITTKELGTVMRSLDQNPTEAELQDTINEVDADGNGTIDFPEFLMLMARKMKETDQEEELR 99

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K + ++E+ E  R  D + +G ++
Sbjct:   100 EAFKVFDRDGNGFISAAE---LRHVMTNLGEKLS-EQEVEEMIREADVDNDGQVN 150


>gi|168777 (L02963) calmodulin [Neurospora crassa]
           Length = 149

  Plus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.1e-22, P = 2.1e-22
 Identities = 47/141 (33%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q+ E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD +G ++F E
Sbjct:     9 QVSEFKEAFSLFDKDGDGQITTKELGTVMLSLGQNPSESELQDMINEVDADNNGTIDFPE 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAF++FD++ NG+IS   L+ ++  I + L+D++++  
Sbjct:    69 FLTMMARKMKDTDSE---EEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEM 125

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D+DG G+I++ EF +LM
Sbjct:   126 IREADQDGDGRIDYNEFVQLM 146

 Score = 135 (47.5 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 26/75 (34%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+++ +E +  E +EAF LFDK+G+G I+   L  ++  +  + S+ +L+  ++E+D D
Sbjct:     1 MADSLTEEQVS-EFKEAFSLFDKDGDGQITTKELGTVMLSLGQNPSESELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
              +G I+F EF  +MA
Sbjct:    60 NNGTIDFPEFLTMMA 74

 Score = 117 (41.2 bits), Expect = 4.0e-06, P = 4.0e-06
 Identities = 26/107 (24%), Positives = 58/107 (54%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++   +N    F     +MA  + +  +E      EE ++ F +FDR   G
Sbjct:    46 ESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSE------EEIREAFKVFDRDNNG 99

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
             +I A ++  +M ++ +   + ++ ++IR+ D DG G+++++EF  L+
Sbjct:   100 FISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQLM 146

 Score = 91 (32.0 bits), Expect = 0.076, P = 0.073
 Identities = 25/102 (24%), Positives = 46/102 (45%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G++   E   ++ ++     +  LQ  + E     D + NG I  P
Sbjct:    12 EFKEAFSLFDKDGDGQITTKELGTVMLSLGQNPSESELQDMINEV----DADNNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D D +G I   E   +M
Sbjct:    68 EFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVM 110

 Score = 76 (26.8 bits), Expect = 6.1, P = 1.0
 Identities = 24/112 (21%), Positives = 54/112 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    28 ITTKELGTVMLSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
             +  + FD D +G +   E   ++ ++   +  + + + +REA    D++G+G I
Sbjct:    88 EAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREA----DQDGDGRI 137


>sp|P41040|CALM_MAIZE CALMODULIN >pir||S40086 calmodulin - maize >pir||S58924
            calmodulin calm1 - maize >gi|435543 (X74490) Calmodulin [Zea mays]
            Length = 149

  Plus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.1e-22, P = 2.1e-22
 Identities = 51/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F E   L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPELLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 133 (46.8 bits), Expect = 6.4e-08, P = 6.4e-08
 Identities = 24/63 (38%), Positives = 42/63 (66%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F E   
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPELLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 102 (35.9 bits), Expect = 0.0019, P = 0.0019
 Identities = 32/109 (29%), Positives = 56/109 (51%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             +Q  DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     3 DQLTDEQIAEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 58

Query:   414 EGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P L  L+ +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    59 DGNGTIDFPELLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 81 (28.5 bits), Expect = 1.5, P = 0.78
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   ++  +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPELLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|P27482|CALL_HUMAN CALMODULIN-RELATED PROTEIN NB-1 (CALMODULIN-LIKE PROTEIN)
            (CLP) >pir||MCHUNB calmodulin-related protein NB-1 - human
            >gi|29650 (X13461) hGH6 calmodulin-like protein [Homo sapiens]
            >gi|189081 (M58026) NB-1 [Homo sapiens]
            Length = 149

  Plus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.1e-22, P = 2.1e-22
 Identities = 47/142 (33%), Positives = 88/142 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   Q+ E+++ F +FD+   G I   ++G +M ++ Q+  E +LR ++ + D DG+G 
Sbjct:     4 QLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNG++S   L+ ++  + + LSDE
Sbjct:    64 VDFPEFLGMMARKMKDTDNE---EEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEF 554
             +++  +   D DG G++ +EEF
Sbjct:   121 EVDEMIRAADTDGDGQVNYEEF 142

 Score = 131 (46.1 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 26/75 (34%), Positives = 48/75 (64%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L   + EID D
Sbjct:     1 MADQLTEEQVT-EFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G ++F EF  +MA
Sbjct:    60 GNGTVDFPEFLGMMA 74

 Score = 104 (36.6 bits), Expect = 0.00090, P = 0.00090
 Identities = 17/64 (26%), Positives = 38/64 (59%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G++ A ++  +M  + +   ++++ ++IR  D DG G++ 
Sbjct:    79 DTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 102 (35.9 bits), Expect = 0.0019, P = 0.0019
 Identities = 25/102 (24%), Positives = 51/102 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + ELR+     D++GNG +  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTRE----LGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFP 67

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 ++ +++ D  ++E++  A    D+DG+G +   E   +M
Sbjct:    68 EFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVM 110

 Score = 82 (28.9 bits), Expect = 1.1, P = 0.67
 Identities = 25/113 (22%), Positives = 53/113 (46%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQ-IGQIMHAMEQDFDEKQLR 269
             I   ++  ++  +  +  E E +      DR   G +   + +G +   M+   +E+++R
Sbjct:    28 ITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIR 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G   F     L + +    +K +  +E+ E  R  D +G+G ++
Sbjct:    88 EAFRVFDKDGNG---FVSAAELRHVMTRLGEKLS-DEEVDEMIRAADTDGDGQVN 138


>sp|P04464|CALM_WHEAT CALMODULIN >pir||MCWT calmodulin - wheat >prf||1109190A
            calmodulin [Triticum aestivum]
            Length = 149

  Plus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 3.4e-22, P = 3.4e-22
 Identities = 51/144 (35%), Positives = 90/144 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D   I E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++
Sbjct:     6 DEQNIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65

Query:   315 FDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQL 494
             F EF  L+       D E   +EL+EAFR+FDK+ +G+IS   L+ ++  + + L+DE++
Sbjct:    66 FPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQDGFISAAELRHVMTNLGEKLTDEEV 122

Query:   495 EAAVDEIDEDGSGKIEFEEFWELM 566
             +  + E D DG G+I +EEF ++M
Sbjct:   123 DEMIREADVDGDGQINYEEFVKVM 146

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 26/70 (37%), Positives = 47/70 (67%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             D++ +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I
Sbjct:     6 DEQNIA-EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI 64

Query:   540 EFEEFWELMA 569
             +F EF  LMA
Sbjct:    65 DFPEFLNLMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQDGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 31/109 (28%), Positives = 52/109 (47%), Frame = +3

Query:   240 EQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             EQ+  E   ++    FD DG G +   E    + TV  ++ +   + EL++     D +G
Sbjct:     7 EQNIAE--FKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADG 60

Query:   420 NGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             NG I  P  L  + +++ D  S+E+L+ A    D+D  G I   E   +M
Sbjct:    61 NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQDGFISAAELRHVM 110

 Score = 78 (27.5 bits), Expect = 3.5, P = 0.97
 Identities = 29/113 (25%), Positives = 53/113 (46%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D  G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQDGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>pir||S51932 calmodulin cam1 - maize >gi|747915 (X77396) calmodulin [Zea mays]
            Length = 149

  Plus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 3.4e-22, P = 3.4e-22
 Identities = 50/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   Q  E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQTAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   ++ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAADVRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 108 (38.0 bits), Expect = 8.0e-05, P = 8.0e-05
 Identities = 18/64 (28%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A  +  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAADVRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 95 (33.4 bits), Expect = 0.022, P = 0.022
 Identities = 28/107 (26%), Positives = 51/107 (47%), Frame = +3

Query:   246 DFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNG 425
             D    + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG
Sbjct:     7 DDQTAEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNG 62

Query:   426 YISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              I  P  L  + +++ D  S+E+L+ A    D+D +G I   +   +M
Sbjct:    63 TIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAADVRHVM 110

 Score = 75 (26.4 bits), Expect = 8.2, P = 1.0
 Identities = 28/113 (24%), Positives = 53/113 (46%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G   F     + + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNG---FISAADVRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>sp|P53440|CALF_NAEGR CALMODULIN, FLAGELLAR (CAM-1) >gi|458232 (U04381)
            flagellar calmodulin [Naegleria gruberi]
            Length = 155

  Plus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 3.4e-22, P = 3.4e-22
 Identities = 49/146 (33%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   QI E+++ F +FD+   G I  +++G +M ++ Q+  E +L  +I + DADG+G 
Sbjct:    10 ELTEEQIAEFKEAFSLFDKDGDGTITTSELGTVMRSLGQNPTEAELHDMINEVDADGNGT 69

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E++EAF++FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    70 IDFTEFLTMMAKKMKDTDNE---EEIKEAFKVFDKDGNGFISAQELRHVMCNLGEKLTDE 126

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG  +I + EF ++M
Sbjct:   127 EVDEMIREADIDGDNQINYTEFVKMM 152

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 26/73 (35%), Positives = 47/73 (64%), Frame = +3

Query:   351 NTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGS 530
             N + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L   ++E+D DG+
Sbjct:     9 NELTEEQIA-EFKEAFSLFDKDGDGTITTSELGTVMRSLGQNPTEAELHDMINEVDADGN 67

Query:   531 GKIEFEEFWELMA 569
             G I+F EF  +MA
Sbjct:    68 GTIDFTEFLTMMA 80

 Score = 102 (35.9 bits), Expect = 0.0030, P = 0.0030
 Identities = 27/102 (26%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-R 437
             + ++    FD DG G +   E    + TV  ++ +   + EL +     D +GNG I   
Sbjct:    18 EFKEAFSLFDKDGDGTITTSE----LGTVMRSLGQNPTEAELHDMINEVDADGNGTIDFT 73

Query:   438 PTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + K++ D  ++E+++ A    D+DG+G I  +E   +M
Sbjct:    74 EFLTMMAKKMKDTDNEEEIKEAFKVFDKDGNGFISAQELRHVM 116

 Score = 96 (33.8 bits), Expect = 0.020, P = 0.020
 Identities = 17/68 (25%), Positives = 39/68 (57%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG  ++ 
Sbjct:    85 DTDNEEEIKEAFKVFDKDGNGFISAQELRHVMCNLGEKLTDEEVDEMIREADIDGDNQIN 144

Query:   315 FDEFCALV 338
             + EF  ++
Sbjct:   145 YTEFVKMM 152

 Score = 75 (26.4 bits), Expect = 9.3, P = 1.0
 Identities = 27/113 (23%), Positives = 53/113 (46%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I   ++  ++  +  +  E E     +  D    G I  T+   +M    +D D E++++
Sbjct:    34 ITTSELGTVMRSLGQNPTEAELHDMINEVDADGNGTIDFTEFLTMMAKKMKDTDNEEEIK 93

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+  I+
Sbjct:    94 EAFKVFDKDGNGFISAQE---LRHVMCNLGEKLT-DEEVDEMIREADIDGDNQIN 144


>gi|587454 (X80231) calmodulin [Sauroleishmania tarentolae]
           Length = 140

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 49/140 (35%), Positives = 89/140 (63%), Frame = +3

Query:   147 IEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             I E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + D DGSG ++F EF
Sbjct:     1 ISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEF 60

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAV 506
               L+       D E   +E++EAFR+FDK+GNG+IS   ++ ++ ++ +  +DE+++  +
Sbjct:    61 LTLMARKMQDSDSE---EEIKEAFRVFDKDGNGFISAAEVRHVMTKLGEKRTDEEVDEMI 117

Query:   507 DEIDEDGSGKIEFEEFWELM 566
              E D DG G+I +EEF ++M
Sbjct:   118 READVDGDGQINYEEFVKMM 137

 Score = 144 (50.7 bits), Expect = 3.6e-09, P = 3.6e-09
 Identities = 26/63 (41%), Positives = 44/63 (69%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D+DGSG I+F EF  
Sbjct:     3 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLT 62

Query:   561 LMA 569
             LMA
Sbjct:    63 LMA 65

 Score = 108 (38.0 bits), Expect = 4.0e-05, P = 4.0e-05
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    70 DSDSEEEIKEAFRVFDKDGNGFISAAEVRHVMTKLGEKRTDEEVDEMIREADVDGDGQIN 129

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   130 YEEFVKMM 137

 Score = 103 (36.3 bits), Expect = 0.00014, P = 0.00014
 Identities = 27/102 (26%), Positives = 52/102 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D++G+G I  P
Sbjct:     3 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFP 58

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ D  S+E+++ A    D+DG+G I   E   +M
Sbjct:    59 EFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAEVRHVM 101

 Score = 84 (29.6 bits), Expect = 0.47, P = 0.37
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D+   G I   +   +M    QD D E++++
Sbjct:    19 ITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIK 78

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E    V  V   + ++   +E+ E  R  D +G+G I+
Sbjct:    79 EAFRVFDKDGNGFISAAE----VRHVMTKLGEKRTDEEVDEMIREADVDGDGQIN 129


>sp|P27166|CALM_STYLE CALMODULIN >pir||JC1309 calmodulin - Stylonychia lemnae
            (SGC5) >gi|161195 (M76407) Calmodulin [Stylonychia lemnae]
            Length = 149

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 51/141 (36%), Positives = 88/141 (62%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     9 QIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F +L+       D E   +EL EAF++FD++GNG IS   L+ ++  + + L+DE+++  
Sbjct:    69 FLSLMARKMKDTDTE---EELVEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDEEVDEM 125

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G I +EEF  +M
Sbjct:   126 IREADVDGDGHINYEEFVRMM 146

 Score = 142 (50.0 bits), Expect = 6.0e-09, P = 6.0e-09
 Identities = 27/75 (36%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADNLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLSLMA 74

 Score = 106 (37.3 bits), Expect = 0.00034, P = 0.00034
 Identities = 31/110 (28%), Positives = 55/110 (50%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M  +  E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADNLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P   +L+ +++ D  ++E+L  A    D DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLSLMARKMKDTDTEEELVEAFKVFDRDGNGLISAAELRHVM 110

 Score = 101 (35.6 bits), Expect = 0.0029, P = 0.0029
 Identities = 18/63 (28%), Positives = 37/63 (58%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  + F +FDR   G I A ++  +M  + +   ++++ ++IR+ D DG G + ++EF 
Sbjct:    84 EELVEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGHINYEEFV 143

Query:   330 ALV 338
              ++
Sbjct:   144 RMM 146

 Score = 83 (29.2 bits), Expect = 0.83, P = 0.57
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L 
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKDTDTEEELV 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G+I+
Sbjct:    88 EAFKVFDRDGNGLISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGHIN 138


>sp|P24044|CALM_PLAFA CALMODULIN >pir||MCZQF calmodulin - Plasmodium falciparum
            >gi|160128 (M59770) calmodulin [Plasmodium falciparum] >gi|385234
            (M99442) calmodulin [Plasmodium falciparum]
            Length = 149

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 50/141 (35%), Positives = 89/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + D DG+G ++F E
Sbjct:     9 QISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFPE 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+       D E   +EL EAFR+FD++G+GYIS   L+ ++  + + L++E+++  
Sbjct:    69 FLTLMARKLKDTDTE---EELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEM 125

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G+I +EEF ++M
Sbjct:   126 IREADIDGDGQINYEEFVKMM 146

 Score = 142 (50.0 bits), Expect = 6.0e-09, P = 6.0e-09
 Identities = 28/75 (37%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++EID D
Sbjct:     1 MADKLTEEQIS-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEIDTD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLTLMA 74

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 19/63 (30%), Positives = 38/63 (60%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  + F +FDR   GYI A ++  +M  + +    +++ ++IR+ D DG G++ ++EF 
Sbjct:    84 EELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEMIREADIDGDGQINYEEFV 143

Query:   330 ALV 338
              ++
Sbjct:   144 KMM 146

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 28/102 (27%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFP 67

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ D  ++E+L  A    D DG G I  +E   +M
Sbjct:    68 EFLTLMARKLKDTDTEEELIEAFRVFDRDGDGYISADELRHVM 110

 Score = 88 (31.0 bits), Expect = 0.19, P = 0.17
 Identities = 31/113 (27%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L 
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFPEFLTLMARKLKDTDTEEELI 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG G +  DE   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDRDGDGYISADE---LRHVMTNLGEKLT-NEEVDEMIREADIDGDGQIN 138


>pir||MCTE calmodulin - Tetrahymena pyriformis (SGC5) >gnl|PID|d1001864
           (D10521) calmodulin [Tetrahymena pyriformis]
           Length = 149

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 51/146 (34%), Positives = 90/146 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF +L+       D E   +EL EAF++FD++GNG IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLSLMARKMKDTDTE---EELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G I +EEF  +M
Sbjct:   121 EVDEMIREADIDGDGHINYEEFVRMM 146

 Score = 141 (49.6 bits), Expect = 7.8e-09, P = 7.8e-09
 Identities = 27/75 (36%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLSLMA 74

 Score = 104 (36.6 bits), Expect = 0.00090, P = 0.00090
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P   +L+ +++ D  ++E+L  A    D DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLSLMARKMKDTDTEEELIEAFKVFDRDGNGLISAAELRHVM 110

 Score = 99 (34.8 bits), Expect = 0.0056, P = 0.0056
 Identities = 18/63 (28%), Positives = 37/63 (58%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  + F +FDR   G I A ++  +M  + +   ++++ ++IR+ D DG G + ++EF 
Sbjct:    84 EELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGHINYEEFV 143

Query:   330 ALV 338
              ++
Sbjct:   144 RMM 146

 Score = 82 (28.9 bits), Expect = 1.1, P = 0.67
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L 
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKDTDTEEELI 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G+I+
Sbjct:    88 EAFKVFDRDGNGLISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGHIN 138


>sp|P02598|CALM_TETPY CALMODULIN
            Length = 148

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 51/146 (34%), Positives = 90/146 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF +L+       D E   +EL EAF++FD++GNG IS   L+ ++  + + L+DE
Sbjct:    63 IDFPEFLSLMARKMKDTDTE---EELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDE 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G I +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGHINYEEFVRMM 145

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/74 (36%), Positives = 49/74 (66%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG
Sbjct:     1 ADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 59

Query:   528 SGKIEFEEFWELMA 569
             +G I+F EF  LMA
Sbjct:    60 NGTIDFPEFLSLMA 73

 Score = 103 (36.3 bits), Expect = 0.0012, P = 0.0012
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    11 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 66

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                +L+ +++ D  ++E+L  A    D DG+G I   E   +M
Sbjct:    67 EFLSLMARKMKDTDTEEELIEAFKVFDRDGNGLISAAELRHVM 109

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 18/63 (28%), Positives = 37/63 (58%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  + F +FDR   G I A ++  +M  + +   ++++ ++IR+ D DG G + ++EF 
Sbjct:    83 EELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGHINYEEFV 142

Query:   330 ALV 338
              ++
Sbjct:   143 RMM 145

 Score = 82 (28.9 bits), Expect = 1.1, P = 0.66
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L 
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKDTDTEEELI 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G+I+
Sbjct:    87 EAFKVFDRDGNGLISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGHIN 137


>gnl|PID|e238630 (X97558) calmodulin-1 [Capsicum annuum]
            Length = 150

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 51/146 (34%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 Q-LEAAVDEIDEDGSGKIEFEEFWELM 566
             + ++  + E D DG G+I+++EF ++M
Sbjct:   121 EEVDEMIREADVDGDGQIQYDEFVKVM 147

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 117 (41.2 bits), Expect = 4.0e-06, P = 4.0e-06
 Identities = 22/65 (33%), Positives = 43/65 (66%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAM-EQDFDEKQLRKLIRKFDADGSGKL 311
             D    EE ++ F +FD+ + G+I A ++  +M  + E+  DE+++ ++IR+ D DG G++
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEEVDEMIREADVDGDGQI 138

Query:   312 EFDEF 326
             ++DEF
Sbjct:   139 QYDEF 143

 Score = 98 (34.5 bits), Expect = 0.0088, P = 0.0087
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 85 (29.9 bits), Expect = 0.47, P = 0.38
 Identities = 29/112 (25%), Positives = 54/112 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
             +  R FD D +G +   E   L + + N  +K T ++E+ E  R  D +G+G I
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLTDEEEVDEMIREADVDGDGQI 138


>pdb|1CLM|  Calmodulin (Paramecium Tetraurelia) (Wild Type)
            Length = 148

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 50/146 (34%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 ELTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF +L+   A  + ++  ++EL EAF++FD++GNG IS   L+ ++  + + L+D+
Sbjct:    63 IDFPEFLSLM---ARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDD 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G I +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGHINYEEFVRMM 145

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    11 EFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLS 70

Query:   561 LMA 569
             LMA
Sbjct:    71 LMA 73

 Score = 107 (37.7 bits), Expect = 0.00010, P = 0.00010
 Identities = 31/108 (28%), Positives = 55/108 (50%), Frame = +3

Query:   243 QDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             Q+  E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     2 QELTEEQIAEFKEAFALFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 57

Query:   414 EGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P   +L+ +++ +  S+E+L  A    D DG+G I   E   +M
Sbjct:    58 DGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVM 109

 Score = 98 (34.5 bits), Expect = 0.0077, P = 0.0077
 Identities = 26/107 (24%), Positives = 53/107 (49%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++    N    F    ++MA  + E  +E      EE  + F +FDR   G
Sbjct:    45 EAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSE------EELIEAFKVFDRDGNG 98

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
              I A ++  +M  + +   + ++ ++IR+ D DG G + ++EF  ++
Sbjct:    99 LISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMM 145

 Score = 79 (27.8 bits), Expect = 2.5, P = 0.92
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M   M++   E++L 
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELI 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T   E+ E  R  D +G+G+I+
Sbjct:    87 EAFKVFDRDGNGLISAAE---LRHVMTNLGEKLT-DDEVDEMIREADIDGDGHIN 137


>gi|16225 (Z12023) calmodulin [Arabidopsis thaliana]
          Length = 138

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 50/138 (36%), Positives = 88/138 (63%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  
Sbjct:     1 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 60

Query:   333 LVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE+++  + E
Sbjct:    61 LMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKE 117

Query:   513 IDEDGSGKIEFEEFWELM 566
              D DG G+I +EEF ++M
Sbjct:   118 ADVDGDGQINYEEFVKVM 135

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     1 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 60

Query:   561 LMA 569
             LMA
Sbjct:    61 LMA 63

 Score = 106 (37.3 bits), Expect = 6.7e-05, P = 6.7e-05
 Identities = 17/64 (26%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++I++ D DG G++ 
Sbjct:    68 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQIN 127

Query:   315 FDEF 326
             ++EF
Sbjct:   128 YEEF 131

 Score = 98 (34.5 bits), Expect = 0.0026, P = 0.0026
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     1 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 56

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    57 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 99


>gi|167676 (M13009) calmodulin [Dictyostelium discoideum]
           Length = 139

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 47/138 (34%), Positives = 89/138 (64%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  
Sbjct:     1 EFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLT 60

Query:   333 LVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             ++       D E   +E+REAF++FDK+GNGYIS   L+ ++  + + L++E+++  + E
Sbjct:    61 MMARKMQDTDTE---EEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIRE 117

Query:   513 IDEDGSGKIEFEEFWELM 566
              D DG G++ ++EF ++M
Sbjct:   118 ADLDGDGQVNYDEFVKMM 135

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     1 EFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLT 60

Query:   561 LMA 569
             +MA
Sbjct:    61 MMA 63

 Score = 114 (40.1 bits), Expect = 8.6e-06, P = 8.6e-06
 Identities = 19/63 (30%), Positives = 40/63 (63%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE ++ F +FD+   GYI A ++  +M ++ +    +++ ++IR+ D DG G++ +DEF 
Sbjct:    73 EEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREADLDGDGQVNYDEFV 132

Query:   330 ALV 338
              ++
Sbjct:   133 KMM 135

 Score = 104 (36.6 bits), Expect = 0.00011, P = 0.00011
 Identities = 27/102 (26%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     1 EFKEAFSLFDKDGDGSITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFP 56

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  ++E++  A    D+DG+G I   E   +M
Sbjct:    57 EFLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVM 99

 Score = 87 (30.6 bits), Expect = 0.18, P = 0.16
 Identities = 26/114 (22%), Positives = 56/114 (49%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQL 266
             +I  +++  ++  +  +  E E Q   +  D    G I   +   +M    QD D E+++
Sbjct:    16 SITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLTMMARKMQDTDTEEEI 75

Query:   267 RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             R+  + FD DG+G +   E   ++ ++   +  E + + +REA    D +G+G ++
Sbjct:    76 REAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREA----DLDGDGQVN 127


>sp|P05419|CALN_CHICK NEO-CALMODULIN (NEOCAM) >pir||A29422 calmodulin-like
            protein - chicken (fragment) >gi|211368 (M18355) calmodulin-like
            protein [Gallus gallus]
            Length = 131

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 48/134 (35%), Positives = 85/134 (63%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  
Sbjct:     1 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 60

Query:   333 LVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             ++       D E   +E+REAFR+FDK+ NGYIS   L+ ++  + + L+DE+++  + E
Sbjct:    61 MMARKMKDTDSE---EEIREAFRVFDKDSNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 117

Query:   513 IDEDGSGKIEFEEF 554
              D DG G++ +EEF
Sbjct:   118 ADIDGDGQVNYEEF 131

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     1 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 60

Query:   561 LMA 569
             +MA
Sbjct:    61 MMA 63

 Score = 110 (38.7 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 19/64 (29%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    68 DTDSEEEIREAFRVFDKDSNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 127

Query:   315 FDEF 326
             ++EF
Sbjct:   128 YEEF 131

 Score = 99 (34.8 bits), Expect = 0.00040, P = 0.00040
 Identities = 27/102 (26%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     1 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 56

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+D +G I   E   +M
Sbjct:    57 EFLTMMARKMKDTDSEEEIREAFRVFDKDSNGYISAAELRHVM 99

 Score = 79 (27.8 bits), Expect = 1.5, P = 0.77
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    17 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIR 76

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    77 EAFRVFDKDSNGYISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 127


>sp|P48976|CALM_MALDO CALMODULIN >gi|505152 (X60737) Calmodulin [Malus
            domestica]
            Length = 149

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 51/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F E   L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEPLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADVDGDGQINYEEFVKVM 146

 Score = 129 (45.4 bits), Expect = 1.8e-07, P = 1.8e-07
 Identities = 24/63 (38%), Positives = 42/63 (66%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F E   
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEPLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             ++EF
Sbjct:   139 YEEF 142

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EPLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 76 (26.8 bits), Expect = 6.1, P = 1.0
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEPLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 138


>pir||S58314 calmodulin - moss (Physcomitrella patens) >gi|940811 (X90560)
            Calmodulin [Cloning vector pBluescript]
            Length = 149

  Plus Strand HSPs:

 Score = 262 (92.2 bits), Expect = 5.5e-22, P = 5.5e-22
 Identities = 51/156 (32%), Positives = 97/156 (62%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             MA+D+ E        QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I
Sbjct:     1 MADDLTE-------EQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMI 53

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + DADG+G ++F EF  L+       D E   +EL+EAF++FDK+ NG+IS   ++ ++
Sbjct:    54 NEVDADGNGTIDFPEFLNLMARKMKDTDSE---EELKEAFKVFDKDQNGFISAADVRHVM 110

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               + + L+DE+++  + + D DG G+++++EF ++M
Sbjct:   111 TNLGEKLTDEEVDEMIRDADVDGDGQVDYDEFVKMM 146

 Score = 141 (49.6 bits), Expect = 7.8e-09, P = 7.8e-09
 Identities = 27/75 (36%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADDLTEEQIA-EFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLNLMA 74

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A  +  +M  + +   ++++ ++IR  D DG G+++
Sbjct:    79 DTDSEEELKEAFKVFDKDQNGFISAADVRHVMTNLGEKLTDEEVDEMIRDADVDGDGQVD 138

Query:   315 FDEFCALV 338
             +DEF  ++
Sbjct:   139 YDEFVKMM 146

 Score = 105 (37.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 31/110 (28%), Positives = 55/110 (50%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M  D  E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADDLTEEQIAEFKEAFSLFDKDGDGSITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E+L+ A    D+D +G I   +   +M
Sbjct:    57 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAADVRHVM 110


>gi|2267084 (AF007889) calmodulin [Symbiodinium microadriaticum]
            Length = 138

  Plus Strand HSPs:

 Score = 262 (92.2 bits), Expect = 5.5e-22, P = 5.5e-22
 Identities = 49/138 (35%), Positives = 89/138 (64%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF +
Sbjct:     1 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLS 60

Query:   333 LVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             L+       D E   +EL EAF++FD++GNG+IS   L+ ++  + + L+DE+++  + E
Sbjct:    61 LMARKMKDTDTE---EELIEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 117

Query:   513 IDEDGSGKIEFEEFWELM 566
              D DG G+I +EEF ++M
Sbjct:   118 ADVDGDGQINYEEFVKMM 135

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     1 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLS 60

Query:   561 LMA 569
             LMA
Sbjct:    61 LMA 63

 Score = 106 (37.3 bits), Expect = 6.7e-05, P = 6.7e-05
 Identities = 18/63 (28%), Positives = 39/63 (61%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  + F +FDR   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ ++EF 
Sbjct:    73 EELIEAFKVFDRDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 132

Query:   330 ALV 338
              ++
Sbjct:   133 KMM 135

 Score = 102 (35.9 bits), Expect = 0.00019, P = 0.00019
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     1 EFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 56

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                +L+ +++ D  ++E+L  A    D DG+G I   E   +M
Sbjct:    57 EFLSLMARKMKDTDTEEELIEAFKVFDRDGNGFISAAELRHVM 99

 Score = 79 (27.8 bits), Expect = 1.9, P = 0.85
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L 
Sbjct:    17 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKDTDTEEELI 76

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    77 EAFKVFDRDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 127


>pir||JC1033 calmodulin - garden pea
            Length = 148

  Plus Strand HSPs:

 Score = 260 (91.5 bits), Expect = 9.0e-22, P = 9.0e-22
 Identities = 50/141 (35%), Positives = 89/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     9 QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L++E+++  
Sbjct:    69 FLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTEEEVDEM 125

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G+I + EF ++M
Sbjct:   126 IREADVDGDGQINYGEFVKVM 146

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/75 (36%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ +  E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADPLTDEQIS-EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLNLMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 19/64 (29%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   E+++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTEEEVDEMIREADVDGDGQIN 138

Query:   315 FDEF 326
             + EF
Sbjct:   139 YGEF 142

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 30/105 (28%), Positives = 53/105 (50%), Frame = +3

Query:   252 DEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNG 425
             DE+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG
Sbjct:     7 DEQISEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNG 62

Query:   426 YISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              I  P  L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    63 TIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 81 (28.5 bits), Expect = 1.5, P = 0.77
 Identities = 29/113 (25%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T ++E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-EEEVDEMIREADVDGDGQIN 138


>sp|P07463|CALM_PARTE CALMODULIN >pir||MCPP calmodulin - Paramecium tetraurelia
            (SGC5) >gi|159994 (M34540) calmodulin [Paramecium tetraurelia]
            >bbs|68026 (S68025) calmodulin [Paramecium tetraurelia, Peptide,
            149 aa] [Paramecium tetraurelia]
            Length = 149

  Plus Strand HSPs:

 Score = 260 (91.5 bits), Expect = 9.0e-22, P = 9.0e-22
 Identities = 49/146 (33%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF +L+   A  + ++  ++EL EAF++FD++GNG IS   L+ ++  + + L+D+
Sbjct:    64 IDFPEFLSLM---ARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDD 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G I +EEF  +M
Sbjct:   121 EVDEMIREADIDGDGHINYEEFVRMM 146

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/75 (36%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A  + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MAEQLTEEQIA-EFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    60 GNGTIDFPEFLSLMA 74

 Score = 106 (37.3 bits), Expect = 0.00034, P = 0.00034
 Identities = 31/110 (28%), Positives = 55/110 (50%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M +   E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MAEQLTEEQIAEFKEAFALFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P   +L+ +++ +  S+E+L  A    D DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVM 110

 Score = 98 (34.5 bits), Expect = 0.0083, P = 0.0082
 Identities = 26/107 (24%), Positives = 53/107 (49%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++    N    F    ++MA  + E  +E      EE  + F +FDR   G
Sbjct:    46 EAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSE------EELIEAFKVFDRDGNG 99

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
              I A ++  +M  + +   + ++ ++IR+ D DG G + ++EF  ++
Sbjct:   100 LISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMM 146

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M   M++   E++L 
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELI 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T   E+ E  R  D +G+G+I+
Sbjct:    88 EAFKVFDRDGNGLISAAE---LRHVMTNLGEKLT-DDEVDEMIREADIDGDGHIN 138


>pdb|1OSA|  Calmodulin
            Length = 148

  Plus Strand HSPs:

 Score = 260 (91.5 bits), Expect = 9.0e-22, P = 9.0e-22
 Identities = 49/146 (33%), Positives = 93/146 (63%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     3 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF +L+   A  + ++  ++EL EAF++FD++GNG IS   L+ ++  + + L+D+
Sbjct:    63 IDFPEFLSLM---ARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDD 119

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G I +EEF  +M
Sbjct:   120 EVDEMIREADIDGDGHINYEEFVRMM 145

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    11 EFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLS 70

Query:   561 LMA 569
             LMA
Sbjct:    71 LMA 73

 Score = 104 (36.6 bits), Expect = 0.00078, P = 0.00078
 Identities = 31/109 (28%), Positives = 55/109 (50%), Frame = +3

Query:   240 EQDFDEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             EQ  +E+  + ++    FD DG G +   E    + TV  ++ +   + EL++     D 
Sbjct:     2 EQLTEEQIAEFKEAFALFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEVDA 57

Query:   414 EGNGYISRPTLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +GNG I  P   +L+ +++ +  S+E+L  A    D DG+G I   E   +M
Sbjct:    58 DGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVM 109

 Score = 98 (34.5 bits), Expect = 0.0077, P = 0.0077
 Identities = 26/107 (24%), Positives = 53/107 (49%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++    N    F    ++MA  + E  +E      EE  + F +FDR   G
Sbjct:    45 EAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSE------EELIEAFKVFDRDGNG 98

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
              I A ++  +M  + +   + ++ ++IR+ D DG G + ++EF  ++
Sbjct:    99 LISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMM 145

 Score = 79 (27.8 bits), Expect = 2.5, P = 0.92
 Identities = 28/113 (24%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M   M++   E++L 
Sbjct:    27 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELI 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD DG+G +   E   L + + N  +K T   E+ E  R  D +G+G+I+
Sbjct:    87 EAFKVFDRDGNGLISAAE---LRHVMTNLGEKLT-DDEVDEMIREADIDGDGHIN 137


>gi|2589016 (AB008556) troponin C [Lampetra japonica]
            Length = 162

  Plus Strand HSPs:

 Score = 260 (91.5 bits), Expect = 9.0e-22, P = 9.0e-22
 Identities = 52/160 (32%), Positives = 94/160 (58%), Frame = +3

Query:    99 MAEDIDEILAE-IDGSQIEEYQKFFDMFDR-GKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             MAED+D    E +   Q +E++  FD+F +  + G I   ++G+++  + Q+    +L++
Sbjct:     1 MAEDVDRAAVEQLTEEQKKEFRAAFDIFVQDAEDGCISTKELGKVLRMLGQNPSPDELQE 60

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKA 452
             +I + D DGSG ++F+EF  ++        K   ++EL E +R+FDK G+GYI    LK 
Sbjct:    61 MIDEVDEDGSGTVDFEEFLIMMVRSMKEESKGKSEEELSELYRMFDKNGDGYIDLEELKV 120

Query:   453 LLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +L    +D++D+ +E    + D++G G I+++EF E M G
Sbjct:   121 MLHATGEDITDDDIEELFADGDKNGDGFIDYDEFMEFMKG 160

 Score = 106 (37.3 bits), Expect = 0.0012, P = 0.0012
 Identities = 20/66 (30%), Positives = 35/66 (53%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E  G   EE  + + MFD+   GYI   ++  ++HA  +D  +  + +L    D +G G 
Sbjct:    89 ESKGKSEEELSELYRMFDKNGDGYIDLEELKVMLHATGEDITDDDIEELFADGDKNGDGF 148

Query:   309 LEFDEF 326
             +++DEF
Sbjct:   149 IDYDEF 154

 Score = 91 (32.0 bits), Expect = 0.12, P = 0.11
 Identities = 30/152 (19%), Positives = 68/152 (44%), Frame = +3

Query:    15 VEQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEI-DGSQIEEYQKFFDMFDRGK 191
             VEQ  E+   +     +   Q      I  +++ ++L  +      +E Q+  D  D   
Sbjct:    10 VEQLTEEQKKEFRAAFDIFVQDAEDGCISTKELGKVLRMLGQNPSPDELQEMIDEVDEDG 69

Query:   192 QGYIMATQ-IGQIMHAMEQDF---DEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTV 359
              G +   + +  ++ +M+++     E++L +L R FD +G G ++ +E   +++     +
Sbjct:    70 SGTVDFEEFLIMMVRSMKEESKGKSEEELSELYRMFDKNGDGYIDLEELKVMLHATGEDI 129

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEI 467
               +    ++ E F   DK G+G+I        +K +
Sbjct:   130 TDD----DIEELFADGDKNGDGFIDYDEFMEFMKGV 161


>sp|P27163|CAL2_PETHY CALMODULIN 2 >pir||S70767 calmodulin CAM72 - petunia
            >gi|169239 (M80832) calmodulin [Petunia hybrida]
            Length = 149

  Plus Strand HSPs:

 Score = 259 (91.2 bits), Expect = 1.2e-21, P = 1.2e-21
 Identities = 49/146 (33%), Positives = 90/146 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD +G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAF++FDK+ NGYIS   ++ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFKVFDKDQNGYISAADVRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   121 EVDEMIREADMDGDGQVNYEEFVRMM 146

 Score = 131 (46.1 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 26/75 (34%), Positives = 47/75 (62%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A  + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  + E+D D
Sbjct:     1 MAEQLTEEQIA-EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
              +G I+F EF  LMA
Sbjct:    60 QNGTIDFPEFLNLMA 74

 Score = 112 (39.4 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 19/68 (27%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + GYI A  +  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFKVFDKDQNGYISAADVRHVMTNLGEKLTDEEVDEMIREADMDGDGQVN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVRMM 146


>sp|P05933|CALM_SCHPO CALMODULIN >pir||MCZP calmodulin - fission yeast
            (Schizosaccharomyces pombe) >gi|173357 (M16475) calmodulin
            [Schizosaccharomyces pombe] >gnl|PID|e316105 (Z95395) Cam1p
            [Schizosaccharomyces pombe]
            Length = 150

  Plus Strand HSPs:

 Score = 259 (91.2 bits), Expect = 1.2e-21, P = 1.2e-21
 Identities = 51/137 (37%), Positives = 84/137 (61%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FDR + G I + ++G +M ++ Q     +L+ +I + DADG+G ++F E
Sbjct:    10 QIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFTE 69

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAF++FDK+GNGYI+   L  +L  + + LS E++   
Sbjct:    70 FLTMMARKMKDTDNE---EEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADM 126

Query:   504 VDEIDEDGSGKIEFEEF 554
             + E D DG G I +EEF
Sbjct:   127 IREADTDGDGVINYEEF 143

 Score = 127 (44.7 bits), Expect = 3.0e-07, P = 3.0e-07
 Identities = 26/76 (34%), Positives = 45/76 (59%), Frame = +3

Query:   342 TVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDE 521
             T  N  D++    E REAF LFD++ +G I+   L  +++ +    +  +L+  ++E+D 
Sbjct:     2 TTRNLTDEQIA--EFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDA 59

Query:   522 DGSGKIEFEEFWELMA 569
             DG+G I+F EF  +MA
Sbjct:    60 DGNGTIDFTEFLTMMA 75

 Score = 104 (36.6 bits), Expect = 0.0010, P = 0.0010
 Identities = 17/68 (25%), Positives = 39/68 (57%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   GYI   ++  ++ ++ +   ++++  +IR+ D DG G + 
Sbjct:    80 DTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREADTDGDGVIN 139

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   140 YEEFSRVI 147

 Score = 91 (32.0 bits), Expect = 0.079, P = 0.076
 Identities = 27/105 (25%), Positives = 51/105 (48%), Frame = +3

Query:   252 DEK--QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNG 425
             DE+  + R+    FD D  G +  +E   ++ ++  +     LQ  + E     D +GNG
Sbjct:     8 DEQIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEV----DADGNG 63

Query:   426 YIS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              I     L  + +++ D  ++E++  A    D+DG+G I  EE   ++
Sbjct:    64 TIDFTEFLTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVL 111

 Score = 90 (31.7 bits), Expect = 0.11, P = 0.10
 Identities = 25/94 (26%), Positives = 48/94 (51%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLRKLIRKFDADGSGKLEFDEFC 329
             E Q   +  D    G I  T+   +M    +D D E+++R+  + FD DG+G +  +E  
Sbjct:    49 ELQDMINEVDADGNGTIDFTEFLTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELT 108

Query:   330 ALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
              ++ ++   + +E +   +REA    D +G+G I+
Sbjct:   109 HVLTSLGERLSQEEVADMIREA----DTDGDGVIN 139


>prf||1803520B calmodulin 1 [Arabidopsis thaliana]
            Length = 137

  Plus Strand HSPs:

 Score = 258 (90.8 bits), Expect = 1.5e-21, P = 1.5e-21
 Identities = 50/133 (37%), Positives = 84/133 (63%), Frame = +3

Query:   168 FDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  L+   
Sbjct:     5 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKK 64

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
                 D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE++E  + E D DG
Sbjct:    65 MKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDG 121

Query:   528 SGKIEFEEFWELM 566
              G+I +EEF ++M
Sbjct:   122 DGQINYEEFVKIM 134

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 24/62 (38%), Positives = 43/62 (69%), Frame = +3

Query:   384 LREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWEL 563
             ++EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  L
Sbjct:     1 MKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNL 60

Query:   564 MA 569
             MA
Sbjct:    61 MA 62

 Score = 112 (39.4 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 18/68 (26%), Positives = 42/68 (61%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    67 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQIN 126

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   127 YEEFVKIM 134

 Score = 101 (35.6 bits), Expect = 0.00024, P = 0.00024
 Identities = 29/101 (28%), Positives = 50/101 (49%), Frame = +3

Query:   264 LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPT 443
             +++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P 
Sbjct:     1 MKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 56

Query:   444 -LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              L  + K++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    57 FLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 98

 Score = 81 (28.5 bits), Expect = 1.0, P = 0.65
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    16 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELK 75

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    76 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVEEMIREADVDGDGQIN 126


>sp|P25854|CAL1_ARATH CALMODULIN-1 >gi|166649 (M38379) calmodulin-1
            [Arabidopsis thaliana]
            Length = 136

  Plus Strand HSPs:

 Score = 258 (90.8 bits), Expect = 1.5e-21, P = 1.5e-21
 Identities = 50/133 (37%), Positives = 84/133 (63%), Frame = +3

Query:   168 FDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  L+   
Sbjct:     4 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKK 63

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
                 D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE++E  + E D DG
Sbjct:    64 MKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDG 120

Query:   528 SGKIEFEEFWELM 566
              G+I +EEF ++M
Sbjct:   121 DGQINYEEFVKIM 133

 Score = 134 (47.2 bits), Expect = 4.9e-08, P = 4.9e-08
 Identities = 24/61 (39%), Positives = 42/61 (68%), Frame = +3

Query:   387 REAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  LM
Sbjct:     1 KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 60

Query:   567 A 569
             A
Sbjct:    61 A 61

 Score = 112 (39.4 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 18/68 (26%), Positives = 42/68 (61%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    66 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQIN 125

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   126 YEEFVKIM 133

 Score = 100 (35.2 bits), Expect = 0.00031, P = 0.00031
 Identities = 29/94 (30%), Positives = 47/94 (50%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPT-LKALLK 461
             FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P  L  + K
Sbjct:     7 FDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAK 62

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    63 KMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 97

 Score = 81 (28.5 bits), Expect = 1.0, P = 0.63
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    15 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELK 74

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    75 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVEEMIREADVDGDGQIN 125


>gnl|PID|e238792 (X97612) CaMF-1 [Fagus sylvatica]
            Length = 148

  Plus Strand HSPs:

 Score = 257 (90.5 bits), Expect = 1.9e-21, P = 1.9e-21
 Identities = 51/146 (34%), Positives = 90/146 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + D DG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDRDGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
              ++  + E D DG G+I +EEF ++M
Sbjct:   121 -VDEMIREADVDGDGQINYEEFVKVM 145

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDRDGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 101 (35.6 bits), Expect = 0.0026, P = 0.0026
 Identities = 28/102 (27%), Positives = 51/102 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D++GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDRDGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVM 110

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 18/64 (28%), Positives = 39/64 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   + ++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD-EVDEMIREADVDGDGQIN 137

Query:   315 FDEF 326
             ++EF
Sbjct:   138 YEEF 141

 Score = 82 (28.9 bits), Expect = 1.1, P = 0.66
 Identities = 30/113 (26%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  DR   G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMINEVDRDGNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K  L  E+ E  R  D +G+G I+
Sbjct:    88 EAFRVFDKDQNGFISAAE---LRHVMTNLGEK--LTDEVDEMIREADVDGDGQIN 137


>sp|P27161|CALM_LYCES CALMODULIN >gi|170396 (M67472) calmodulin [Lycopersicon
            esculentum]
            Length = 149

  Plus Strand HSPs:

 Score = 257 (90.5 bits), Expect = 1.9e-21, P = 1.9e-21
 Identities = 49/146 (33%), Positives = 90/146 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD +G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAF++FDK+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G++ +EEF  +M
Sbjct:   121 EVDEMIREADIDGDGQVNYEEFVRMM 146

 Score = 131 (46.1 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 26/75 (34%), Positives = 47/75 (62%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A  + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  + E+D D
Sbjct:     1 MAEQLTEEQIA-EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
              +G I+F EF  LMA
Sbjct:    60 QNGTIDFPEFLNLMA 74

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 18/68 (26%), Positives = 42/68 (61%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVRMM 146

 Score = 76 (26.8 bits), Expect = 6.1, P = 1.0
 Identities = 27/113 (23%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q      D  + G I   +   +M    +D D E++L+
Sbjct:    28 ITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFPEFLNLMARKMKDTDSEEELK 87

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  + FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G ++
Sbjct:    88 EAFKVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDGDGQVN 138


>gnl|PID|d1014427 (D88976) troponin C [Branchiostoma lanceolatum]
            >gnl|PID|d1014429 (D88978) troponin C [Branchiostoma lanceolatum]
            Length = 164

  Plus Strand HSPs:

 Score = 256 (90.1 bits), Expect = 2.4e-21, P = 2.4e-21
 Identities = 52/157 (33%), Positives = 89/157 (56%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M++D  +        QI E++  FDMFD    G I   ++G IM  +      ++L+++I
Sbjct:     1 MSDDYVKARVMFKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMI 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D D SG ++F+EF  ++       ++E    ELR AFR+ DK G+G+I +   +AL 
Sbjct:    61 DEVDEDASGTIDFEEFLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALA 120

Query:   459 KEIA-DDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              E A DDL+D++L   +DE D +  G+ ++EE+ E++
Sbjct:   121 SECAGDDLTDDELHEFMDEYDGNRDGRFDYEEWKEII 157

 Score = 204 (71.8 bits), Expect = 7.7e-16, P = 7.7e-16
 Identities = 49/154 (31%), Positives = 81/154 (52%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M++D  +        QI E++  FDMFD    G I   ++G IM  +      ++L+++I
Sbjct:     1 MSDDYVKARVMFKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMI 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D D SG ++F+EF  ++       ++E    ELR AFR+ DK G+G+I +   +AL 
Sbjct:    61 DEVDEDASGTIDFEEFLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALA 120

Query:   459 KEIADDLSDEQLEAAVDEIDE-DGSGKIEFE-EFWE 560
              E A D  D   +   + +DE DG+    F+ E W+
Sbjct:   121 SECAGD--DLTDDELHEFMDEYDGNRDGRFDYEEWK 154

 Score = 165 (58.1 bits), Expect = 1.2e-11, P = 1.2e-11
 Identities = 33/77 (42%), Positives = 48/77 (62%), Frame = +3

Query:   339 YTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEID 518
             Y  A  + KE    E + AF +FD++G G IS   L  ++K +   +S E+L+  +DE+D
Sbjct:     5 YVKARVMFKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMIDEVD 64

Query:   519 EDGSGKIEFEEFWELMA 569
             ED SG I+FEEF E+MA
Sbjct:    65 EDASGTIDFEEFLEMMA 81

 Score = 102 (35.9 bits), Expect = 0.0046, P = 0.0046
 Identities = 33/125 (26%), Positives = 63/125 (50%), Frame = +3

Query:   249 FDEKQLRKL---IRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             F E+Q+ +       FD DG G +   E   ++  +  ++ +E LQ+ + E     D++ 
Sbjct:    12 FKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMIDEV----DEDA 67

Query:   420 NGYIS-RPTLKALLKEIAD---DLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*T 587
             +G I     L+ + + + D   ++ D++L AA   +D++G G I+ +EF  L +  A   
Sbjct:    68 SGTIDFEEFLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALASECAGDD 127

Query:   588 ITVDNF*PF 614
             +T D    F
Sbjct:   128 LTDDELHEF 136


>gi|310563 (L19359) calmodulin [Glycine max] >prf||2121384E calmodulin [Glycine
           max]
           Length = 150

  Plus Strand HSPs:

 Score = 256 (90.1 bits), Expect = 2.4e-21, P = 2.4e-21
 Identities = 51/150 (34%), Positives = 95/150 (63%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             ++L+E    QI E ++ F +FD+   G I   +   ++ ++ Q+  E++L+ +I + DAD
Sbjct:     3 DVLSE---EQISEIKEAFGLFDKDGDGCITVDEFVTVIRSLVQNPTEEELQDMINEVDAD 59

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             G+G +EF EF  L+       D+E   ++L+EAF++FDK+ NGYIS   L+ ++  + + 
Sbjct:    60 GNGTIEFVEFLNLMAKKMKETDEE---EDLKEAFKVFDKDQNGYISASELRHVMINLGEK 116

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             L+DE++E  ++E D DG G++ ++EF ++M
Sbjct:   117 LTDEEVEQMIEEADLDGDGQVNYDEFVKMM 146

 Score = 147 (51.7 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 28/75 (37%), Positives = 51/75 (68%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E++EAF LFDK+G+G I+      +++ +  + ++E+L+  ++E+D D
Sbjct:     1 MADVLSEEQIS-EIKEAFGLFDKDGDGCITVDEFVTVIRSLVQNPTEEELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G IEF EF  LMA
Sbjct:    60 GNGTIEFVEFLNLMA 74

 Score = 121 (42.6 bits), Expect = 1.4e-06, P = 1.4e-06
 Identities = 27/115 (23%), Positives = 62/115 (53%), Frame = +3

Query:     3 VTQMVEQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFD 182
             V    E++L+ +  ++    N   +F     +MA+ + E   E      E+ ++ F +FD
Sbjct:    41 VQNPTEEELQDMINEVDADGNGTIEFVEFLNLMAKKMKETDEE------EDLKEAFKVFD 94

Query:   183 RGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             + + GYI A+++  +M  + +   ++++ ++I + D DG G++ +DEF  ++ T+
Sbjct:    95 KDQNGYISASELRHVMINLGEKLTDEEVEQMIEEADLDGDGQVNYDEFVKMMMTI 149

 Score = 104 (36.6 bits), Expect = 0.0010, P = 0.0010
 Identities = 28/102 (27%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             ++++    FD DG G +  DEF  ++ ++     +E LQ  + E     D +GNG I   
Sbjct:    12 EIKEAFGLFDKDGDGCITVDEFVTVIRSLVQNPTEEELQDMINEV----DADGNGTIEFV 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + K++ +   +E L+ A    D+D +G I   E   +M
Sbjct:    68 EFLNLMAKKMKETDEEEDLKEAFKVFDKDQNGYISASELRHVM 110


>pir||JU0232 calmodulin - fungus (Fusarium oxysporum) (fragment)
            Length = 143

  Plus Strand HSPs:

 Score = 256 (90.1 bits), Expect = 2.4e-21, P = 2.4e-21
 Identities = 44/137 (32%), Positives = 87/137 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q+ E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DAD +G ++F E
Sbjct:     8 QVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE 67

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++       D E   +E+REAF++FD++ +G+IS   L+ ++  I + L+D++++  
Sbjct:    68 FLTMMARKMKDTDSE---EEIREAFKVFDRDNDGFISAAELRHVMTSIGEKLTDDEVDEM 124

Query:   504 VDEIDEDGSGKIEFEEF 554
             + E D+DG G+I++ EF
Sbjct:   125 IREADQDGDGRIDYNEF 141

 Score = 135 (47.5 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 24/63 (38%), Positives = 42/63 (66%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + S+ +L+  ++E+D D +G I+F EF  
Sbjct:    11 EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT 70

Query:   561 LMA 569
             +MA
Sbjct:    71 MMA 73

 Score = 114 (40.1 bits), Expect = 8.6e-06, P = 8.6e-06
 Identities = 25/103 (24%), Positives = 56/103 (54%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ +  ++   +N    F     +MA  + +  +E      EE ++ F +FDR   G
Sbjct:    45 ESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSE------EEIREAFKVFDRDNDG 98

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             +I A ++  +M ++ +   + ++ ++IR+ D DG G+++++EF
Sbjct:    99 FISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEF 141

 Score = 93 (32.7 bits), Expect = 0.029, P = 0.029
 Identities = 26/102 (25%), Positives = 47/102 (46%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G++   E    + TV  ++ +   + EL++     D + NG I  P
Sbjct:    11 EFKEAFSLFDKDGDGQITTKE----LGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D D  G I   E   +M
Sbjct:    67 EFLTMMARKMKDTDSEEEIREAFKVFDRDNDGFISAAELRHVM 109

 Score = 75 (26.4 bits), Expect = 7.2, P = 1.0
 Identities = 24/112 (21%), Positives = 53/112 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E+++R
Sbjct:    27 ITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSEEEIR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
             +  + FD D  G +   E   ++ ++   +  + + + +REA    D++G+G I
Sbjct:    87 EAFKVFDRDNDGFISAAELRHVMTSIGEKLTDDEVDEMIREA----DQDGDGRI 136


>sp|P15094|CALM_ACHKL CALMODULIN >pir||MCUMAK calmodulin - Achlya klebsiana
            >gi|166304 (J05116) calmodulin [Achlya klebsiana]
            Length = 149

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 3.1e-21, P = 3.1e-21
 Identities = 49/146 (33%), Positives = 90/146 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++   +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAGSLFDKDGDGTITTKELGTVMRSVGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+ EAF+ FDK+GNG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEILEAFQGFDKDGNGFISAAELRHMMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + E D DG G+I +EEF ++M
Sbjct:   121 EVDEMIREADIDGDGQINYEEFVKMM 146

 Score = 130 (45.8 bits), Expect = 1.4e-07, P = 1.4e-07
 Identities = 25/75 (33%), Positives = 49/75 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EA  LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAGSLFDKDGDGTITTKELGTVMRSVGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 106 (37.3 bits), Expect = 0.00034, P = 0.00034
 Identities = 29/94 (30%), Positives = 47/94 (50%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPT-LKALLK 461
             FD DG G +   E    + TV  +V +   + EL++     D +GNG I  P  L  + +
Sbjct:    20 FDKDGDGTITTKE----LGTVMRSVGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR 75

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    76 KMKDTDSEEEILEAFQGFDKDGNGFISAAELRHMM 110

 Score = 99 (34.8 bits), Expect = 0.0056, P = 0.0056
 Identities = 18/68 (26%), Positives = 39/68 (57%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE  + F  FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEEILEAFQGFDKDGNGFISAAELRHMMTNLGEKLTDEEVDEMIREADIDGDGQIN 138

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:   139 YEEFVKMM 146


>gnl|PID|e327459 (Z97336) calmodulin [Arabidopsis thaliana]
            Length = 151

  Plus Strand HSPs:

 Score = 253 (89.1 bits), Expect = 5.0e-21, P = 5.0e-21
 Identities = 47/141 (33%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++  ++ +++Q+  E++L  +I + D+D +G +EF E
Sbjct:    10 QITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAE 69

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+   A  + +   ++EL+EAF++FDK+ NGYIS   L  ++  + + L+DE++E  
Sbjct:    70 FLNLM---AKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQM 126

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G++ ++EF ++M
Sbjct:   127 IKEADLDGDGQVNYDEFVKMM 147

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 29/110 (26%), Positives = 62/110 (56%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             EQ+L  + T++    N   +F     +MA+ + E  AE      EE ++ F +FD+ + G
Sbjct:    47 EQELHDIITEIDSDSNGTIEFAEFLNLMAKKLQESDAE------EELKEAFKVFDKDQNG 100

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             YI A+++  +M  + +   ++++ ++I++ D DG G++ +DEF  ++  +
Sbjct:   101 YISASELSHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYDEFVKMMINI 150

 Score = 132 (46.5 bits), Expect = 8.3e-08, P = 8.3e-08
 Identities = 26/63 (41%), Positives = 41/63 (65%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++++L   + EID D +G IEF EF  
Sbjct:    13 EFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAEFLN 72

Query:   561 LMA 569
             LMA
Sbjct:    73 LMA 75

 Score = 100 (35.2 bits), Expect = 0.0046, P = 0.0046
 Identities = 26/94 (27%), Positives = 46/94 (48%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FD DG G +  +E      TV  ++D+   ++EL +     D + NG I     L  + K
Sbjct:    21 FDKDGDGCITVEELA----TVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAEFLNLMAK 76

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++ +  ++E+L+ A    D+D +G I   E   +M
Sbjct:    77 KLQESDAEEELKEAFKVFDKDQNGYISASELSHVM 111


>sp|P14533|CABO_LOLPE SQUIDULIN (OPTIC LOBE CALCIUM-BINDING PROTEIN) (SCABP)
            >pir||A33353 calcium-binding protein - squid (Watasenia
            scintillans)
            Length = 149

  Plus Strand HSPs:

 Score = 252 (88.7 bits), Expect = 6.3e-21, P = 6.3e-21
 Identities = 51/146 (34%), Positives = 87/146 (59%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   QI E +  FDMFD    G I + ++  +M ++ +   + +L ++IR+ D DG+G 
Sbjct:     3 ELSEKQIAEIKDAFDMFDIDGDGQITSKELRSVMKSLGRTPSDAELEEMIREVDTDGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD-LSD 485
             +E+ EF  ++       D E   KE+REAFR+FDK+GNG I+   L+ ++   +D+ L+ 
Sbjct:    63 IEYAEFVEMMAKQMGPTDPE---KEMREAFRVFDKDGNGLITAAELRQVMANFSDEKLTS 119

Query:   486 EQLEAAVDEIDEDGSGKIEFEEFWELM 566
             E++   + E D DG G + +EEF ++M
Sbjct:   120 EEISEMIREADIDGDGMVNYEEFVKMM 146

 Score = 143 (50.3 bits), Expect = 4.7e-09, P = 4.7e-09
 Identities = 29/72 (40%), Positives = 48/72 (66%), Frame = +3

Query:   363 KETLQK---ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSG 533
             KE  +K   E+++AF +FD +G+G I+   L++++K +    SD +LE  + E+D DG+G
Sbjct:     2 KELSEKQIAEIKDAFDMFDIDGDGQITSKELRSVMKSLGRTPSDAELEEMIREVDTDGNG 61

Query:   534 KIEFEEFWELMA 569
              IE+ EF E+MA
Sbjct:    62 TIEYAEFVEMMA 73

 Score = 107 (37.7 bits), Expect = 0.00015, P = 0.00015
 Identities = 30/117 (25%), Positives = 61/117 (52%), Frame = +3

Query:   243 QDFDEKQLRKL---IRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDK 413
             ++  EKQ+ ++      FD DG G++   E  +++ ++  T     L++ +RE     D 
Sbjct:     2 KELSEKQIAEIKDAFDMFDIDGDGQITSKELRSVMKSLGRTPSDAELEEMIREV----DT 57

Query:   414 EGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TI 590
             +GNG I     ++ + K++     ++++  A    D+DG+G I   E  ++MA  +D  +
Sbjct:    58 DGNGTIEYAEFVEMMAKQMGPTDPEKEMREAFRVFDKDGNGLITAAELRQVMANFSDEKL 117

Query:   591 T 593
             T
Sbjct:   118 T 118

 Score = 95 (33.4 bits), Expect = 0.022, P = 0.022
 Identities = 20/81 (24%), Positives = 47/81 (58%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLRKL 275
             AE ++ +  ++  +  E E ++ F +FD+   G I A ++ Q+M +  ++    +++ ++
Sbjct:    66 AEFVEMMAKQMGPTDPEKEMREAFRVFDKDGNGLITAAELRQVMANFSDEKLTSEEISEM 125

Query:   276 IRKFDADGSGKLEFDEFCALV 338
             IR+ D DG G + ++EF  ++
Sbjct:   126 IREADIDGDGMVNYEEFVKMM 146

 Score = 95 (33.4 bits), Expect = 0.022, P = 0.022
 Identities = 33/109 (30%), Positives = 57/109 (52%), Frame = +3

Query:   108 DIDEILAEID--GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             +++E++ E+D  G+   EY +F +M         MA Q+G        D  EK++R+  R
Sbjct:    47 ELEEMIREVDTDGNGTIEYAEFVEM---------MAKQMGPT------D-PEKEMREAFR 90

Query:   282 KFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
              FD DG+G +   E   L   +AN  D++   +E+ E  R  D +G+G ++
Sbjct:    91 VFDKDGNGLITAAE---LRQVMANFSDEKLTSEEISEMIREADIDGDGMVN 138

 Score = 87 (30.6 bits), Expect = 0.26, P = 0.23
 Identities = 27/113 (23%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I ++++  ++  +  +  + E ++     D    G I   +  ++M       D EK++R
Sbjct:    27 ITSKELRSVMKSLGRTPSDAELEEMIREVDTDGNGTIEYAEFVEMMAKQMGPTDPEKEMR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L   +AN  D++   +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGLITAAE---LRQVMANFSDEKLTSEEISEMIREADIDGDGMVN 138


>gi|1572783 (U70851) similar to calmodulin-like protein. [Caenorhabditis
            elegans]
            Length = 164

  Plus Strand HSPs:

 Score = 251 (88.4 bits), Expect = 8.1e-21, P = 8.1e-21
 Identities = 48/155 (30%), Positives = 96/155 (61%), Frame = +3

Query:   105 EDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRK 284
             E+   +++++   +I E+++ F +FD+   G I   ++G  M A+ Q+  E+Q+ ++I  
Sbjct:    14 EESKLVISQLTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHD 73

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE 464
              D DG+G++EF EFC ++  +     KET  + +REAF++FD++GNG I+    K  +  
Sbjct:    74 VDLDGNGQVEFPEFCVMMKRIM----KETDSEMIREAFKIFDRDGNGVITANEFKLFMIN 129

Query:   465 IADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
             +     + ++E  ++E+D DG+G+I++EEF ++ +
Sbjct:   130 MGMCFDEVEVEEMMNEVDCDGNGEIDYEEFVKIFS 164

 Score = 132 (46.5 bits), Expect = 8.3e-08, P = 8.3e-08
 Identities = 26/74 (35%), Positives = 47/74 (63%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             V + + +E +  E +EAF LFDK+GNG IS   L   ++ +  + +++Q+   + ++D D
Sbjct:    19 VISQLTEEEIH-EFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLD 77

Query:   525 GSGKIEFEEFWELM 566
             G+G++EF EF  +M
Sbjct:    78 GNGQVEFPEFCVMM 91

 Score = 107 (37.7 bits), Expect = 0.00093, P = 0.00093
 Identities = 23/69 (33%), Positives = 38/69 (55%), Frame = +3

Query:   120 ILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             I+ E D   I E    F +FDR   G I A +    M  M   FDE ++ +++ + D DG
Sbjct:    94 IMKETDSEMIREA---FKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDCDG 150

Query:   300 SGKLEFDEF 326
             +G+++++EF
Sbjct:   151 NGEIDYEEF 159

 Score = 100 (35.2 bits), Expect = 0.0087, P = 0.0086
 Identities = 26/110 (23%), Positives = 46/110 (41%), Frame = +3

Query:   225 IMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRL 404
             I    E++  E   ++    FD DG+G +   E    +      + +   ++++ E    
Sbjct:    20 ISQLTEEEIHE--FKEAFLLFDKDGNGTISIKELGVAM----RALGQNPTEQQMMEIIHD 73

Query:   405 FDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              D +GNG +  P    ++K I  +   E +  A    D DG+G I   EF
Sbjct:    74 VDLDGNGQVEFPEFCVMMKRIMKETDSEMIREAFKIFDRDGNGVITANEF 123


>gi|1399216 (U57550) calmodulin-like myosin-light chain [Loligo pealei]
            Length = 149

  Plus Strand HSPs:

 Score = 250 (88.0 bits), Expect = 1.0e-20, P = 1.0e-20
 Identities = 51/146 (34%), Positives = 87/146 (59%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   QI E +  FDMFD    G I + ++  +M ++ +   + +L ++IR+ D DG+G 
Sbjct:     3 ELREQQIAEIKDAFDMFDIDGDGQITSKELRSVMKSLGRTPSDAELEEMIREVDTDGNGT 62

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD-LSD 485
             +E+ EF  ++       D E   KE+REAFR+FDK+GNG I+   L+ ++   +D+ L+ 
Sbjct:    63 IEYAEFVEMMAKQMGPTDPE---KEMREAFRVFDKDGNGLITAAELRQVMANFSDEKLTS 119

Query:   486 EQLEAAVDEIDEDGSGKIEFEEFWELM 566
             E++   + E D DG G + +EEF ++M
Sbjct:   120 EEISEMIREADIDGDGMVNYEEFVKMM 146

 Score = 142 (50.0 bits), Expect = 6.0e-09, P = 6.0e-09
 Identities = 26/63 (41%), Positives = 44/63 (69%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E+++AF +FD +G+G I+   L++++K +    SD +LE  + E+D DG+G IE+ EF E
Sbjct:    11 EIKDAFDMFDIDGDGQITSKELRSVMKSLGRTPSDAELEEMIREVDTDGNGTIEYAEFVE 70

Query:   561 LMA 569
             +MA
Sbjct:    71 MMA 73

 Score = 102 (35.9 bits), Expect = 0.0019, P = 0.0019
 Identities = 27/111 (24%), Positives = 56/111 (50%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             +++     FD DG G++   E  +++ ++  T     L++ +RE     D +GNG I   
Sbjct:    11 EIKDAFDMFDIDGDGQITSKELRSVMKSLGRTPSDAELEEMIREV----DTDGNGTIEYA 66

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TIT 593
               ++ + K++     ++++  A    D+DG+G I   E  ++MA  +D  +T
Sbjct:    67 EFVEMMAKQMGPTDPEKEMREAFRVFDKDGNGLITAAELRQVMANFSDEKLT 118

 Score = 95 (33.4 bits), Expect = 0.022, P = 0.022
 Identities = 20/81 (24%), Positives = 47/81 (58%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIM-HAMEQDFDEKQLRKL 275
             AE ++ +  ++  +  E E ++ F +FD+   G I A ++ Q+M +  ++    +++ ++
Sbjct:    66 AEFVEMMAKQMGPTDPEKEMREAFRVFDKDGNGLITAAELRQVMANFSDEKLTSEEISEM 125

Query:   276 IRKFDADGSGKLEFDEFCALV 338
             IR+ D DG G + ++EF  ++
Sbjct:   126 IREADIDGDGMVNYEEFVKMM 146

 Score = 95 (33.4 bits), Expect = 0.022, P = 0.022
 Identities = 33/109 (30%), Positives = 57/109 (52%), Frame = +3

Query:   108 DIDEILAEID--GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             +++E++ E+D  G+   EY +F +M         MA Q+G        D  EK++R+  R
Sbjct:    47 ELEEMIREVDTDGNGTIEYAEFVEM---------MAKQMGPT------D-PEKEMREAFR 90

Query:   282 KFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
              FD DG+G +   E   L   +AN  D++   +E+ E  R  D +G+G ++
Sbjct:    91 VFDKDGNGLITAAE---LRQVMANFSDEKLTSEEISEMIREADIDGDGMVN 138

 Score = 87 (30.6 bits), Expect = 0.26, P = 0.23
 Identities = 27/113 (23%), Positives = 55/113 (48%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I ++++  ++  +  +  + E ++     D    G I   +  ++M       D EK++R
Sbjct:    27 ITSKELRSVMKSLGRTPSDAELEEMIREVDTDGNGTIEYAEFVEMMAKQMGPTDPEKEMR 86

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD DG+G +   E   L   +AN  D++   +E+ E  R  D +G+G ++
Sbjct:    87 EAFRVFDKDGNGLITAAE---LRQVMANFSDEKLTSEEISEMIREADIDGDGMVN 138


>gnl|PID|e330443 (Z82282) T07G12.1 [Caenorhabditis elegans]
            Length = 182

  Plus Strand HSPs:

 Score = 250 (88.0 bits), Expect = 1.0e-20, P = 1.0e-20
 Identities = 47/157 (29%), Positives = 95/157 (60%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +  D DE   E    +++E+ + F +FD+     +   ++G+ M  +  +  E++L  ++
Sbjct:    10 VCSDADEFTPE----ELQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMV 65

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              ++D DG+GK++F EFC ++      ++KET Q+ +R AF++FDK+GNGYI+    K  +
Sbjct:    66 NEYDVDGNGKIDFGEFCKMM----KEMNKETDQELIRLAFKVFDKDGNGYITAQEFKHFM 121

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
               + +  S+E+++  + E+D+DG  +I+ +EF  ++A
Sbjct:   122 TTMGERFSEEEVDEIIREVDKDGDEQIDLDEFVNMVA 158

 Score = 123 (43.3 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 28/73 (38%), Positives = 46/73 (63%), Frame = +3

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A+    E LQ E  +AF+LFDK+GN  ++   L   ++ +  + ++E+L   V+E D DG
Sbjct:    14 ADEFTPEELQ-EFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDG 72

Query:   528 SGKIEFEEFWELM 566
             +GKI+F EF ++M
Sbjct:    73 NGKIDFGEFCKMM 85

 Score = 108 (38.0 bits), Expect = 0.0014, P = 0.0014
 Identities = 20/62 (32%), Positives = 36/62 (58%), Frame = +3

Query:   168 FDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             F +FD+   GYI A +    M  M + F E+++ ++IR+ D DG  +++ DEF  +V  +
Sbjct:   101 FKVFDKDGNGYITAQEFKHFMTTMGERFSEEEVDEIIREVDKDGDEQIDLDEFVNMVAPI 160

Query:   348 AN 353
              +
Sbjct:   161 VS 162

 Score = 91 (32.0 bits), Expect = 0.18, P = 0.16
 Identities = 25/103 (24%), Positives = 45/103 (43%), Frame = +3

Query:   258 KQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISR 437
             ++  +  + FD DG+  +   E    +  +     +E L   + E    +D +GNG I  
Sbjct:    23 QEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNE----YDVDGNGKIDF 78

Query:   438 PTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                  ++KE+  +   E +  A    D+DG+G I  +EF   M
Sbjct:    79 GEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFKHFM 121

 Score = 91 (32.0 bits), Expect = 0.18, P = 0.16
 Identities = 26/109 (23%), Positives = 49/109 (44%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE     + +D    G I   +  ++M  M ++ D++ +R   + FD DG+G +   EF 
Sbjct:    59 EELLNMVNEYDVDGNGKIDFGEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFK 118

Query:   330 ALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
               + T+     +E + + +RE     DK+G+  I       ++  I  D
Sbjct:   119 HFMTTMGERFSEEEVDEIIREV----DKDGDEQIDLDEFVNMVAPIVSD 163


>gi|9874 (X56950) calmodulin [Plasmodium falciparum] >gi|160126 (M59349)
         calmodulin [Plasmodium falciparum]
         Length = 146

  Plus Strand HSPs:

 Score = 249 (87.7 bits), Expect = 1.3e-20, P = 1.3e-20
 Identities = 49/141 (34%), Positives = 88/141 (62%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G     ++G +M ++ Q+  E +L+ +I + D DG+G ++F E
Sbjct:     9 QISEFKEAFSLFDKDGDG---TKELGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFPE 65

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+       D E   +EL EAFR+FD++G+GYIS   L+ ++  + + L++E+++  
Sbjct:    66 FLTLMARKLKDTDTE---EELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEM 122

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D DG G+I +EEF ++M
Sbjct:   123 IREADIDGDGQINYEEFVKMM 143

 Score = 126 (44.4 bits), Expect = 3.9e-07, P = 3.9e-07
 Identities = 27/75 (36%), Positives = 48/75 (64%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G      L  +++ +  + ++ +L+  ++EID D
Sbjct:     1 MADKLTEEQIS-EFKEAFSLFDKDGDG---TKELGTVMRSLGQNPTEAELQDMINEIDTD 56

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  LMA
Sbjct:    57 GNGTIDFPEFLTLMA 71

 Score = 105 (37.0 bits), Expect = 0.00026, P = 0.00026
 Identities = 19/63 (30%), Positives = 38/63 (60%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  + F +FDR   GYI A ++  +M  + +    +++ ++IR+ D DG G++ ++EF 
Sbjct:    81 EELIEAFRVFDRDGDGYISADELRHVMTNLGEKLTNEEVDEMIREADIDGDGQINYEEFV 140

Query:   330 ALV 338
              ++
Sbjct:   141 KMM 143

 Score = 100 (35.2 bits), Expect = 0.0031, P = 0.0031
 Identities = 28/102 (27%), Positives = 47/102 (46%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G  E         TV  ++ +   + EL++     D +GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGTKELG-------TVMRSLGQNPTEAELQDMINEIDTDGNGTIDFP 64

Query:   441 TLKALL-KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                 L+ +++ D  ++E+L  A    D DG G I  +E   +M
Sbjct:    65 EFLTLMARKLKDTDTEEELIEAFRVFDRDGDGYISADELRHVM 107

 Score = 85 (29.9 bits), Expect = 0.42, P = 0.34
 Identities = 30/110 (27%), Positives = 53/110 (48%), Frame = +3

Query:   105 EDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLRKLI 278
             +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L +  
Sbjct:    28 KELGTVMRSLGQNPTEAELQDMINEIDTDGNGTIDFPEFLTLMARKLKDTDTEEELIEAF 87

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             R FD DG G +  DE   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    88 RVFDRDGDGYISADE---LRHVMTNLGEKLT-NEEVDEMIREADIDGDGQIN 135


>sp|Q06827|CATR_SCHDU CALTRACTIN (CENTRIN) >pir||S42551 caltractin -
            Scherffelia dubia >gi|21209 (X69220) caltractin [Scherffelia dubia]
            Length = 168

  Plus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 2.1e-20, P = 2.1e-20
 Identities = 50/147 (34%), Positives = 92/147 (62%), Frame = +3

Query:   126 AEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSG 305
             A +   Q +E ++ FD+FD    G I A ++   M A+  +  +++++K+I   D DGSG
Sbjct:    19 AGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSG 78

Query:   306 KLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSD 485
              ++F+EF  ++   A   ++++ ++E+ +AFRLFD +  G IS   LK + KE+ ++++D
Sbjct:    79 TIDFEEFLQMM--TAKMGERDS-REEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTD 135

Query:   486 EQLEAAVDEIDEDGSGKIEFEEFWELM 566
             E+L+  +DE D DG G++  EEF+ +M
Sbjct:   136 EELQEMIDEADRDGDGEVNEEEFFRIM 162

 Score = 144 (50.7 bits), Expect = 3.6e-09, P = 3.6e-09
 Identities = 27/67 (40%), Positives = 45/67 (67%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+REAF LFD +G+G I    LK  ++ +  +   E+++  + +ID+DGSG I+F
Sbjct:    23 EEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDF 82

Query:   546 EEFWELM 566
             EEF ++M
Sbjct:    83 EEFLQMM 89

 Score = 98 (34.5 bits), Expect = 0.018, P = 0.018
 Identities = 28/99 (28%), Positives = 52/99 (52%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ +R+    FD DGSG ++  E    +  +     KE ++K + +     DK+G+G 
Sbjct:    24 EQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIAD----IDKDGSGT 79

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             I     L+ +  ++ +  S E++  A    D+D +GKI F+
Sbjct:    80 IDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDETGKISFK 120

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.72
 Identities = 16/59 (27%), Positives = 34/59 (57%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE  K F +FD  + G I    + ++   + ++  +++L+++I + D DG G++  +EF
Sbjct:   100 EEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEF 158


>gi|2589014 (AB008555) troponin C [Lampetra japonica]
            Length = 167

  Plus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 2.1e-20, P = 2.1e-20
 Identities = 48/151 (31%), Positives = 91/151 (60%), Frame = +3

Query:   126 AEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSG 305
             A ++  QI E++  FDMFD    G I  +++G++M  + Q+  +++L  +I + D DGSG
Sbjct:    15 AYLNEEQIAEFKAAFDMFDADGGGDISTSELGKVMKLLGQNPTKEELDAIIEEVDEDGSG 74

Query:   306 KLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSD 485
              ++F+EF  ++            ++EL EAFR+ D  G+GYI R  LK +L    ++++D
Sbjct:    75 TIDFEEFLVMMVRQMKEESAGQTEEELAEAFRILDTNGDGYIDRDELKDILLNTGENVTD 134

Query:   486 EQLEAAVDEIDEDGSGKIEFEEFWELMAGDA 578
              +++  + + D++  G+++F+EF ++M G A
Sbjct:   135 LEMDELMKDGDKNCDGRLDFDEFLKMMEGIA 165

 Score = 82 (28.9 bits), Expect = 1.6, P = 0.81
 Identities = 19/80 (23%), Positives = 41/80 (51%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  E  G   EE  + F + D    GYI   ++  I+    ++  + ++ +L++  D
Sbjct:    86 VRQMKEESAGQTEEELAEAFRILDTNGDGYIDRDELKDILLNTGENVTDLEMDELMKDGD 145

Query:   291 ADGSGKLEFDEFCALVYTVA 350
              +  G+L+FDEF  ++  +A
Sbjct:   146 KNCDGRLDFDEFLKMMEGIA 165


>gnl|PID|d1020515 (AB003079) fast skeletal troponin C beta [Xenopus laevis]
            Length = 163

  Plus Strand HSPs:

 Score = 245 (86.2 bits), Expect = 3.5e-20, P = 3.5e-20
 Identities = 50/156 (32%), Positives = 88/156 (56%), Frame = +3

Query:   105 EDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRK 284
             +D    L+E     I E++  FDMFD    G I   ++G +M  + Q   +++L  +I +
Sbjct:     9 QDARSFLSE---EMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEE 65

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE 464
              D DGSG ++F+EF  ++        +   ++EL E FR+FDK  +GYI    L  +L+ 
Sbjct:    66 VDEDGSGTIDFEEFLVMMVRQMKEDAQGKSEEELAECFRIFDKNADGYIDGEELAEILRS 125

Query:   465 IADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
               + ++DE++E  + + D++  GKI+F+EF ++M G
Sbjct:   126 SGESITDEEIEELMKDGDKNNDGKIDFDEFLKMMEG 161

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/67 (40%), Positives = 43/67 (64%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E +  E + AF +FD +G G IS   L  +++ +    + E+L+A ++E+DEDGSG I+F
Sbjct:    17 EEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDF 76

Query:   546 EEFWELM 566
             EEF  +M
Sbjct:    77 EEFLVMM 83

 Score = 110 (38.7 bits), Expect = 0.00031, P = 0.00031
 Identities = 18/76 (23%), Positives = 43/76 (56%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FD+   GYI   ++ +I+ +  +   ++++ +L++  D
Sbjct:    84 VRQMKEDAQGKSEEELAECFRIFDKNADGYIDGEELAEILRSSGESITDEEIEELMKDGD 143

Query:   291 ADGSGKLEFDEFCALV 338
              +  GK++FDEF  ++
Sbjct:   144 KNNDGKIDFDEFLKMM 159

 Score = 89 (31.3 bits), Expect = 0.21, P = 0.19
 Identities = 29/103 (28%), Positives = 48/103 (46%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL-- 458
             FD DG G +   E   ++  +  T  KE L   + E     D++G+G I       ++  
Sbjct:    30 FDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 85

Query:   459 --KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TIT 593
               KE A   S+E+L       D++  G I+ EE  E++    + +IT
Sbjct:    86 QMKEDAQGKSEEELAECFRIFDKNADGYIDGEELAEILRSSGE-SIT 131


>gi|666076 (X83765) centrin [Micromonas pusilla]
           Length = 148

  Plus Strand HSPs:

 Score = 245 (86.2 bits), Expect = 3.5e-20, P = 3.5e-20
 Identities = 49/141 (34%), Positives = 89/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q +E +  FD+FD    G I A ++   M A+  +  +++++K+I   D DGSG ++F+E
Sbjct:     5 QKQEIRXAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDFEE 64

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++   A   ++++ ++E+ +AFRLFD +  G IS   LK + KE+ ++++DE+L+  
Sbjct:    65 FLTMM--TAKMGERDS-REEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEM 121

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +DE D DG G++  EEF+ +M
Sbjct:   122 IDEADRDGDGEVNEEEFFRIM 142

 Score = 135 (47.5 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 26/67 (38%), Positives = 43/67 (64%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+R AF LFD +G+G I    LK  ++ +  +   E+++  + +ID+DGSG I+F
Sbjct:     3 EEQKQEIRXAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDF 62

Query:   546 EEFWELM 566
             EEF  +M
Sbjct:    63 EEFLTMM 69

 Score = 94 (33.1 bits), Expect = 0.028, P = 0.028
 Identities = 28/99 (28%), Positives = 50/99 (50%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ +R     FD DGSG ++  E    +  +     KE ++K + +     DK+G+G 
Sbjct:     4 EQKQEIRXAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIAD----IDKDGSGT 59

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             I     L  +  ++ +  S E++  A    D+D +GKI F+
Sbjct:    60 IDFEEFLTMMTAKMGERDSREEIMKAFRLFDDDETGKISFK 100

 Score = 83 (29.2 bits), Expect = 0.81, P = 0.56
 Identities = 16/59 (27%), Positives = 34/59 (57%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE  K F +FD  + G I    + ++   + ++  +++L+++I + D DG G++  +EF
Sbjct:    80 EEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEF 138


>gnl|PID|d1020514 (AB003078) fast skeletal troponin C alpha [Xenopus laevis]
            Length = 163

  Plus Strand HSPs:

 Score = 244 (85.9 bits), Expect = 4.5e-20, P = 4.5e-20
 Identities = 50/156 (32%), Positives = 88/156 (56%), Frame = +3

Query:   105 EDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRK 284
             +D    L+E     I E++  FDMFD    G I   ++G +M  + Q   +++L  +I +
Sbjct:     9 QDARSFLSE---EMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEE 65

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE 464
              D DGSG ++F+EF  ++        +   ++EL E FR+FDK  +GYI    L  +L+ 
Sbjct:    66 VDEDGSGTIDFEEFLVMMVRQMKEDAQGKSEEELAERFRIFDKNADGYIDGEELAEILRS 125

Query:   465 IADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
               + ++DE++E  + + D++  GKI+F+EF ++M G
Sbjct:   126 SGESITDEEIEELMKDGDKNNDGKIDFDEFLKMMEG 161

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/67 (40%), Positives = 43/67 (64%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E +  E + AF +FD +G G IS   L  +++ +    + E+L+A ++E+DEDGSG I+F
Sbjct:    17 EEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDF 76

Query:   546 EEFWELM 566
             EEF  +M
Sbjct:    77 EEFLVMM 83

 Score = 109 (38.4 bits), Expect = 0.00047, P = 0.00047
 Identities = 18/76 (23%), Positives = 43/76 (56%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FD+   GYI   ++ +I+ +  +   ++++ +L++  D
Sbjct:    84 VRQMKEDAQGKSEEELAERFRIFDKNADGYIDGEELAEILRSSGESITDEEIEELMKDGD 143

Query:   291 ADGSGKLEFDEFCALV 338
              +  GK++FDEF  ++
Sbjct:   144 KNNDGKIDFDEFLKMM 159

 Score = 88 (31.0 bits), Expect = 0.28, P = 0.24
 Identities = 29/103 (28%), Positives = 48/103 (46%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL-- 458
             FD DG G +   E   ++  +  T  KE L   + E     D++G+G I       ++  
Sbjct:    30 FDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 85

Query:   459 --KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TIT 593
               KE A   S+E+L       D++  G I+ EE  E++    + +IT
Sbjct:    86 QMKEDAQGKSEEELAERFRIFDKNADGYIDGEELAEILRSSGE-SIT 131


>prf||731112A troponin C [Oryctolagus cuniculus]
            Length = 158

  Plus Strand HSPs:

 Score = 244 (85.9 bits), Expect = 4.5e-20, P = 4.5e-20
 Identities = 48/152 (31%), Positives = 87/152 (57%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I + D D
Sbjct:     6 EARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDED 65

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             GSG ++F+EF  +V  +     K   ++EL E FR+FD+  +GYI    L  + +   + 
Sbjct:    66 GSGTIDFEEFLVMVRQMKEDA-KGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEH 124

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             ++DE++E+ + + D+D  G+I+F+EF ++M G
Sbjct:   125 VTDEEIESLMKDGDKDNDGRIDFDEFLKMMEG 156

 Score = 135 (47.5 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 26/63 (41%), Positives = 41/63 (65%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E +  E + AF +FD +G G IS   L  +++ +    + E+L+A ++E+DEDGSG I+F
Sbjct:    13 EEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDF 72

Query:   546 EEF 554
             EEF
Sbjct:    73 EEF 75

 Score = 116 (40.8 bits), Expect = 5.2e-06, P = 5.2e-06
 Identities = 21/76 (27%), Positives = 42/76 (55%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FDR   GYI A ++ +I  A  +   ++++  L++  D
Sbjct:    79 VRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGD 138

Query:   291 ADGSGKLEFDEFCALV 338
              D  G+++FDEF  ++
Sbjct:   139 KDNDGRIDFDEFLKMM 154

 Score = 95 (33.4 bits), Expect = 0.032, P = 0.032
 Identities = 26/99 (26%), Positives = 46/99 (46%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE 464
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I       ++++
Sbjct:    26 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMVRQ 81

Query:   465 IADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             + +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    82 MKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGE 123


>sp|P43646|CATR_TETST CALTRACTIN (CENTRIN)
            Length = 148

  Plus Strand HSPs:

 Score = 243 (85.5 bits), Expect = 5.7e-20, P = 5.7e-20
 Identities = 48/141 (34%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q ++ ++ FD+FD    G I A ++   M A+  +  +++++K+I   D DGSG ++F+E
Sbjct:     5 QKQDIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDFEE 64

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++   A   ++++ ++E+ +AFRLFD +  G IS   LK + KE+ ++++DE+L+  
Sbjct:    65 FLQMM--TAKMGERDS-REEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEM 121

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +DE D DG G++  EEF+ +M
Sbjct:   122 IDEADRDGDGEVNEEEFFRIM 142

 Score = 141 (49.6 bits), Expect = 7.8e-09, P = 7.8e-09
 Identities = 26/67 (38%), Positives = 45/67 (67%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++++REAF LFD +G+G I    LK  ++ +  +   E+++  + +ID+DGSG I+F
Sbjct:     3 EEQKQDIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDF 62

Query:   546 EEFWELM 566
             EEF ++M
Sbjct:    63 EEFLQMM 69

 Score = 98 (34.5 bits), Expect = 0.0077, P = 0.0077
 Identities = 28/99 (28%), Positives = 52/99 (52%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ +R+    FD DGSG ++  E    +  +     KE ++K + +     DK+G+G 
Sbjct:     4 EQKQDIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIAD----IDKDGSGT 59

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             I     L+ +  ++ +  S E++  A    D+D +GKI F+
Sbjct:    60 IDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDETGKISFK 100

 Score = 83 (29.2 bits), Expect = 0.81, P = 0.56
 Identities = 16/59 (27%), Positives = 34/59 (57%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE  K F +FD  + G I    + ++   + ++  +++L+++I + D DG G++  +EF
Sbjct:    80 EEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEF 138


>sp|P02589|TPCS_RANES TROPONIN C, SKELETAL MUSCLE >pir||TPFGCS troponin C,
            skeletal muscle - edible frog
            Length = 162

  Plus Strand HSPs:

 Score = 243 (85.5 bits), Expect = 5.7e-20, P = 5.7e-20
 Identities = 47/142 (33%), Positives = 83/142 (58%), Frame = +3

Query:   147 IEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             I E++  FDMFD    G I   ++G +M  + Q   +++L  +I + D DGSG ++F+EF
Sbjct:    19 IAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEF 78

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAV 506
               ++        +   ++EL E FR+FDK  +GYI    L  +L+   + ++DE++E  +
Sbjct:    79 LVMMVRQMKEDAQGKSEEELAECFRIFDKNADGYIDSEELGEILRSSGESITDEEIEELM 138

Query:   507 DEIDEDGSGKIEFEEFWELMAG 572
              + D++  GKI+F+EF ++M G
Sbjct:   139 KDGDKNNDGKIDFDEFLKMMEG 160

 Score = 140 (49.3 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 27/67 (40%), Positives = 43/67 (64%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E +  E + AF +FD +G G IS   L  +++ +    + E+L+A ++E+DEDGSG I+F
Sbjct:    16 EEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDF 75

Query:   546 EEFWELM 566
             EEF  +M
Sbjct:    76 EEFLVMM 82

 Score = 117 (41.2 bits), Expect = 1.2e-05, P = 1.2e-05
 Identities = 19/76 (25%), Positives = 45/76 (59%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FD+   GYI + ++G+I+ +  +   ++++ +L++  D
Sbjct:    83 VRQMKEDAQGKSEEELAECFRIFDKNADGYIDSEELGEILRSSGESITDEEIEELMKDGD 142

Query:   291 ADGSGKLEFDEFCALV 338
              +  GK++FDEF  ++
Sbjct:   143 KNNDGKIDFDEFLKMM 158

 Score = 91 (32.0 bits), Expect = 0.12, P = 0.11
 Identities = 29/103 (28%), Positives = 48/103 (46%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL-- 458
             FD DG G +   E   ++  +  T  KE L   + E     D++G+G I       ++  
Sbjct:    29 FDTDGGGDISTKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 84

Query:   459 --KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TIT 593
               KE A   S+E+L       D++  G I+ EE  E++    + +IT
Sbjct:    85 QMKEDAQGKSEEELAECFRIFDKNADGYIDSEELGEILRSSGE-SIT 130


>sp|P49258|CALL_DROME CALMODULIN RELATED PROTEIN 97A (ANDROCAM PROTEIN)
            >gi|452435 (X76045) calmodulin related [Drosophila melanogaster]
            >prf||2021248D calmodulin-related protein [Drosophila melanogaster]
            Length = 148

  Plus Strand HSPs:

 Score = 243 (85.5 bits), Expect = 5.7e-20, P = 5.7e-20
 Identities = 47/145 (32%), Positives = 88/145 (60%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGS 302
             ++E+   QI E++  F  FD+   G I   ++G +M  + Q+  E +L+ LI + + + +
Sbjct:     1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNN 60

Query:   303 GKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLS 482
             G+L F EFC ++       D E   +E+REAF++FD++G+G+IS   ++ ++  + + ++
Sbjct:    61 GQLNFTEFCGIMAKQMRETDTE---EEMREAFKIFDRDGDGFISPAEIRFVMINLGEKVT 117

Query:   483 DEQLEAAVDEIDEDGSGKIEFEEF-W 557
             DE+++  + E D DG G I +EEF W
Sbjct:   118 DEEIDEMIREADFDGDGMINYEEFVW 143

 Score = 109 (38.4 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 28/107 (26%), Positives = 55/107 (51%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             E +L+ L  +    +N +  F     IMA+ + E   E      EE ++ F +FDR   G
Sbjct:    45 EAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTE------EEMREAFKIFDRDGDG 98

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
             +I   +I  +M  + +   ++++ ++IR+ D DG G + ++EF  ++
Sbjct:    99 FISPAEIRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMI 145

 Score = 104 (36.6 bits), Expect = 0.00078, P = 0.00078
 Identities = 20/63 (31%), Positives = 38/63 (60%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E ++AF  FDKEG G I+   L  L++ +  + ++ +L+  + E + + +G++ F EF  
Sbjct:    11 EFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCG 70

Query:   561 LMA 569
             +MA
Sbjct:    71 IMA 73

 Score = 80 (28.2 bits), Expect = 1.9, P = 0.85
 Identities = 27/122 (22%), Positives = 55/122 (45%), Frame = +3

Query:    69 EFQFQHRQAIMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQ 245
             +F  +    I   ++  ++  +  +  E E Q      +    G +  T+   IM    +
Sbjct:    18 QFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMR 77

Query:   246 DFD-EKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGN 422
             + D E+++R+  + FD DG G +   E   ++  +   V  E + + +REA    D +G+
Sbjct:    78 ETDTEEEMREAFKIFDRDGDGFISPAEIRFVMINLGEKVTDEEIDEMIREA----DFDGD 133

Query:   423 GYIS 434
             G I+
Sbjct:   134 GMIN 137


>sp|P43645|CATR_SPESI CALTRACTIN (CENTRIN)
            Length = 148

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 7.3e-20, P = 7.3e-20
 Identities = 49/141 (34%), Positives = 90/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q +E ++ FD+FD    G I A ++   M A+  +  +++++K+I   D DGSG ++F+E
Sbjct:     5 QKQEXREAFDLFDTDGSGTIDAKELKVXMXALGFEPKKEEIQKMISDIDKDGSGTIDFEE 64

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++   A   ++++ ++E+ +AFRLFD +  G I+   LK + KE+ ++L+DE+++  
Sbjct:    65 FLQMM--TAKMGERDS-REEIMKAFRLFDDDQTGKITFKNLKRVAKELGENLTDEEIQEM 121

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +DE D DG G+I  EEF+ +M
Sbjct:   122 IDEADRDGDGEINEEEFFRIM 142

 Score = 141 (49.6 bits), Expect = 7.8e-09, P = 7.8e-09
 Identities = 27/67 (40%), Positives = 43/67 (64%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E REAF LFD +G+G I    LK  +  +  +   E+++  + +ID+DGSG I+F
Sbjct:     3 EEQKQEXREAFDLFDTDGSGTIDAKELKVXMXALGFEPKKEEIQKMISDIDKDGSGTIDF 62

Query:   546 EEFWELM 566
             EEF ++M
Sbjct:    63 EEFLQMM 69

 Score = 99 (34.8 bits), Expect = 0.0052, P = 0.0052
 Identities = 29/99 (29%), Positives = 51/99 (51%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ  R+    FD DGSG ++  E    +  +     KE +QK + +     DK+G+G 
Sbjct:     4 EQKQEXREAFDLFDTDGSGTIDAKELKVXMXALGFEPKKEEIQKMISD----IDKDGSGT 59

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             I     L+ +  ++ +  S E++  A    D+D +GKI F+
Sbjct:    60 IDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDQTGKITFK 100

 Score = 82 (28.9 bits), Expect = 1.1, P = 0.66
 Identities = 15/59 (25%), Positives = 34/59 (57%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE  K F +FD  + G I    + ++   + ++  +++++++I + D DG G++  +EF
Sbjct:    80 EEIMKAFRLFDDDQTGKITFKNLKRVAKELGENLTDEEIQEMIDEADRDGDGEINEEEF 138


>gnl|PID|e227640 (Z70034) C18E9.1 [Caenorhabditis elegans]
            Length = 258

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 7.3e-20, P = 7.3e-20
 Identities = 47/146 (32%), Positives = 90/146 (61%), Frame = +3

Query:   102 AEDIDEILAEIDG---SQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             ++  +E ++  DG    +I EY+  F +FD+   G I + ++G  M ++ Q+  E++L  
Sbjct:    16 SKQTNEPVSGFDGLNEEEIMEYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLD 75

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKA 452
             ++ + D DGSG ++F EFC ++      ++KE   + +REAFR+FD++GNG+I+    + 
Sbjct:    76 MVNEVDIDGSGTIDFGEFCQMM----KRMNKENDSEMIREAFRVFDRDGNGFITADEFRY 131

Query:   453 LLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
              +  + D  SD++++  + EID DG G++
Sbjct:   132 FMTHMGDQFSDQEVDEIIAEIDIDGDGQV 160

 Score = 139 (48.9 bits), Expect = 9.2e-07, P = 9.2e-07
 Identities = 27/62 (43%), Positives = 42/62 (67%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E + AFRLFDK+GNG IS   L   ++ +  + ++++L   V+E+D DGSG I+F EF +
Sbjct:    36 EYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLDMVNEVDIDGSGTIDFGEFCQ 95

Query:   561 LM 566
             +M
Sbjct:    96 MM 97

 Score = 86 (30.3 bits), Expect = 1.5, P = 0.78
 Identities = 29/96 (30%), Positives = 47/96 (48%), Frame = +3

Query:   159 QKFFDMF---DRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             Q+  DM    D    G I   +  Q+M  M ++ D + +R+  R FD DG+G +  DEF 
Sbjct:    71 QELLDMVNEVDIDGSGTIDFGEFCQMMKRMNKENDSEMIREAFRVFDRDGNGFITADEFR 130

Query:   330 ALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTL 446
                Y + +  D+ + Q E+ E     D +G+G +    L
Sbjct:   131 ---YFMTHMGDQFSDQ-EVDEIIAEIDIDGDGQVGNINL 165

 Score = 84 (29.6 bits), Expect = 2.6, P = 0.93
 Identities = 26/105 (24%), Positives = 46/105 (43%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + +   R FD DG+G +   E    +     ++ +   ++EL +     D +G+G I   
Sbjct:    36 EYKAAFRLFDKDGNGSISSKELGVAM----RSLGQNPTEQELLDMVNEVDIDGSGTIDFG 91

Query:   441 TLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA--GD 575
                 ++K +  +   E +  A    D DG+G I  +EF   M   GD
Sbjct:    92 EFCQMMKRMNKENDSEMIREAFRVFDRDGNGFITADEFRYFMTHMGD 138

 Score = 81 (28.5 bits), Expect = 5.7, P = 1.0
 Identities = 16/54 (29%), Positives = 30/54 (55%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKL 311
             E  ++ F +FDR   G+I A +    M  M   F ++++ ++I + D DG G++
Sbjct:   107 EMIREAFRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDIDGDGQV 160


>gi|1017791 (U37538) centrin [Xenopus laevis]
            Length = 172

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 7.3e-20, P = 7.3e-20
 Identities = 51/146 (34%), Positives = 87/146 (59%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   Q +E ++ FD+FD    G I   ++   M A+  +  +++++K+I   D +G+GK
Sbjct:    24 ELTEEQKQEIREAFDLFDTDGTGTIDVKELKVAMRALGFEPKKEEIKKMIADIDKEGTGK 83

Query:   309 LEFDEF-CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSD 485
             + F +F CA+   +A    KE    E+ +AFRLFD +  G IS   LK + KE+ ++L+D
Sbjct:    84 IAFSDFMCAMTQKMAEKDSKE----EIMKAFRLFDDDETGKISFKNLKRVAKELGENLTD 139

Query:   486 EQLEAAVDEIDEDGSGKIEFEEFWELM 566
             E+L+  +DE D DG G++  +EF  +M
Sbjct:   140 EELQEMIDEADRDGDGEVNEQEFLRIM 166

 Score = 123 (43.3 bits), Expect = 4.3e-06, P = 4.3e-06
 Identities = 25/70 (35%), Positives = 42/70 (60%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             V  T   E  ++E+REAF LFD +G G I    LK  ++ +  +   E+++  + +ID++
Sbjct:    20 VPKTELTEEQKQEIREAFDLFDTDGTGTIDVKELKVAMRALGFEPKKEEIKKMIADIDKE 79

Query:   525 GSGKIEFEEF 554
             G+GKI F +F
Sbjct:    80 GTGKIAFSDF 89

 Score = 105 (37.0 bits), Expect = 0.0025, P = 0.0025
 Identities = 29/99 (29%), Positives = 54/99 (54%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ +R+    FD DG+G ++  E    +  +     KE ++K + +     DKEG G 
Sbjct:    28 EQKQEIREAFDLFDTDGTGTIDVKELKVAMRALGFEPKKEEIKKMIAD----IDKEGTGK 83

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             I+    + A+ +++A+  S E++  A    D+D +GKI F+
Sbjct:    84 IAFSDFMCAMTQKMAEKDSKEEIMKAFRLFDDDETGKISFK 124

 Score = 87 (30.6 bits), Expect = 0.46, P = 0.37
 Identities = 29/105 (27%), Positives = 48/105 (45%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEK----QLRKLIRKFDADGSGKLEF 317
             EE +K     D+   G I        M AM Q   EK    ++ K  R FD D +GK+ F
Sbjct:    67 EEIKKMIADIDKEGTGKIA---FSDFMCAMTQKMAEKDSKEEIMKAFRLFDDDETGKISF 123

Query:   318 DEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE 464
                  +   +   +  E LQ+ + EA    D++G+G ++      ++K+
Sbjct:   124 KNLKRVAKELGENLTDEELQEMIDEA----DRDGDGEVNEQEFLRIMKK 168

 Score = 85 (29.9 bits), Expect = 0.78, P = 0.54
 Identities = 19/72 (26%), Positives = 39/72 (54%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGS 302
             +AE D    EE  K F +FD  + G I    + ++   + ++  +++L+++I + D DG 
Sbjct:    97 MAEKDSK--EEIMKAFRLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGD 154

Query:   303 GKLEFDEFCALV 338
             G++   EF  ++
Sbjct:   155 GEVNEQEFLRIM 166


>sp|Q12798|CAT2_HUMAN CALTRACTIN, ISOFORM 2 (CENTRIN) >gi|414993 (U03270)
            centrin [Homo sapiens]
            Length = 172

  Plus Strand HSPs:

 Score = 241 (84.8 bits), Expect = 9.3e-20, P = 9.3e-20
 Identities = 50/146 (34%), Positives = 91/146 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   Q +E ++ FD+FD    G I A ++   M A+  +  +++++K+I + D +G+GK
Sbjct:    24 ELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGK 83

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             + F++F A++       +K+T ++E+ +AFRLFD +  G IS   LK +  E+ ++L+DE
Sbjct:    84 ISFNDFLAVM--TQKMSEKDT-KEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE 140

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +L+  +DE D DG G++  EEF  +M
Sbjct:   141 ELQEMIDEADRDGDGEVNEEEFLRIM 166

 Score = 129 (45.4 bits), Expect = 1.8e-07, P = 1.8e-07
 Identities = 24/67 (35%), Positives = 42/67 (62%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+REAF LFD +G+G I    LK  ++ +  +   E+++  + E+D +G+GKI F
Sbjct:    27 EDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISF 86

Query:   546 EEFWELM 566
              +F  +M
Sbjct:    87 NDFLAVM 93

 Score = 106 (37.3 bits), Expect = 0.0019, P = 0.0019
 Identities = 30/99 (30%), Positives = 53/99 (53%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             D+KQ +R+    FD DGSG ++  E    +  +     KE ++K + E     D+EG G 
Sbjct:    28 DQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEV----DREGTGK 83

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             IS    L  + +++++  + E++  A    D+D +GKI F+
Sbjct:    84 ISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFK 124

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.65
 Identities = 16/63 (25%), Positives = 37/63 (58%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  K F +FD  + G I    + ++ + + ++  +++L+++I + D DG G++  +EF 
Sbjct:   104 EEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFL 163

Query:   330 ALV 338
              ++
Sbjct:   164 RIM 166


>sp|P02586|TPCS_RABIT TROPONIN C, SKELETAL MUSCLE >pir||TPRBCS troponin C, fast
            skeletal muscle - rabbit >gi|1755 (Y00760) troponin-C (AA 1-160)
            [Oryctolagus cuniculus] >gi|165747 (J03462) troponin C [Oryctolagus
            cuniculus]
            Length = 160

  Plus Strand HSPs:

 Score = 240 (84.5 bits), Expect = 1.2e-19, P = 1.2e-19
 Identities = 47/158 (29%), Positives = 88/158 (55%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M +   E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I
Sbjct:     1 MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++F+EF  ++        K   ++EL E FR+FD+  +GYI    L  + 
Sbjct:    61 EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIF 120

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++DE++E+ + + D++  G+I+F+EF ++M G
Sbjct:   121 RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG 158

 Score = 91 (32.0 bits), Expect = 0.11, P = 0.10
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    27 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 82

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    83 QMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGE 125


>sp|P02585|TPCS_HUMAN TROPONIN C, SKELETAL MUSCLE >pir||TPHUCS troponin C, fast
            skeletal muscle - human >gi|36729 (X07898) troponin C (AA 1-160)
            [Homo sapiens] >gi|339736 (M33772) fast skeletal muscle troponin C
            [Homo sapiens]
            Length = 160

  Plus Strand HSPs:

 Score = 239 (84.1 bits), Expect = 1.5e-19, P = 1.5e-19
 Identities = 47/158 (29%), Positives = 88/158 (55%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M +   E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I
Sbjct:     1 MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++F+EF  ++        K   ++EL E FR+FD+  +GYI    L  + 
Sbjct:    61 EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF 120

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++DE++E+ + + D++  G+I+F+EF ++M G
Sbjct:   121 RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG 158

 Score = 89 (31.3 bits), Expect = 0.20, P = 0.18
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    27 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 82

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    83 QMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGE 125


>sp|P80322|TPC_BRALA TROPONIN C >pir||S43240 troponin C - common lancelet
            >bbs|146922 troponin C, TnC [Branchiostoma lanceolatum=amphioxus,
            Peptide, 163 aa]
            Length = 163

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 48/142 (33%), Positives = 83/142 (58%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E++  FDMFD    G I   ++G IM  +      ++L+++I + D D SG ++F+E
Sbjct:    15 QISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMIDEVDEDASGTIDFEE 74

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIA-DDLSDEQLEA 500
             F  ++       ++E    ELR AFR+ DK G+G+I +   +AL  E A DDL+D++L  
Sbjct:    75 FLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALASECAGDDLTDDELLE 134

Query:   501 AVDEIDEDGSGKIEFEEFWELM 566
              + + D +  G+ ++EE+ E++
Sbjct:   135 FMMDYDGNRDGRFDYEEWKEII 156

 Score = 165 (58.1 bits), Expect = 1.2e-11, P = 1.2e-11
 Identities = 33/77 (42%), Positives = 48/77 (62%), Frame = +3

Query:   339 YTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEID 518
             Y  A  + KE    E + AF +FD++G G IS   L  ++K +   +S E+L+  +DE+D
Sbjct:     4 YVKARVMFKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMIDEVD 63

Query:   519 EDGSGKIEFEEFWELMA 569
             ED SG I+FEEF E+MA
Sbjct:    64 EDASGTIDFEEFLEMMA 80

 Score = 105 (37.0 bits), Expect = 0.0017, P = 0.0017
 Identities = 33/128 (25%), Positives = 65/128 (50%), Frame = +3

Query:   249 FDEKQLRKL---IRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             F E+Q+ +       FD DG G +   E   ++  +  ++ +E LQ+ + E     D++ 
Sbjct:    11 FKEEQISEFKMAFDMFDEDGGGDISTKELGTIMKRLGMSISREELQQMIDEV----DEDA 66

Query:   420 NGYIS-RPTLKALLKEIAD---DLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*T 587
             +G I     L+ + + + D   ++ D++L AA   +D++G G I+ +EF  L +  A   
Sbjct:    67 SGTIDFEEFLEMMARAMQDSEREIPDDELRAAFRVLDKNGDGFIDKDEFRALASECAGDD 126

Query:   588 ITVDNF*PFFLN 623
             +T D    F ++
Sbjct:   127 LTDDELLEFMMD 138


>prf||0408496A troponin C [Oryctolagus cuniculus]
            Length = 159

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 46/152 (30%), Positives = 86/152 (56%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I + D D
Sbjct:     6 EARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDED 65

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             GSG ++F+EF  ++        K   ++EL E FR+FD+  +GYI    L  + +   + 
Sbjct:    66 GSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEH 125

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             ++DE++E+ + + D++  G+I+F+EF ++M G
Sbjct:   126 VTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG 157

 Score = 111 (39.1 bits), Expect = 0.00015, P = 0.00015
 Identities = 20/76 (26%), Positives = 42/76 (55%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FDR   GYI A ++ +I  A  +   ++++  L++  D
Sbjct:    80 VRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGD 139

Query:   291 ADGSGKLEFDEFCALV 338
              +  G+++FDEF  ++
Sbjct:   140 KNNDGRIDFDEFLKMM 155

 Score = 91 (32.0 bits), Expect = 0.11, P = 0.10
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    26 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 81

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    82 QMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGE 124


>sp|P09860|TPCC_CHICK TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES (TN-C)
            >pir||A27204 troponin C, cardiac and slow skeletal muscle - chicken
            >gi|211400 (M16024) slow muscle troponin C [Gallus gallus]
            >gnl|PID|d1002869 (D13037) cardiac troponin C [Gallus gallus]
            Length = 161

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 48/158 (30%), Positives = 92/158 (58%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDRGKQ-GYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F  G + G I   ++G++M  + Q+   ++L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMI 61

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FDEF  ++        K   ++EL + FR+FDK  +GYI    LK +L
Sbjct:    62 DEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIML 121

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + D++  G+I+++EF E M G
Sbjct:   122 QATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKG 159

 Score = 95 (33.4 bits), Expect = 0.035, P = 0.035
 Identities = 18/63 (28%), Positives = 33/63 (52%), Frame = +3

Query:   138 GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEF 317
             G   EE    F MFD+   GYI   ++  ++ A  +   E  + +L++  D +  G++++
Sbjct:    91 GKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDY 150

Query:   318 DEF 326
             DEF
Sbjct:   151 DEF 153


>gi|1220372 (M22307) troponin C [Homo sapiens]
            Length = 160

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 47/158 (29%), Positives = 88/158 (55%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M +   E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I
Sbjct:     1 MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++F+EF  ++        K   ++EL E FR+FD+  +GYI    L  + 
Sbjct:    61 EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPGELAEIF 120

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++DE++E+ + + D++  G+I+F+EF ++M G
Sbjct:   121 RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG 158

 Score = 82 (28.9 bits), Expect = 1.4, P = 0.76
 Identities = 26/99 (26%), Positives = 46/99 (46%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    27 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 82

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+  E  E+     +
Sbjct:    83 QMKEDAKGKSEEELAECFRIFDRNADGYIDPGELAEIFRASGE 125


>pdb|5TNC|  Troponin-C
            Length = 162

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 48/160 (30%), Positives = 89/160 (55%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             A M +   E  A +    I E++  FDMFD    G I   ++G +M  + Q+  +++L  
Sbjct:     1 ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDA 60

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKA 452
             +I + D DGSG ++F+EF  ++        K   ++EL + FR+FDK  +G+I    L  
Sbjct:    61 IIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELEDCFRIFDKNADGFIDIEELGE 120

Query:   453 LLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +L+   + +++E +E  + + D++  G+I+F+EF ++M G
Sbjct:   121 ILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEG 160


>pdb|1TNC|  Troponin (Calcium-Binding Component) (Theoretical Model)
            Length = 146

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 45/142 (31%), Positives = 83/142 (58%), Frame = +3

Query:   147 IEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             I E++  FDMFD    G I   ++G +M  + Q   +++L  +I + D DGSG ++F+EF
Sbjct:     3 IAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEF 62

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAV 506
               ++        K   ++EL E FR+FD+  +GYI    L  + +   + ++DE++E+ +
Sbjct:    63 LVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLM 122

Query:   507 DEIDEDGSGKIEFEEFWELMAG 572
              + D++  G+I+F+EF ++M G
Sbjct:   123 KDGDKNNDGRIDFDEFLKMMEG 144

 Score = 111 (39.1 bits), Expect = 1.9e-05, P = 1.9e-05
 Identities = 20/76 (26%), Positives = 42/76 (55%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FDR   GYI A ++ +I  A  +   ++++  L++  D
Sbjct:    67 VRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGD 126

Query:   291 ADGSGKLEFDEFCALV 338
              +  G+++FDEF  ++
Sbjct:   127 KNNDGRIDFDEFLKMM 142

 Score = 91 (32.0 bits), Expect = 0.067, P = 0.065
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    13 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 68

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    69 QMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGE 111


>sp|P19123|TPCC_MOUSE TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES (TN-C)
            >pir||A32620 troponin C, cardiac muscle - mouse >gi|309201 (M29793)
            slow/cardiac troponin C [Mus musculus] >gi|387137 (J04971)
            slow/cardiac troponin C [Mus musculus]
            Length = 161

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 48/158 (30%), Positives = 92/158 (58%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDRGKQ-GYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F  G + G I   ++G++M  + Q+   ++L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMI 61

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FDEF  ++        K   ++EL + FR+FDK  +GYI    LK +L
Sbjct:    62 DEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMML 121

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + D++  G+I+++EF E M G
Sbjct:   122 QATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKG 159

 Score = 99 (34.8 bits), Expect = 0.010, P = 0.010
 Identities = 18/63 (28%), Positives = 33/63 (52%), Frame = +3

Query:   138 GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEF 317
             G   EE    F MFD+   GYI   ++  ++ A  +   E  + +L++  D +  G++++
Sbjct:    91 GKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEELMKDGDKNNDGRIDY 150

Query:   318 DEF 326
             DEF
Sbjct:   151 DEF 153


>sp|P02591|TPCC_RABIT TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES (TN-C)
            >pir||TPRBCW troponin C, cardiac and slow skeletal muscle - rabbit
            >pir||TPHUCC troponin C, cardiac and slow skeletal muscle - human
            >gi|37208 (X07897) troponin C (AA 1-161) [Homo sapiens] >gi|339946
            (M37984) slow twitch skeletal/cardiac muscle troponin C [Homo
            sapiens]
            Length = 161

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 48/158 (30%), Positives = 92/158 (58%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDRGKQ-GYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F  G + G I   ++G++M  + Q+   ++L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMI 61

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FDEF  ++        K   ++EL + FR+FDK  +GYI    LK +L
Sbjct:    62 DEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIML 121

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + D++  G+I+++EF E M G
Sbjct:   122 QATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKG 159

 Score = 96 (33.8 bits), Expect = 0.026, P = 0.025
 Identities = 18/63 (28%), Positives = 33/63 (52%), Frame = +3

Query:   138 GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEF 317
             G   EE    F MFD+   GYI   ++  ++ A  +   E  + +L++  D +  G++++
Sbjct:    91 GKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDY 150

Query:   318 DEF 326
             DEF
Sbjct:   151 DEF 153


>sp|P02590|TPCC_HUMAN TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES (TN-C)
            >pir||TPBOCC troponin C, cardiac muscle - bovine >pir||JU0035
            troponin C, cardiac muscle - pig >prf||750650A troponin c,cardiac
            [Bos taurus] >prf||1510257A troponin C [Sus scrofa domestica]
            Length = 161

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 48/158 (30%), Positives = 92/158 (58%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDRGKQ-GYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F  G + G I   ++G++M  + Q+   ++L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMI 61

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FDEF  ++        K   ++EL + FR+FDK  +GYI    LK +L
Sbjct:    62 DEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIML 121

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + D++  G+I+++EF E M G
Sbjct:   122 QATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKG 159

 Score = 96 (33.8 bits), Expect = 0.026, P = 0.025
 Identities = 18/63 (28%), Positives = 33/63 (52%), Frame = +3

Query:   138 GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEF 317
             G   EE    F MFD+   GYI   ++  ++ A  +   E  + +L++  D +  G++++
Sbjct:    91 GKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDY 150

Query:   318 DEF 326
             DEF
Sbjct:   151 DEF 153


>gi|508526 (L31642) calmodulin [Mus musculus]
           Length = 131

  Plus Strand HSPs:

 Score = 236 (83.1 bits), Expect = 3.1e-19, P = 3.1e-19
 Identities = 44/130 (33%), Positives = 80/130 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS    + ++  + + L+DE
Sbjct:    64 IDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAXXRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEID 518
             +++  + E D
Sbjct:   121 EVDEMIREAD 130

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLTMMA 74

 Score = 101 (35.6 bits), Expect = 0.00024, P = 0.00024
 Identities = 29/101 (28%), Positives = 51/101 (50%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I
Sbjct:    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYI 101


>sp|P54213|CATR_DUNSA CALTRACTIN (CENTRIN) >gi|1293682 (U53812) caltractin-like
            protein [Dunaliella salina]
            Length = 169

  Plus Strand HSPs:

 Score = 236 (83.1 bits), Expect = 3.1e-19, P = 3.1e-19
 Identities = 49/161 (30%), Positives = 97/161 (60%), Frame = +3

Query:    84 HRQAIMAEDIDEILAEIDG---SQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD 254
             +R+ +++   D+    + G    Q +E ++ FD+FD    G I A ++   M A+  +  
Sbjct:     3 YRKTVVSARRDQKKGRVGGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPK 62

Query:   255 EKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +++++K+I   D  GSG ++F+EF  ++ +     D    ++E+ +AF+LFD +  G+I+
Sbjct:    63 KEEIKKMIADIDKAGSGTIDFEEFLQMMTSKMGERDS---REEIIKAFKLFDDDNTGFIT 119

Query:   435 RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                LK + KE+ ++L+DE+L+   DE D +G G+I+ +EF+ +M
Sbjct:   120 LKNLKRVAKELGENLTDEELQEMTDEADRNGDGQIDEDEFYRIM 163

 Score = 136 (47.9 bits), Expect = 2.9e-08, P = 2.9e-08
 Identities = 26/67 (38%), Positives = 44/67 (65%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+REAF LFD +G+G I    LK  ++ +  +   E+++  + +ID+ GSG I+F
Sbjct:    24 EEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIADIDKAGSGTIDF 83

Query:   546 EEFWELM 566
             EEF ++M
Sbjct:    84 EEFLQMM 90

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.73
 Identities = 15/59 (25%), Positives = 34/59 (57%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE  K F +FD    G+I    + ++   + ++  +++L+++  + D +G G+++ DEF
Sbjct:   101 EEIIKAFKLFDDDNTGFITLKNLKRVAKELGENLTDEELQEMTDEADRNGDGQIDEDEF 159

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.73
 Identities = 26/96 (27%), Positives = 48/96 (50%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ +R+    FD DGSG ++  E    +  +     KE ++K + +     DK G+G 
Sbjct:    25 EQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMIAD----IDKAGSGT 80

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             I     L+ +  ++ +  S E++  A    D+D +G I
Sbjct:    81 IDFEEFLQMMTSKMGERDSREEIIKAFKLFDDDNTGFI 118


>sp|P23286|CALM_CANAL CALMODULIN
            Length = 149

  Plus Strand HSPs:

 Score = 236 (83.1 bits), Expect = 3.1e-19, P = 3.1e-19
 Identities = 48/149 (32%), Positives = 84/149 (56%), Frame = +3

Query:   123 LAE-IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             +AE +   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L  +I + D + 
Sbjct:     1 MAEKLSEQQIAEFKEAFSLFDKDSDGKITTKELGTVMRSLGQNPSESELTDMINEVDVNS 60

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
              G ++F EF  ++       D E    E+ EAF++FD+ G+G IS   L+ LL  I + L
Sbjct:    61 DGSIDFPEFLTMMARKMKDTDSEA---EIAEAFKVFDRNGDGKISAAELRHLLTSIGEKL 117

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
             SD  ++  + E D +  G+I+ +EF  L+A
Sbjct:   118 SDADVDQMIKEADTNNDGEIDIQEFTSLLA 147

 Score = 119 (41.9 bits), Expect = 2.4e-06, P = 2.4e-06
 Identities = 22/63 (34%), Positives = 39/63 (61%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+ +G I+   L  +++ +  + S+ +L   ++E+D +  G I+F EF  
Sbjct:    12 EFKEAFSLFDKDSDGKITTKELGTVMRSLGQNPSESELTDMINEVDVNSDGSIDFPEFLT 71

Query:   561 LMA 569
             +MA
Sbjct:    72 MMA 74

 Score = 81 (28.5 bits), Expect = 1.5, P = 0.78
 Identities = 14/62 (22%), Positives = 35/62 (56%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E  + F +FDR   G I A ++  ++ ++ +   +  + ++I++ D +  G+++  EF +
Sbjct:    85 EIAEAFKVFDRNGDGKISAAELRHLLTSIGEKLSDADVDQMIKEADTNNDGEIDIQEFTS 144

Query:   333 LV 338
             L+
Sbjct:   145 LL 146


>sp|P20801|TPCS_MOUSE TROPONIN C, SKELETAL MUSCLE (STNC) >pir||A38383 troponin
            C, fast skeletal muscle - mouse >gi|193356 (M57590) fast skeletal
            muscle troponin C [Mus musculus]
            Length = 160

  Plus Strand HSPs:

 Score = 236 (83.1 bits), Expect = 3.1e-19, P = 3.1e-19
 Identities = 46/158 (29%), Positives = 88/158 (55%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M +   E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I
Sbjct:     1 MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++F+EF  ++        K   ++EL E FR+FD+  +GYI    L  + 
Sbjct:    61 EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIF 120

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + +++E++E+ + + D++  G+I+F+EF ++M G
Sbjct:   121 RASGEHVTEEEIESLMKDGDKNNDGRIDFDEFLKMMEG 158

 Score = 91 (32.0 bits), Expect = 0.11, P = 0.10
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    27 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 82

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    83 QMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGE 125


>sp|P41209|CATR_MOUSE CALTRACTIN (CENTRIN) >pir||S38531 caltractin - mouse
            >gnl|PID|d1004322 (D16301) caltractin [Mus musculus]
            Length = 172

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.0e-19, P = 4.0e-19
 Identities = 48/146 (32%), Positives = 89/146 (60%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   Q +E ++ FD+FD    G I   ++   M A+  +  +++++K+I + D + +GK
Sbjct:    24 ELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGK 83

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             + F++F A++       +K+T ++E+ +AFRLFD +  G IS   LK +  E+ + L+DE
Sbjct:    84 ISFNDFLAVM--TQKMAEKDT-KEEILKAFRLFDDDETGKISFKNLKRVANELGESLTDE 140

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +L+  +DE D DG G++  EEF ++M
Sbjct:   141 ELQEMIDEADRDGDGEVNEEEFLKIM 166

 Score = 124 (43.7 bits), Expect = 2.0e-06, P = 2.0e-06
 Identities = 23/67 (34%), Positives = 42/67 (62%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+REAF LFD +G+G I    LK  ++ +  +   E+++  + E+D++ +GKI F
Sbjct:    27 EDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGKISF 86

Query:   546 EEFWELM 566
              +F  +M
Sbjct:    87 NDFLAVM 93

 Score = 108 (38.0 bits), Expect = 0.0010, P = 0.0010
 Identities = 31/99 (31%), Positives = 53/99 (53%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             D+KQ +R+    FD+DGSG ++  E    +  +     KE ++K + E     DKE  G 
Sbjct:    28 DQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEV----DKEATGK 83

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             IS    L  + +++A+  + E++  A    D+D +GKI F+
Sbjct:    84 ISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGKISFK 124

 Score = 92 (32.4 bits), Expect = 0.11, P = 0.11
 Identities = 27/105 (25%), Positives = 48/105 (45%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQ-LRKLIRKFDADGSGKLEFDEF 326
             EE +K     D+   G I       +M     + D K+ + K  R FD D +GK+ F   
Sbjct:    67 EEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGKISFKN- 125

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE 464
                +  VAN + +    +EL+E     D++G+G ++      ++K+
Sbjct:   126 ---LKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKK 168

 Score = 87 (30.6 bits), Expect = 0.46, P = 0.37
 Identities = 23/107 (21%), Positives = 56/107 (52%), Frame = +3

Query:    18 EQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQG 197
             +++++K+ +++      +  F    A+M +     +AE D    EE  K F +FD  + G
Sbjct:    66 KEEMKKMISEVDKEATGKISFNDFLAVMTQK----MAEKDTK--EEILKAFRLFDDDETG 119

Query:   198 YIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
              I    + ++ + + +   +++L+++I + D DG G++  +EF  ++
Sbjct:   120 KISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIM 166


>pir||TPPGCS troponin C, skeletal muscle - pig
            Length = 159

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.0e-19, P = 4.0e-19
 Identities = 46/152 (30%), Positives = 86/152 (56%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I + D D
Sbjct:     6 EARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDED 65

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             GSG ++F+EF  ++        K   ++EL E FR+FD+  +GYI    L  + +   + 
Sbjct:    66 GSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNMDGYIDAEELAEIFRASGEH 125

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             ++DE++E+ + + D++  G+I+F+EF ++M G
Sbjct:   126 VTDEEIESIMKDGDKNNDGRIDFDEFLKMMEG 157

 Score = 109 (38.4 bits), Expect = 0.00034, P = 0.00034
 Identities = 19/76 (25%), Positives = 42/76 (55%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FDR   GYI A ++ +I  A  +   ++++  +++  D
Sbjct:    80 VRQMKEDAKGKSEEELAECFRIFDRNMDGYIDAEELAEIFRASGEHVTDEEIESIMKDGD 139

Query:   291 ADGSGKLEFDEFCALV 338
              +  G+++FDEF  ++
Sbjct:   140 KNNDGRIDFDEFLKMM 155

 Score = 88 (31.0 bits), Expect = 0.25, P = 0.22
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    26 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 81

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    82 QMKEDAKGKSEEELAECFRIFDRNMDGYIDAEELAEIFRASGE 124


>sp|P02587|TPCS_PIG TROPONIN C, SKELETAL MUSCLE
            Length = 159

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.0e-19, P = 4.0e-19
 Identities = 46/152 (30%), Positives = 86/152 (56%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             E  + +    I E++  FDMFD    G I   ++G +M  + Q   +++L  +I + D D
Sbjct:     6 EARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDED 65

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             GSG ++F+EF  ++        K   ++EL E FR+FD+  +GYI    L  + +   + 
Sbjct:    66 GSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNMDGYIDAEELAEIFRASGEH 125

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             ++DE++E+ + + D++  G+I+F+EF ++M G
Sbjct:   126 VTDEEIESIMKDGDKNNDGRIDFDEFLKMMEG 157

 Score = 109 (38.4 bits), Expect = 0.00034, P = 0.00034
 Identities = 19/76 (25%), Positives = 42/76 (55%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE  + F +FDR   GYI A ++ +I  A  +   ++++  +++  D
Sbjct:    80 VRQMKEDAKGKSEEELAECFRIFDRNMDGYIDAEELAEIFRASGEHVTDEEIESIMKDGD 139

Query:   291 ADGSGKLEFDEFCALV 338
              +  G+++FDEF  ++
Sbjct:   140 KNNDGRIDFDEFLKMM 155

 Score = 88 (31.0 bits), Expect = 0.25, P = 0.22
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +  T  KE L   + E     D++G+G I     L  +++
Sbjct:    26 FDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 81

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D +  G I+ EE  E+     +
Sbjct:    82 QMKEDAKGKSEEELAECFRIFDRNMDGYIDAEELAEIFRASGE 124


>pdb|1TOP|  Troponin C >pdb|1NCY|  Troponin-C, Complex With Manganese Muscle
            Protein, Calcium-Binding Protein Mol_id: 1; Molecule: Troponin C;
            Chain: Null >pdb|1NCX|  Troponin C Muscle Protein, Calcium-Binding
            Protein, Duplication Mol_id: 1; Molecule: Troponin C; Chain: Null
            >pdb|1NCZ|  Troponin C Muscle Protein, Calcium-Binding Protein,
            Duplication Mol_id: 1; Molecule: Troponin C; Chain: Null
            Length = 162

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.0e-19, P = 4.0e-19
 Identities = 48/160 (30%), Positives = 88/160 (55%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             A M +   E  A +    I E++  FDMFD    G I   ++G +M  + Q+  +++L  
Sbjct:     1 ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDA 60

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKA 452
             +I + D DGSG ++F+EF  ++        K   ++EL   FR+FDK  +G+I    L  
Sbjct:    61 IIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGE 120

Query:   453 LLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +L+   + +++E +E  + + D++  G+I+F+EF ++M G
Sbjct:   121 ILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEG 160


>sp|P10246|TPCS_MELGA TROPONIN C, SKELETAL MUSCLE >pir||A40803 troponin C,
            skeletal muscle - turkey >bbs|51382 troponin C [turkeys, muscle,
            Peptide Partial, 162 aa]
            Length = 162

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.0e-19, P = 4.0e-19
 Identities = 47/158 (29%), Positives = 88/158 (55%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             M +   E  A +    I E++  FDMFD    G I   ++G +M  + Q+  +++L  +I
Sbjct:     3 MTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAII 62

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++F+EF  ++        K   ++EL   FR+FDK  +G+I    L  +L
Sbjct:    63 EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEIL 122

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + +++E++E  + + D++  G+I+F+EF ++M G
Sbjct:   123 RATGEHVTEEEIEDLMKDSDKNNDGRIDFDEFLKMMEG 160


>sp|P02588|TPCS_CHICK TROPONIN C, SKELETAL MUSCLE >pir||TPCHCS troponin C,
            skeletal muscle - chicken
            Length = 163

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.0e-19, P = 4.0e-19
 Identities = 48/160 (30%), Positives = 88/160 (55%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             A M +   E  A +    I E++  FDMFD    G I   ++G +M  + Q+  +++L  
Sbjct:     2 ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDA 61

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKA 452
             +I + D DGSG ++F+EF  ++        K   ++EL   FR+FDK  +G+I    L  
Sbjct:    62 IIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGE 121

Query:   453 LLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +L+   + +++E +E  + + D++  G+I+F+EF ++M G
Sbjct:   122 ILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEG 161


>gi|665656 (X83766) centrin [Pterosperma cristatum]
           Length = 133

  Plus Strand HSPs:

 Score = 234 (82.4 bits), Expect = 5.1e-19, P = 5.1e-19
 Identities = 47/132 (35%), Positives = 84/132 (63%), Frame = +3

Query:   168 FDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             FD+FD    G I A ++   M A+  +  +++++K+I   D DGSG ++F+EF  ++   
Sbjct:     5 FDLFDTDGSGTIDAKELKVPMRALGFEPKKEEIKKMIADIDKDGSGTIDFEEFLQMM--T 62

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
             A   ++++ ++E+ +AFRLFD +  G IS   LK + KE+ +++SDE+L+  +DE D DG
Sbjct:    63 AKMGERDS-REEIMKAFRLFDDDETGKISFKNLKRVAKELGENMSDEELQEMIDEADRDG 121

Query:   528 SGKIEFEEFWEL 563
              G++  EEF+ +
Sbjct:   122 DGEVNEEEFFRI 133

 Score = 133 (46.8 bits), Expect = 6.4e-08, P = 6.4e-08
 Identities = 25/61 (40%), Positives = 41/61 (67%), Frame = +3

Query:   384 LREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWEL 563
             +REAF LFD +G+G I    LK  ++ +  +   E+++  + +ID+DGSG I+FEEF ++
Sbjct:     1 IREAFDLFDTDGSGTIDAKELKVPMRALGFEPKKEEIKKMIADIDKDGSGTIDFEEFLQM 60

Query:   564 M 566
             M
Sbjct:    61 M 61

 Score = 91 (32.0 bits), Expect = 0.027, P = 0.027
 Identities = 26/95 (27%), Positives = 48/95 (50%), Frame = +3

Query:   264 LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RP 440
             +R+    FD DGSG ++  E    +  +     KE ++K + +     DK+G+G I    
Sbjct:     1 IREAFDLFDTDGSGTIDAKELKVPMRALGFEPKKEEIKKMIAD----IDKDGSGTIDFEE 56

Query:   441 TLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
              L+ +  ++ +  S E++  A    D+D +GKI F+
Sbjct:    57 FLQMMTAKMGERDSREEIMKAFRLFDDDETGKISFK 92

 Score = 90 (31.7 bits), Expect = 0.043, P = 0.042
 Identities = 26/95 (27%), Positives = 46/95 (48%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQ-LRKLIRKFDADGSGKLEFDEF 326
             EE +K     D+   G I   +  Q+M A   + D ++ + K  R FD D +GK+ F   
Sbjct:    35 EEIKKMIADIDKDGSGTIDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDETGKISFKNL 94

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
               +   +   +  E LQ+ + EA    D++G+G ++
Sbjct:    95 KRVAKELGENMSDEELQEMIDEA----DRDGDGEVN 126

 Score = 84 (29.6 bits), Expect = 0.34, P = 0.29
 Identities = 16/59 (27%), Positives = 34/59 (57%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE  K F +FD  + G I    + ++   + ++  +++L+++I + D DG G++  +EF
Sbjct:    72 EEIMKAFRLFDDDETGKISFKNLKRVAKELGENMSDEELQEMIDEADRDGDGEVNEEEF 130


>sp|P41208|CAT1_HUMAN CALTRACTIN, ISOFORM 1 (CENTRIN) >pir||A49652 caltractin -
            human >gi|454248 (X72964) caltractin [Homo sapiens]
            Length = 172

  Plus Strand HSPs:

 Score = 234 (82.4 bits), Expect = 5.1e-19, P = 5.1e-19
 Identities = 48/146 (32%), Positives = 88/146 (60%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   Q +E ++ FD+FD    G I   ++   M A+  +  +++++K+I + D +G+GK
Sbjct:    24 ELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGK 83

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             + F +F  L        +K+T ++E+ +AF+LFD +  G IS   LK + KE+ ++L+DE
Sbjct:    84 MNFGDF--LTVMTQKMSEKDT-KEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE 140

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +L+  +DE D DG G++  +EF  +M
Sbjct:   141 ELQEMIDEADRDGDGEVSEQEFLRIM 166

 Score = 126 (44.4 bits), Expect = 3.9e-07, P = 3.9e-07
 Identities = 24/67 (35%), Positives = 42/67 (62%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+REAF LFD +G G I    LK  ++ +  +   E+++  + EID++G+GK+ F
Sbjct:    27 EEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNF 86

Query:   546 EEFWELM 566
              +F  +M
Sbjct:    87 GDFLTVM 93

 Score = 102 (35.9 bits), Expect = 0.0061, P = 0.0061
 Identities = 28/99 (28%), Positives = 54/99 (54%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ +R+    FDADG+G ++  E    +  +     KE ++K + E     DKEG G 
Sbjct:    28 EQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISE----IDKEGTGK 83

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
             ++    L  + +++++  + E++  A    D+D +GKI F+
Sbjct:    84 MNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFK 124

 Score = 81 (28.5 bits), Expect = 2.4, P = 0.91
 Identities = 16/63 (25%), Positives = 35/63 (55%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  K F +FD  + G I    + ++   + ++  +++L+++I + D DG G++   EF 
Sbjct:   104 EEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFL 163

Query:   330 ALV 338
              ++
Sbjct:   164 RIM 166


>pir||MCCKA calmodulin - yeast (Candida albicans) >gi|170839 (M61128)
            calmodulin [Candida albicans]
            Length = 149

  Plus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 48/149 (32%), Positives = 84/149 (56%), Frame = +3

Query:   123 LAE-IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADG 299
             +AE +   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L  +I + D + 
Sbjct:     1 MAEKLSEQQIAEFKEAFSLFDKDSDGKITTKELGTVMRSLGQNPSESELTDMINEVDVNS 60

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
              G ++F EF  ++       D E    E+ EAF++FD+ G+G IS   L+ LL  I + L
Sbjct:    61 DGSIDFPEFLTMMARKMKDTDSEA---EIAEAFKVFDRNGDGKISAAELRHLLTSIGEKL 117

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
             SD  ++  + E D +  G+I+ +EF  L+A
Sbjct:   118 SDADVDQMIKEADTNNDGEIDIQEFTLLLA 147

 Score = 119 (41.9 bits), Expect = 2.4e-06, P = 2.4e-06
 Identities = 22/63 (34%), Positives = 39/63 (61%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+ +G I+   L  +++ +  + S+ +L   ++E+D +  G I+F EF  
Sbjct:    12 EFKEAFSLFDKDSDGKITTKELGTVMRSLGQNPSESELTDMINEVDVNSDGSIDFPEFLT 71

Query:   561 LMA 569
             +MA
Sbjct:    72 MMA 74

 Score = 79 (27.8 bits), Expect = 2.6, P = 0.93
 Identities = 14/62 (22%), Positives = 34/62 (54%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E  + F +FDR   G I A ++  ++ ++ +   +  + ++I++ D +  G+++  EF  
Sbjct:    85 EIAEAFKVFDRNGDGKISAAELRHLLTSIGEKLSDADVDQMIKEADTNNDGEIDIQEFTL 144

Query:   333 LV 338
             L+
Sbjct:   145 LL 146


>gi|1754997 (U48690) calmodulin TaCaM2-1 [Triticum aestivum]
            Length = 142

  Plus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 46/124 (37%), Positives = 79/124 (63%), Frame = +3

Query:   195 GYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETL 374
             G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  L+       D E  
Sbjct:    19 GCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSE-- 76

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE+++  V E D DG G+I ++EF
Sbjct:    77 -EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVDGDGQINYDEF 135

Query:   555 WELM 566
              ++M
Sbjct:   136 VKVM 139

 Score = 112 (39.4 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 18/64 (28%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ +++R+ D DG G++ 
Sbjct:    72 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVDGDGQIN 131

Query:   315 FDEF 326
             +DEF
Sbjct:   132 YDEF 135

 Score = 88 (31.0 bits), Expect = 0.14, P = 0.13
 Identities = 16/49 (32%), Positives = 31/49 (63%), Frame = +3

Query:   423 GYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
             G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  LMA
Sbjct:    19 GCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMA 67

 Score = 85 (29.9 bits), Expect = 0.36, P = 0.30
 Identities = 22/76 (28%), Positives = 39/76 (51%), Frame = +3

Query:   342 TVANTVDKETLQKELREAFRLFDKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEID 518
             TV  ++ +   + EL++     D +GNG I  P  L  + +++ D  S+E+L+ A    D
Sbjct:    28 TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD 87

Query:   519 EDGSGKIEFEEFWELM 566
             +D +G I   E   +M
Sbjct:    88 KDQNGFISAAELRHVM 103

 Score = 78 (27.5 bits), Expect = 3.0, P = 0.95
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:    21 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 80

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    81 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMVREADVDGDGQIN 131


>pdb|4TNC|  Troponin C
            Length = 162

  Plus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 46/152 (30%), Positives = 86/152 (56%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             E  A +    I E++  FDMFD    G I   ++G +M  + Q+  +++L  +I + D D
Sbjct:     9 EARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDED 68

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             GSG ++F+EF  ++        K   ++EL + FR+FDK  +G+I    L  +L+   + 
Sbjct:    69 GSGTIDFEEFLVMMVRQMKEDAKGKSEEELADCFRIFDKNADGFIDIEELGEILRATGEH 128

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +++E +E  + + D++  G+I+F+EF ++M G
Sbjct:   129 VTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEG 160

 Score = 106 (37.3 bits), Expect = 0.0012, P = 0.0012
 Identities = 19/76 (25%), Positives = 41/76 (53%), Frame = +3

Query:   111 IDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFD 290
             + ++  +  G   EE    F +FD+   G+I   ++G+I+ A  +   E+ +  L++  D
Sbjct:    83 VRQMKEDAKGKSEEELADCFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDLMKDSD 142

Query:   291 ADGSGKLEFDEFCALV 338
              +  G+++FDEF  ++
Sbjct:   143 KNNDGRIDFDEFLKMM 158


>gnl|PID|d1020516 (AB003080) cardiac troponin C [Xenopus laevis]
            Length = 161

  Plus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 47/158 (29%), Positives = 92/158 (58%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDR-GKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F +  + G I   ++G++M  + Q+   ++L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFRAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTPEELQEMI 61

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FDEF  ++        K   ++EL + FR+FDK  +GYI    LK +L
Sbjct:    62 DEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMML 121

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + D++  G+I+++EF E M G
Sbjct:   122 EATGETITEDDIEELMRDGDKNNDGRIDYDEFLEFMKG 159

 Score = 102 (35.9 bits), Expect = 0.0041, P = 0.0041
 Identities = 19/63 (30%), Positives = 33/63 (52%), Frame = +3

Query:   138 GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEF 317
             G   EE    F MFD+   GYI   ++  ++ A  +   E  + +L+R  D +  G++++
Sbjct:    91 GKSEEELSDLFRMFDKNADGYIDLDELKMMLEATGETITEDDIEELMRDGDKNNDGRIDY 150

Query:   318 DEF 326
             DEF
Sbjct:   151 DEF 153


>pir||S60234 calmodulin (clone PCM2) - potato (fragment) >gi|687698 (U20291)
            calmodulin [Solanum tuberosum] >gi|687702 (U20293) calmodulin
            [Solanum tuberosum]
            Length = 124

  Plus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 8.4e-19, P = 8.4e-19
 Identities = 45/124 (36%), Positives = 79/124 (63%), Frame = +3

Query:   195 GYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETL 374
             G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  L+       D E  
Sbjct:     1 GCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSE-- 58

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              +EL+EAFR+FDK+ NG+IS   L+ ++  + + L+DE+++  + E D DG G+I ++EF
Sbjct:    59 -EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEF 117

Query:   555 WELM 566
              ++M
Sbjct:   118 VKVM 121

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 19/64 (29%), Positives = 40/64 (62%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    54 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN 113

Query:   315 FDEF 326
             +DEF
Sbjct:   114 YDEF 117

 Score = 88 (31.0 bits), Expect = 0.026, P = 0.026
 Identities = 16/49 (32%), Positives = 31/49 (63%), Frame = +3

Query:   423 GYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
             G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  LMA
Sbjct:     1 GCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMA 49

 Score = 85 (29.9 bits), Expect = 0.11, P = 0.11
 Identities = 22/76 (28%), Positives = 39/76 (51%), Frame = +3

Query:   342 TVANTVDKETLQKELREAFRLFDKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEID 518
             TV  ++ +   + EL++     D +GNG I  P  L  + +++ D  S+E+L+ A    D
Sbjct:    10 TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD 69

Query:   519 EDGSGKIEFEEFWELM 566
             +D +G I   E   +M
Sbjct:    70 KDQNGFISAAELRHVM 85

 Score = 79 (27.8 bits), Expect = 1.0, P = 0.64
 Identities = 29/113 (25%), Positives = 54/113 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I  +++  ++  +  +  E E Q   +  D    G I   +   +M    +D D E++L+
Sbjct:     3 ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELK 62

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             +  R FD D +G +   E   L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    63 EAFRVFDKDQNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADVDGDGQIN 113


>gi|2460249 (AF020769) cardiac ventricular troponin C [Homo sapiens]
            Length = 160

  Plus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 8.4e-19, P = 8.4e-19
 Identities = 48/157 (30%), Positives = 92/157 (58%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDRGKQ-GYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F  G + G I   ++G++M  + Q+   ++L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMI 61

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FDEF  ++       D +   +EL + FR+FDK  +GYI    LK +L
Sbjct:    62 DEVDEDGSGTVDFDEFLVMMVRCMKD-DSKGKSEELSDLFRMFDKNADGYIDLDELKIML 120

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + D++  G+I+++EF E M G
Sbjct:   121 QATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKG 158

 Score = 112 (39.4 bits), Expect = 0.00012, P = 0.00012
 Identities = 25/78 (32%), Positives = 44/78 (56%), Frame = +3

Query:   336 VYTVANTVDKETLQKELREAFRLFDKEG-NGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             +Y  A     E  + E + AF +F     +G IS   L  +++ +  + + E+L+  +DE
Sbjct:     4 IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDE 63

Query:   513 IDEDGSGKIEFEEFWELM 566
             +DEDGSG ++F+EF  +M
Sbjct:    64 VDEDGSGTVDFDEFLVMM 81

 Score = 93 (32.7 bits), Expect = 0.060, P = 0.059
 Identities = 17/59 (28%), Positives = 32/59 (54%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE    F MFD+   GYI   ++  ++ A  +   E  + +L++  D +  G++++DEF
Sbjct:    94 EELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEF 152


>gi|212778 (M19027) troponin C [Gallus gallus]
           Length = 163

  Plus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 8.4e-19, P = 8.4e-19
 Identities = 48/160 (30%), Positives = 87/160 (54%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             A M +   E  A +    I E++  FDMFD    G I   ++G +M  + Q+  +++L  
Sbjct:     2 ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDA 61

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKA 452
             +I + D DGSG ++F+EF  ++        K   ++EL   FR+FDK  +G+I    L  
Sbjct:    62 IIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGE 121

Query:   453 LLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +L+   + + +E +E  + + D++  G+I+F+EF ++M G
Sbjct:   122 ILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMMEG 161

 Score = 91 (32.0 bits), Expect = 0.12, P = 0.11
 Identities = 28/105 (26%), Positives = 50/105 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +     KE L   + E     D++G+G I     L  +++
Sbjct:    30 FDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 85

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TITVD 599
             ++ +D    S+E+L       D++  G I+ EE  E++    +  I  D
Sbjct:    86 QMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVIEED 134


>pdb|1TNX|  Ef-Hand Mol_id: 1; Molecule: Troponin C; Chain: Null; Engineered:
            Yes; Mutation: T130i >pdb|1TNW|  Ef-Hand Mol_id: 1; Molecule:
            Troponin C; Chain: Null; Engineered: Yes; Mutation: T130i
            Length = 162

  Plus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 8.4e-19, P = 8.4e-19
 Identities = 48/160 (30%), Positives = 87/160 (54%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRK 272
             A M +   E  A +    I E++  FDMFD    G I   ++G +M  + Q+  +++L  
Sbjct:     1 ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDA 60

Query:   273 LIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKA 452
             +I + D DGSG ++F+EF  ++        K   ++EL   FR+FDK  +G+I    L  
Sbjct:    61 IIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGE 120

Query:   453 LLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +L+   + + +E +E  + + D++  G+I+F+EF ++M G
Sbjct:   121 ILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMMEG 160

 Score = 91 (32.0 bits), Expect = 0.12, P = 0.11
 Identities = 28/105 (26%), Positives = 50/105 (47%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FDADG G +   E   ++  +     KE L   + E     D++G+G I     L  +++
Sbjct:    29 FDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEV----DEDGSGTIDFEEFLVMMVR 84

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TITVD 599
             ++ +D    S+E+L       D++  G I+ EE  E++    +  I  D
Sbjct:    85 QMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVIEED 133


>gnl|PID|e238629 (X97546) CaMF gene product [Fagus sylvatica]
            Length = 148

  Plus Strand HSPs:

 Score = 231 (81.3 bits), Expect = 1.1e-18, P = 1.1e-18
 Identities = 48/146 (32%), Positives = 85/146 (58%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ +    +  R LI + D DG+G 
Sbjct:     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLARTQLRQSCRTLINEVDRDGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  L+       D E   +EL+EAFR+  K+ NG+IS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLNLMARKMKDTDSE---EELKEAFRVSTKDQNGFISAAELRHVMTNLGEKLTDE 120

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
              ++  + E D DG G+I +EEF ++M
Sbjct:   121 -VDEMIREADVDGDGQINYEEFVKVM 145

 Score = 130 (45.8 bits), Expect = 1.4e-07, P = 1.4e-07
 Identities = 25/63 (39%), Positives = 39/63 (61%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +A     +     ++E+D DG+G I+F EF  
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLARTQLRQSCRTLINEVDRDGNGTIDFPEFLN 71

Query:   561 LMA 569
             LMA
Sbjct:    72 LMA 74

 Score = 89 (31.3 bits), Expect = 0.14, P = 0.13
 Identities = 27/102 (26%), Positives = 49/102 (48%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E   ++ ++A T     L++  R      D++GNG I  P
Sbjct:    12 EFKEAFSLFDKDGDGCITTKELGTVMRSLART----QLRQSCRTLINEVDRDGNGTIDFP 67

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A     +D +G I   E   +M
Sbjct:    68 EFLNLMARKMKDTDSEEELKEAFRVSTKDQNGFISAAELRHVM 110

 Score = 84 (29.6 bits), Expect = 0.61, P = 0.46
 Identities = 16/64 (25%), Positives = 37/64 (57%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +  + + G+I A ++  +M  + +   + ++ ++IR+ D DG G++ 
Sbjct:    79 DTDSEEELKEAFRVSTKDQNGFISAAELRHVMTNLGEKLTD-EVDEMIREADVDGDGQIN 137

Query:   315 FDEF 326
             ++EF
Sbjct:   138 YEEF 141


>sp|P41210|CATR_ATRNU CALTRACTIN (CENTRIN) >prf||1906390A caltractin-like
            protein [Atriplex nummularia]
            Length = 167

  Plus Strand HSPs:

 Score = 229 (80.6 bits), Expect = 1.7e-18, P = 1.7e-18
 Identities = 44/139 (31%), Positives = 85/139 (61%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             +E ++ F++FD    G I A ++   M A+  +  E+Q+ ++I   D DGSG ++FDEFC
Sbjct:    25 QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFC 84

Query:   330 ALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVD 509
              ++   A   +++T ++EL +AFR+ D++ NG IS   ++ + KE+ ++ + + ++  ++
Sbjct:    85 HMM--TAKIGERDT-KEELMKAFRIIDQDNNGKISPEDIQRIAKELGENFTVKDIQDMIE 141

Query:   510 EIDEDGSGKIEFEEFWELM 566
             E D D  G++  EEF  +M
Sbjct:   142 EADRDRDGEVNVEEFLRMM 160

 Score = 141 (49.6 bits), Expect = 7.8e-09, P = 7.8e-09
 Identities = 23/64 (35%), Positives = 44/64 (68%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             ++E++EAF LFD +G+G I    L   ++ +  ++++EQ+   + ++D+DGSG I+F+EF
Sbjct:    24 RQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEF 83

Query:   555 WELM 566
               +M
Sbjct:    84 CHMM 87

 Score = 90 (31.7 bits), Expect = 0.18, P = 0.16
 Identities = 26/107 (24%), Positives = 53/107 (49%), Frame = +3

Query:   231 HAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFD 410
             H + Q    +++++    FD DGSG ++  E    +  +   + +E + + + +     D
Sbjct:    17 HGLTQQ-KRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADV----D 71

Query:   411 KEGNGYISRPTLKALLK-EIADDLSDEQLEAAVDEIDEDGSGKIEFEE 551
             K+G+G I       ++  +I +  + E+L  A   ID+D +GKI  E+
Sbjct:    72 KDGSGAIDFDEFCHMMTAKIGERDTKEELMKAFRIIDQDNNGKISPED 119

 Score = 80 (28.2 bits), Expect = 2.9, P = 0.94
 Identities = 17/63 (26%), Positives = 32/63 (50%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  K F + D+   G I    I +I   + ++F  K ++ +I + D D  G++  +EF 
Sbjct:    98 EELMKAFRIIDQDNNGKISPEDIQRIAKELGENFTVKDIQDMIEEADRDRDGEVNVEEFL 157

Query:   330 ALV 338
              ++
Sbjct:   158 RMM 160


>bbs|154098 troponin C, TnC [Anguilla anguilla=European eel, white muscle,
            Peptide, 160 aa]
            Length = 160

  Plus Strand HSPs:

 Score = 228 (80.3 bits), Expect = 2.2e-18, P = 2.2e-18
 Identities = 44/140 (31%), Positives = 82/140 (58%), Frame = +3

Query:   147 IEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             I E++  FDMFD    G I   ++G +M  + Q+   ++L  +I + D DGSG ++F+EF
Sbjct:    17 IAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTREELDAIIEEVDEDGSGTIDFEEF 76

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAV 506
               ++            ++EL E FR+FDK G+G+I R     +L+   + +S+E+++  +
Sbjct:    77 LVMMVRQLKEDQAGKSEEELAEFFRVFDKNGDGFIDREEFGEILRSSGEPVSEEEIDELM 136

Query:   507 DEIDEDGSGKIEFEEFWELM 566
              + D++  GKI+F+E+ ++M
Sbjct:   137 ADGDKNNDGKIDFDEWLKMM 156

 Score = 143 (50.3 bits), Expect = 4.7e-09, P = 4.7e-09
 Identities = 29/75 (38%), Positives = 47/75 (62%), Frame = +3

Query:   342 TVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDE 521
             T A +   E +  E + AF +FD +G G IS   L  +++ +  + + E+L+A ++E+DE
Sbjct:     6 TDARSFLSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTREELDAIIEEVDE 65

Query:   522 DGSGKIEFEEFWELM 566
             DGSG I+FEEF  +M
Sbjct:    66 DGSGTIDFEEFLVMM 80

 Score = 108 (38.0 bits), Expect = 0.00052, P = 0.00052
 Identities = 23/90 (25%), Positives = 47/90 (52%), Frame = +3

Query:    78 FQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDE 257
             F+    +M   + E  A   G   EE  +FF +FD+   G+I   + G+I+ +  +   E
Sbjct:    73 FEEFLVMMVRQLKEDQA---GKSEEELAEFFRVFDKNGDGFIDREEFGEILRSSGEPVSE 129

Query:   258 KQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             +++ +L+   D +  GK++FDE+  ++  +
Sbjct:   130 EEIDELMADGDKNNDGKIDFDEWLKMMENI 159

 Score = 91 (32.0 bits), Expect = 0.11, P = 0.10
 Identities = 26/99 (26%), Positives = 49/99 (49%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS-RPTLKALLK 461
             FD DG G +   E   ++  +     +E L   + E     D++G+G I     L  +++
Sbjct:    27 FDTDGGGDISTKELGTVMRMLGQNPTREELDAIIEEV----DEDGSGTIDFEEFLVMMVR 82

Query:   462 EIADDL---SDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
             ++ +D    S+E+L       D++G G I+ EEF E++    +
Sbjct:    83 QLKEDQAGKSEEELAEFFRVFDKNGDGFIDREEFGEILRSSGE 125


>gi|1785955 (U38786) calmodulin [Trichomonas vaginalis]
            Length = 134

  Plus Strand HSPs:

 Score = 228 (80.3 bits), Expect = 2.2e-18, P = 2.2e-18
 Identities = 43/133 (32%), Positives = 84/133 (63%), Frame = +3

Query:   168 FDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTV 347
             F++FD+   G I A ++G +M ++ Q+  E +L+ +I + D DG+G +EFDEF   +Y +
Sbjct:     2 FNIFDKDGDGRITAKELGTVMRSLGQNPSEAELQDMINEIDLDGNGTIEFDEF---LYMM 58

Query:   348 ANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDG 527
                + +   ++E+++AFR+FDK+G+G I+   L  ++K + + L+ E+++  + + D + 
Sbjct:    59 NRQMKEGDTEEEIKDAFRVFDKDGDGKITAAELAHVMKNLGEPLTQEEVDEMIAQADTNK 118

Query:   528 SGKIEFEEFWELM 566
              G I++ EF  LM
Sbjct:   119 DGIIDYGEFVHLM 131

 Score = 126 (44.4 bits), Expect = 3.9e-07, P = 3.9e-07
 Identities = 23/58 (39%), Positives = 40/58 (68%), Frame = +3

Query:   393 AFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             AF +FDK+G+G I+   L  +++ +  + S+ +L+  ++EID DG+G IEF+EF  +M
Sbjct:     1 AFNIFDKDGDGRITAKELGTVMRSLGQNPSEAELQDMINEIDLDGNGTIEFDEFLYMM 58

 Score = 94 (33.1 bits), Expect = 0.0085, P = 0.0085
 Identities = 25/94 (26%), Positives = 48/94 (51%), Frame = +3

Query:   285 FDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL-K 461
             FD DG G++   E    + TV  ++ +   + EL++     D +GNG I       ++ +
Sbjct:     5 FDKDGDGRITAKE----LGTVMRSLGQNPSEAELQDMINEIDLDGNGTIEFDEFLYMMNR 60

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++ +  ++E+++ A    D+DG GKI   E   +M
Sbjct:    61 QMKEGDTEEEIKDAFRVFDKDGDGKITAAELAHVM 95

 Score = 87 (30.6 bits), Expect = 0.13, P = 0.13
 Identities = 17/70 (24%), Positives = 38/70 (54%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             +G   EE +  F +FD+   G I A ++  +M  + +   ++++ ++I + D +  G ++
Sbjct:    64 EGDTEEEIKDAFRVFDKDGDGKITAAELAHVMKNLGEPLTQEEVDEMIAQADTNKDGIID 123

Query:   315 FDEFCALVYT 344
             + EF  L+ T
Sbjct:   124 YGEFVHLMLT 133

 Score = 76 (26.8 bits), Expect = 4.1, P = 0.98
 Identities = 28/112 (25%), Positives = 52/112 (46%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQIE-EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLR 269
             I A+++  ++  +  +  E E Q   +  D    G I   +   +M+   ++ D E++++
Sbjct:    13 ITAKELGTVMRSLGQNPSEAELQDMINEIDLDGNGTIEFDEFLYMMNRQMKEGDTEEEIK 72

Query:   270 KLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
                R FD DG GK+   E   L + + N  +  T Q+E+ E     D   +G I
Sbjct:    73 DAFRVFDKDGDGKITAAE---LAHVMKNLGEPLT-QEEVDEMIAQADTNKDGII 122


>gi|1666242 (U59300) centrin [Giardia intestinalis]
            Length = 161

  Plus Strand HSPs:

 Score = 227 (79.9 bits), Expect = 2.8e-18, P = 2.8e-18
 Identities = 46/146 (31%), Positives = 88/146 (60%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   Q  E ++ FD+FD    G I   ++   M A+  +   ++L+++I + D  GSG 
Sbjct:    13 DLTEEQKHEIREAFDLFDSDGSGRIDVKELKVAMRALGFEPKREELKRMIAEVDTSGSGM 72

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++ ++F  ++   A   ++++ ++E+ +AFRLFD++  G IS   LK + KE+ ++L+DE
Sbjct:    73 IDLNDFFRIM--TAKMAERDS-REEILKAFRLFDEDDTGKISFKNLKKVAKELGENLTDE 129

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  +DE D DG G+I  EEF  +M
Sbjct:   130 EIQEMIDEADRDGDGEINEEEFLRIM 155

 Score = 123 (43.3 bits), Expect = 8.5e-07, P = 8.5e-07
 Identities = 24/67 (35%), Positives = 40/67 (59%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  + E+REAF LFD +G+G I    LK  ++ +  +   E+L+  + E+D  GSG I+ 
Sbjct:    16 EEQKHEIREAFDLFDSDGSGRIDVKELKVAMRALGFEPKREELKRMIAEVDTSGSGMIDL 75

Query:   546 EEFWELM 566
              +F+ +M
Sbjct:    76 NDFFRIM 82

 Score = 101 (35.6 bits), Expect = 0.0058, P = 0.0058
 Identities = 30/103 (29%), Positives = 53/103 (51%), Frame = +3

Query:   240 EQDFDEKQ---LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFD 410
             E D  E+Q   +R+    FD+DGSG+++  E    +  +     +E L++ + E     D
Sbjct:    11 EPDLTEEQKHEIREAFDLFDSDGSGRIDVKELKVAMRALGFEPKREELKRMIAEV----D 66

Query:   411 KEGNGYIS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
               G+G I      + +  ++A+  S E++  A    DED +GKI F+
Sbjct:    67 TSGSGMIDLNDFFRIMTAKMAERDSREEILKAFRLFDEDDTGKISFK 113

 Score = 87 (30.6 bits), Expect = 0.36, P = 0.30
 Identities = 25/104 (24%), Positives = 47/104 (45%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQ-LRKLIRKFDADGSGKLEFDEF 326
             EE ++     D    G I      +IM A   + D ++ + K  R FD D +GK+ F   
Sbjct:    56 EELKRMIAEVDTSGSGMIDLNDFFRIMTAKMAERDSREEILKAFRLFDEDDTGKISFKNL 115

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   +   +  E +Q+ + EA    D++G+G I+      +++
Sbjct:   116 KKVAKELGENLTDEEIQEMIDEA----DRDGDGEINEEEFLRIMR 156

 Score = 83 (29.2 bits), Expect = 1.1, P = 0.67
 Identities = 18/72 (25%), Positives = 39/72 (54%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGS 302
             +AE D    EE  K F +FD    G I    + ++   + ++  +++++++I + D DG 
Sbjct:    86 MAERDSR--EEILKAFRLFDEDDTGKISFKNLKKVAKELGENLTDEEIQEMIDEADRDGD 143

Query:   303 GKLEFDEFCALV 338
             G++  +EF  ++
Sbjct:   144 GEINEEEFLRIM 155


>sp|P05936|TPCC_COTJA TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES (TN-C)
            >pir||S07450 troponin C - quail >prf||1403394A slow/cardiac
            troponin C [Phasianidae gen. sp.]
            Length = 161

  Plus Strand HSPs:

 Score = 227 (79.9 bits), Expect = 2.8e-18, P = 2.8e-18
 Identities = 45/158 (28%), Positives = 92/158 (58%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDRGKQ-GYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F  G + G I   ++G++M  + Q+   ++L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMI 61

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FD+F  ++        K   ++EL + FR+FDK  +GYI    LK +L
Sbjct:    62 DEVDEDGSGTVDFDQFLVMMVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIML 121

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + +++  G+I+++EF + M G
Sbjct:   122 QATGETITEDDIEELMKDGNKNNDGRIDYDEFLQFMKG 159

 Score = 90 (31.7 bits), Expect = 0.15, P = 0.14
 Identities = 17/63 (26%), Positives = 33/63 (52%), Frame = +3

Query:   138 GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEF 317
             G   EE    F MFD+   GYI   ++  ++ A  +   E  + +L++  + +  G++++
Sbjct:    91 GKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGNKNNDGRIDY 150

Query:   318 DEF 326
             DEF
Sbjct:   151 DEF 153


>gi|972430 (F14583) calmodulin [Sus scrofa]
           Length = 120

  Plus Strand HSPs:

 Score = 226 (79.6 bits), Expect = 3.6e-18, P = 3.6e-18
 Identities = 43/120 (35%), Positives = 75/120 (62%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++F EF  ++       D E   +E+REAFR+FDK+GNGYIS   L+ ++  + + L+DE
Sbjct:    64 IDFPEFLXMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE 120

 Score = 138 (48.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 26/75 (34%), Positives = 50/75 (66%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A+ + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMA 569
             G+G I+F EF  +MA
Sbjct:    60 GNGTIDFPEFLXMMA 74

 Score = 106 (37.3 bits), Expect = 6.7e-05, P = 6.7e-05
 Identities = 31/110 (28%), Positives = 54/110 (49%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M     E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             D +GNG I  P  L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    57 DADGNGTIDFPEFLXMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM 110


>gnl|PID|d1014325 (D88494) troponin C [Halocynthia roretzi] >gnl|PID|d1014327
            (D88496) troponin C [Halocynthia roretzi]
            Length = 158

  Plus Strand HSPs:

 Score = 225 (79.2 bits), Expect = 4.6e-18, P = 4.6e-18
 Identities = 50/145 (34%), Positives = 86/145 (59%), Frame = +3

Query:   144 QIEEYQKFFDMFDR-GKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFD 320
             Q  E++  FD+F    K G I + ++G++M  + Q+  EK L+++I + D DGSG ++F+
Sbjct:     9 QKSEFRAAFDIFVADAKDGTISSKELGKVMKMLGQNPTEKDLQEMIEEVDIDGSGTIDFE 68

Query:   321 EFCALVYTVANTVDK----ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             EFC ++Y      ++    E  +KEL EAFRLFD +GNG I    LKA L    +++   
Sbjct:    69 EFCLMMYRQMQAEEEAKIPEREEKELSEAFRLFDLDGNGLIGWDELKAALDGTGENVETW 128

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + + D++   +I++EE W  M
Sbjct:   129 EVDEMMADGDKNHDSQIDYEE-WVTM 153

 Score = 109 (38.4 bits), Expect = 0.00031, P = 0.00031
 Identities = 24/68 (35%), Positives = 41/68 (60%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEG-NGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIE 542
             E  + E R AF +F  +  +G IS   L  ++K +  + +++ L+  ++E+D DGSG I+
Sbjct:     7 EDQKSEFRAAFDIFVADAKDGTISSKELGKVMKMLGQNPTEKDLQEMIEEVDIDGSGTID 66

Query:   543 FEEFWELM 566
             FEEF  +M
Sbjct:    67 FEEFCLMM 74

 Score = 77 (27.1 bits), Expect = 5.6, P = 1.0
 Identities = 27/104 (25%), Positives = 52/104 (50%), Frame = +3

Query:   105 EDIDEILAE--IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +D+ E++ E  IDGS   ++++F  M  R  Q    A +  +I      + +EK+L +  
Sbjct:    48 KDLQEMIEEVDIDGSGTIDFEEFCLMMYRQMQ----AEEEAKI-----PEREEKELSEAF 98

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKE 416
             R FD DG+G + +DE  A +      V+   + + + +  +  D +
Sbjct:    99 RLFDLDGNGLIGWDELKAALDGTGENVETWEVDEMMADGDKNHDSQ 144


>gnl|PID|e314005 (Y12473) centrin [Homo sapiens]
            Length = 167

  Plus Strand HSPs:

 Score = 224 (78.9 bits), Expect = 5.9e-18, P = 5.9e-18
 Identities = 46/149 (30%), Positives = 88/149 (59%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   Q +E +  F++FD  K   I   ++   M A+  D  +  + K+++ +D + +GK
Sbjct:    21 ELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGK 80

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             + F++F  +V    + + +    +E+ +AF+LFD + +G IS   L+ + +E+ +++SDE
Sbjct:    81 ITFEDFNEVV---TDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDE 137

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELMAGD 575
             +L A ++E D+DG G+I  EEF  +M GD
Sbjct:   138 ELRAMIEEFDKDGDGEINQEEFIAIMTGD 166

 Score = 114 (40.1 bits), Expect = 0.00010, P = 0.00010
 Identities = 23/83 (27%), Positives = 46/83 (55%), Frame = +3

Query:    96 IMAEDIDEILAE--IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLR 269
             I  ED +E++ +  ++    EE  K F +FD    G I    + ++   + ++  +++LR
Sbjct:    81 ITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR 140

Query:   270 KLIRKFDADGSGKLEFDEFCALV 338
              +I +FD DG G++  +EF A++
Sbjct:   141 AMIEEFDKDGDGEINQEEFIAIM 163

 Score = 93 (32.7 bits), Expect = 0.073, P = 0.071
 Identities = 19/67 (28%), Positives = 38/67 (56%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+++AF LFD + +  I    LK  ++ +  D+    +   + + D + +GKI F
Sbjct:    24 EEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITF 83

Query:   546 EEFWELM 566
             E+F E++
Sbjct:    84 EDFNEVV 90

 Score = 85 (29.9 bits), Expect = 0.71, P = 0.51
 Identities = 28/99 (28%), Positives = 47/99 (47%), Frame = +3

Query:   162 KFFDMFDRGKQGYIMATQIGQIMH--AMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCAL 335
             K    +DR   G I      +++    +E+D  E+ L K  + FD D SGK+        
Sbjct:    68 KILKDYDREATGKITFEDFNEVVTDWILERDPHEEIL-KAFKLFDDDDSGKISLRN---- 122

Query:   336 VYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
             +  VA  + +    +ELR     FDK+G+G I++    A++
Sbjct:   123 LRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIM 163


>gnl|PID|e314006 (Y12474) centrin [Mus musculus]
            Length = 167

  Plus Strand HSPs:

 Score = 224 (78.9 bits), Expect = 5.9e-18, P = 5.9e-18
 Identities = 46/149 (30%), Positives = 88/149 (59%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             E+   Q +E +  F++FD  K   I   ++   M A+  D  +  + K+++ +D + +GK
Sbjct:    21 ELSEEQKQEIKDAFELFDTDKDQAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGK 80

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             + F++F  +V    + + +    +E+ +AF+LFD + +G IS   L+ + +E+ +++SDE
Sbjct:    81 ITFEDFNEVV---TDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDE 137

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELMAGD 575
             +L A ++E D+DG G+I  EEF  +M GD
Sbjct:   138 ELRAMIEEFDKDGDGEINQEEFIAIMTGD 166

 Score = 114 (40.1 bits), Expect = 0.00010, P = 0.00010
 Identities = 23/83 (27%), Positives = 46/83 (55%), Frame = +3

Query:    96 IMAEDIDEILAE--IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLR 269
             I  ED +E++ +  ++    EE  K F +FD    G I    + ++   + ++  +++LR
Sbjct:    81 ITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR 140

Query:   270 KLIRKFDADGSGKLEFDEFCALV 338
              +I +FD DG G++  +EF A++
Sbjct:   141 AMIEEFDKDGDGEINQEEFIAIM 163

 Score = 93 (32.7 bits), Expect = 0.073, P = 0.071
 Identities = 19/67 (28%), Positives = 38/67 (56%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+++AF LFD + +  I    LK  ++ +  D+    +   + + D + +GKI F
Sbjct:    24 EEQKQEIKDAFELFDTDKDQAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITF 83

Query:   546 EEFWELM 566
             E+F E++
Sbjct:    84 EDFNEVV 90

 Score = 85 (29.9 bits), Expect = 0.71, P = 0.51
 Identities = 28/99 (28%), Positives = 47/99 (47%), Frame = +3

Query:   162 KFFDMFDRGKQGYIMATQIGQIMH--AMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCAL 335
             K    +DR   G I      +++    +E+D  E+ L K  + FD D SGK+        
Sbjct:    68 KILKDYDREATGKITFEDFNEVVTDWILERDPHEEIL-KAFKLFDDDDSGKISLRN---- 122

Query:   336 VYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
             +  VA  + +    +ELR     FDK+G+G I++    A++
Sbjct:   123 LRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIM 163


>gnl|PID|d1014326 (D88495) troponin C [Halocynthia roretzi] >gnl|PID|d1014328
            (D88496) alternative splicing: see D88495; larval specific troponin
            C [Halocynthia roretzi]
            Length = 158

  Plus Strand HSPs:

 Score = 224 (78.9 bits), Expect = 5.9e-18, P = 5.9e-18
 Identities = 48/145 (33%), Positives = 88/145 (60%), Frame = +3

Query:   144 QIEEYQKFFDMF-DRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFD 320
             Q  E++  FD+F +  + G I A ++G++M  + Q+  E++L++++ + D DGSG ++F+
Sbjct:     9 QKSEFRTCFDIFVEDTEDGTITAKELGKLMKMLGQNPSEQELKEMVEEVDLDGSGTIDFE 68

Query:   321 EFCALVYTVANTVDK----ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             EFC ++Y      ++    E  +KEL EAFRLFD +GNG I    LKA L    +++   
Sbjct:    69 EFCLMMYRQMQAEEEAKIPEREEKELSEAFRLFDLDGNGLIGWDELKAALDGTGENVETW 128

Query:   489 QLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++  + + D++   +I++EE W  M
Sbjct:   129 EVDEMMADGDKNHDSQIDYEE-WVTM 153

 Score = 112 (39.4 bits), Expect = 8.7e-05, P = 8.7e-05
 Identities = 27/68 (39%), Positives = 42/68 (61%), Frame = +3

Query:   366 ETLQKELREAFRLF--DKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             E  + E R  F +F  D E +G I+   L  L+K +  + S+++L+  V+E+D DGSG I
Sbjct:     7 EDQKSEFRTCFDIFVEDTE-DGTITAKELGKLMKMLGQNPSEQELKEMVEEVDLDGSGTI 65

Query:   540 EFEEFWELM 566
             +FEEF  +M
Sbjct:    66 DFEEFCLMM 74


>sp|P53441|CATR_NAEGR CALTRACTIN (CENTRIN) >gi|972963 (U21725) centrin
            [Naegleria gruberi]
            Length = 172

  Plus Strand HSPs:

 Score = 223 (78.5 bits), Expect = 7.5e-18, P = 7.5e-18
 Identities = 46/150 (30%), Positives = 92/150 (61%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             ++  E+   Q +E ++ FD+FD    G I A ++   M A+  +  +++++K+I   D +
Sbjct:    21 KVQIELTDEQRQEIKEAFDLFDMDGSGKIDAKELKVAMRALGFEPKKEEIKKMISGID-N 79

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             GSGK++F++F  L+   A   +K++   E+ +AFRLFD++ +G+I+   LK + K++ ++
Sbjct:    80 GSGKIDFNDFLQLM--TAKMSEKDS-HAEIMKAFRLFDEDDSGFITFANLKRVAKDLGEN 136

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             ++DE+L   ++E D    G+I  E+F  +M
Sbjct:   137 MTDEELREMIEEADRSNQGQISKEDFLRIM 166

 Score = 122 (42.9 bits), Expect = 6.6e-06, P = 6.6e-06
 Identities = 24/64 (37%), Positives = 42/64 (65%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             ++E++EAF LFD +G+G I    LK  ++ +  +   E+++  +  ID +GSGKI+F +F
Sbjct:    31 RQEIKEAFDLFDMDGSGKIDAKELKVAMRALGFEPKKEEIKKMISGID-NGSGKIDFNDF 89

Query:   555 WELM 566
              +LM
Sbjct:    90 LQLM 93

 Score = 77 (27.1 bits), Expect = 7.1, P = 1.0
 Identities = 13/62 (20%), Positives = 33/62 (53%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E  K F +FD    G+I    + ++   + ++  +++LR++I + D    G++  ++F  
Sbjct:   105 EIMKAFRLFDEDDSGFITFANLKRVAKDLGENMTDEELREMIEEADRSNQGQISKEDFLR 164

Query:   333 LV 338
             ++
Sbjct:   165 IM 166


>sp|Q11083|YT67_CAEEL HYPOTHETICAL CALCIUM-BINDING PROTEIN B0563.7 IN
            CHROMOSOME X >gi|861285 (U28740) similar to calmodulin
            [Caenorhabditis elegans]
            Length = 229

  Plus Strand HSPs:

 Score = 220 (77.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 49/157 (31%), Positives = 86/157 (54%), Frame = +3

Query:    84 HRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQ 263
             H Q    EDI     +    +++EY++ F+MFD    G I   ++ Q M ++    ++ +
Sbjct:    32 HSQQSQPEDIQ---MKYTRKELKEYRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAE 88

Query:   264 LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPT 443
             +  +I++ DADG+G+++F+EFCA +    N V K T ++ +RE F +FD++ NG I+   
Sbjct:    89 IDNVIKEVDADGNGEIDFEEFCACMKKSQNIV-KSTNEELIRECFEIFDQDRNGIITENE 147

Query:   444 LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              K + KE  D   DE  E    E+D   +G +  ++F
Sbjct:   148 FKYIAKEFGD-FDDELAEKVFRELDVSANGHLSADQF 183

 Score = 120 (42.2 bits), Expect = 0.00012, P = 0.00012
 Identities = 23/63 (36%), Positives = 37/63 (58%), Frame = +3

Query:   378 KELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFW 557
             KE R+ F +FD +G+G I    LK  +  I    +  +++  + E+D DG+G+I+FEEF 
Sbjct:    51 KEYRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEVDADGNGEIDFEEFC 110

Query:   558 ELM 566
               M
Sbjct:   111 ACM 113

 Score = 95 (33.4 bits), Expect = 0.11, P = 0.10
 Identities = 27/99 (27%), Positives = 47/99 (47%), Frame = +3

Query:   258 KQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISR 437
             K+ R+L   FD DGSG +  +E    + ++    +K  +   ++E     D +GNG I  
Sbjct:    51 KEYRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEV----DADGNGEIDF 106

Query:   438 PTLKALLKE---IADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
                 A +K+   I    ++E +    +  D+D +G I   EF
Sbjct:   107 EEFCACMKKSQNIVKSTNEELIRECFEIFDQDRNGIITENEF 148

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.70
 Identities = 25/92 (27%), Positives = 41/92 (44%), Frame = +3

Query:    63 NFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAME 242
             N E  F+   A M +    I+   +   I E    F++FD+ + G I   +   I     
Sbjct:   101 NGEIDFEEFCACMKKS-QNIVKSTNEELIREC---FEIFDQDRNGIITENEFKYIAKEFG 156

Query:   243 QDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
              DFD++   K+ R+ D   +G L  D+F  +V
Sbjct:   157 -DFDDELAEKVFRELDVSANGHLSADQFATIV 187


>pir||S60235 calmodulin (clone PCM3) - potato (fragment) >gi|687700 (U20292)
            calmodulin [Solanum tuberosum]
            Length = 124

  Plus Strand HSPs:

 Score = 220 (77.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 43/124 (34%), Positives = 78/124 (62%), Frame = +3

Query:   195 GYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETL 374
             G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F EF  L+   A  +     
Sbjct:     1 GCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM---ARKIKDTDF 57

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             ++EL+EAFR+FDK+ NG+IS   L  ++  + + L+DE+++  + E D D  G+I ++EF
Sbjct:    58 EEELKEAFRVFDKDRNGFISAAELPHVMTNLGEKLTDEEVDEIIREADVDCDGQINYDEF 117

Query:   555 WELM 566
              ++M
Sbjct:   118 VKVM 121

 Score = 104 (36.6 bits), Expect = 0.00011, P = 0.00011
 Identities = 17/59 (28%), Positives = 38/59 (64%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D D  G++ +DEF
Sbjct:    59 EELKEAFRVFDKDRNGFISAAELPHVMTNLGEKLTDEEVDEIIREADVDCDGQINYDEF 117

 Score = 88 (31.0 bits), Expect = 0.026, P = 0.026
 Identities = 16/49 (32%), Positives = 31/49 (63%), Frame = +3

Query:   423 GYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
             G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  LMA
Sbjct:     1 GCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMA 49

 Score = 81 (28.5 bits), Expect = 0.54, P = 0.42
 Identities = 22/76 (28%), Positives = 38/76 (50%), Frame = +3

Query:   342 TVANTVDKETLQKELREAFRLFDKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEID 518
             TV  ++ +   + EL++     D +GNG I  P  L  + ++I D   +E+L+ A    D
Sbjct:    10 TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKIKDTDFEEELKEAFRVFD 69

Query:   519 EDGSGKIEFEEFWELM 566
             +D +G I   E   +M
Sbjct:    70 KDRNGFISAAELPHVM 85


>gi|213622 (M29722) troponin C [Coturnix coturnix]
           Length = 160

  Plus Strand HSPs:

 Score = 220 (77.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 45/157 (28%), Positives = 91/157 (57%), Frame = +3

Query:   105 EDIDEILAE-IDGSQIEEYQKFFDMFDRGKQ-GYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             +DI +   E +   Q  E++  FD+F  G + G I   ++G++M  + Q+    +L+++I
Sbjct:     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQN-PTPELQEMI 60

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D DGSG ++FD+F  ++        K   ++EL + FR+FDK  +GYI    LK +L
Sbjct:    61 DEVDEDGSGTVDFDQFLVMMVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIML 120

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +   + ++++ +E  + + +++  G+I+++EF + M G
Sbjct:   121 QATGETITEDDIEELMKDGNKNNDGRIDYDEFLQFMKG 158


>sp|Q24956|CATR_GIALA CALTRACTIN (CENTRIN) >gi|1399341 (U42428) caltractin
            [Giardia intestinalis]
            Length = 176

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 5.3e-17, P = 5.3e-17
 Identities = 45/143 (31%), Positives = 85/143 (59%), Frame = +3

Query:   126 AEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSG 305
             AE+      E ++ FD+FD  + G I   ++   M A+  D  ++++++++ ++D D  G
Sbjct:    26 AEVSEEMKHEIREAFDLFDADRSGRIDFHELKVAMRALGFDVKKEEIQRIMNEYDRDQLG 85

Query:   306 KLEFDEFC-ALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLS 482
             ++ F +F   ++  ++N    E    E+ +AFRLFD +  G IS   L+ + KE+++++S
Sbjct:    86 EITFQDFEEVMIEKISNRDPTE----EILKAFRLFDDDATGRISLKNLRRVAKELSENIS 141

Query:   483 DEQLEAAVDEIDEDGSGKIEFEEF 554
             DE+L A + E D DG G+I+ E+F
Sbjct:   142 DEELLAMIQEFDRDGDGEIDEEDF 165

 Score = 122 (42.9 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 24/67 (35%), Positives = 42/67 (62%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E ++ E+REAF LFD + +G I    LK  ++ +  D+  E+++  ++E D D  G+I F
Sbjct:    30 EEMKHEIREAFDLFDADRSGRIDFHELKVAMRALGFDVKKEEIQRIMNEYDRDQLGEITF 89

Query:   546 EEFWELM 566
             ++F E+M
Sbjct:    90 QDFEEVM 96

 Score = 104 (36.6 bits), Expect = 0.0039, P = 0.0039
 Identities = 21/83 (25%), Positives = 47/83 (56%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQ--IEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLR 269
             I  +D +E++ E   ++   EE  K F +FD    G I    + ++   + ++  +++L 
Sbjct:    87 ITFQDFEEVMIEKISNRDPTEEILKAFRLFDDDATGRISLKNLRRVAKELSENISDEELL 146

Query:   270 KLIRKFDADGSGKLEFDEFCALV 338
              +I++FD DG G+++ ++F A++
Sbjct:   147 AMIQEFDRDGDGEIDEEDFIAIL 169

 Score = 93 (32.7 bits), Expect = 0.090, P = 0.086
 Identities = 25/104 (24%), Positives = 49/104 (47%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDE-KQLRKLIRKFDADGSGKLEFDEF 326
             EE Q+  + +DR + G I      ++M     + D  +++ K  R FD D +G++     
Sbjct:    70 EEIQRIMNEYDRDQLGEITFQDFEEVMIEKISNRDPTEEILKAFRLFDDDATGRISLKNL 129

Query:   327 CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   ++  +  E L   ++E    FD++G+G I      A+L+
Sbjct:   130 RRVAKELSENISDEELLAMIQE----FDRDGDGEIDEEDFIAILR 170

 Score = 92 (32.4 bits), Expect = 0.12, P = 0.11
 Identities = 24/96 (25%), Positives = 52/96 (54%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             ++R+    FDAD SG+++F E    +  +   V KE +Q+ + E    +D++  G I+  
Sbjct:    35 EIREAFDLFDADRSGRIDFHELKVAMRALGFDVKKEEIQRIMNE----YDRDQLGEITFQ 90

Query:   441 TLK-ALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFE 548
               +  ++++I++    E++  A    D+D +G+I  +
Sbjct:    91 DFEEVMIEKISNRDPTEEILKAFRLFDDDATGRISLK 127


>gnl|PID|d1008877 (D45848) calmodulin-related protein [Arabidopsis thaliana]
            Length = 324

  Plus Strand HSPs:

 Score = 214 (75.3 bits), Expect = 6.8e-17, P = 6.8e-17
 Identities = 51/160 (31%), Positives = 87/160 (54%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI EY++ F +FD+   G I   ++G +M ++ +   +  L+ L+ + D DG G 
Sbjct:     4 KLTDDQITEYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGT 63

Query:   309 LEFDEF-CALV----------YTVANTVDKETLQK--ELREAFRLFDKEGNGYISRPTLK 449
             ++F EF C +           +T     DK T  +  E RE+FRLFDK G+G I++  L+
Sbjct:    64 IDFPEFLCVMAKNQGHDQAPRHTKKTMADKLTDDQITEYRESFRLFDKNGDGSITKKELR 123

Query:   450 ALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
              ++  +  + +   L+  ++E+D DG G I+F EF  LMA
Sbjct:   124 TVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMA 163

 Score = 207 (72.9 bits), Expect = 4.8e-16, P = 4.8e-16
 Identities = 48/162 (29%), Positives = 85/162 (52%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI EY++ F +FD+   G I   ++  +M ++ ++  +  L+ ++ + D DG G 
Sbjct:    93 KLTDDQITEYRESFRLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGT 152

Query:   309 LEFDEFCALV-----------YTVANTVDKETLQK---ELREAFRLFDKEGNGYISRPTL 446
             ++F EF  L+           +T    VD +       E REAFR+FDK G+GYI+   L
Sbjct:   153 IDFPEFLYLMAKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVNEL 212

Query:   447 KALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +  ++ + +  +  +L+  ++E D DG G I F EF  +M G
Sbjct:   213 RTTMRSLGETQTKAELQDMINEADADGDGTISFSEFVCVMTG 254

 Score = 127 (44.7 bits), Expect = 4.6e-05, P = 4.6e-05
 Identities = 26/63 (41%), Positives = 40/63 (63%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E RE+FRLFDK G+G I++  L  +++ I +  +   L+  ++E D DG G I+F EF  
Sbjct:    12 EYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGTIDFPEFLC 71

Query:   561 LMA 569
             +MA
Sbjct:    72 VMA 74

 Score = 126 (44.4 bits), Expect = 6.0e-05, P = 6.0e-05
 Identities = 29/105 (27%), Positives = 56/105 (53%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   GYI   ++   M ++ +   + +L+ +I + DADG G 
Sbjct:   183 QLTDDQILEFREAFRVFDKNGDGYITVNELRTTMRSLGETQTKAELQDMINEADADGDGT 242

Query:   309 LEFDEF-CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPT 443
             + F EF C +   + +T  K       +E +R+ + +G G + R T
Sbjct:   243 ISFSEFVCVMTGKMIDTQSK-------KETYRVVN-QGQGQVQRHT 280

 Score = 89 (31.3 bits), Expect = 1.0, P = 0.64
 Identities = 36/164 (21%), Positives = 74/164 (45%), Frame = +3

Query:   108 DIDEIL--AEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDE-KQLRKLI 278
             D+ +++  A++DG    ++ +F  +  +  QG+  A +  +   A +   D+  + R+  
Sbjct:    48 DLQDLMNEADLDGDGTIDFPEFLCVMAKN-QGHDQAPRHTKKTMADKLTDDQITEYRESF 106

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
             R FD +G G +   E   +++++     K  LQ  + E     D +G+G I  P    L+
Sbjct:   107 RLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEV----DLDGDGTIDFPEFLYLM 162

Query:   459 -KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TITVD 599
              K    D +    +  + +        +EF E + +   + D  ITV+
Sbjct:   163 AKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVN 210

 Score = 82 (28.9 bits), Expect = 6.3, P = 1.0
 Identities = 32/145 (22%), Positives = 66/145 (45%), Frame = +3

Query:   108 DIDEILAEID--GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEK--QLRKL 275
             D+ +++ E+D  G    ++ +F  +  +  QG+  A +  +      Q  D++  + R+ 
Sbjct:   137 DLQDMMNEVDLDGDGTIDFPEFLYLMAKN-QGHDQAPRHTKKTMVDYQLTDDQILEFREA 195

Query:   276 IRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
              R FD +G G +  +E    + ++  T  K  LQ  + EA    D +G+G IS      +
Sbjct:   196 FRVFDKNGDGYITVNELRTTMRSLGETQTKAELQDMINEA----DADGDGTISFSEFVCV 251

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIE 542
             +      + D Q +     +   G G+++
Sbjct:   252 M---TGKMIDTQSKKETYRVVNQGQGQVQ 277


>gi|598067 (L34546) calmodulin-related protein [Arabidopsis thaliana]
           Length = 324

  Plus Strand HSPs:

 Score = 214 (75.3 bits), Expect = 6.8e-17, P = 6.8e-17
 Identities = 51/160 (31%), Positives = 87/160 (54%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI EY++ F +FD+   G I   ++G +M ++ +   +  L+ L+ + D DG G 
Sbjct:     4 KLTDDQITEYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGT 63

Query:   309 LEFDEF-CALV----------YTVANTVDKETLQK--ELREAFRLFDKEGNGYISRPTLK 449
             ++F EF C +           +T     DK T  +  E RE+FRLFDK G+G I++  L+
Sbjct:    64 IDFPEFLCVMAKNQGHDQAPRHTKKTMADKLTDDQITEYRESFRLFDKNGDGSITKKELR 123

Query:   450 ALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
              ++  +  + +   L+  ++E+D DG G I+F EF  LMA
Sbjct:   124 TVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLMA 163

 Score = 204 (71.8 bits), Expect = 1.1e-15, P = 1.1e-15
 Identities = 48/162 (29%), Positives = 84/162 (51%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI EY++ F +FD+   G I   ++  +M ++ ++  +  L+ ++ + D DG G 
Sbjct:    93 KLTDDQITEYRESFRLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGT 152

Query:   309 LEFDEFCALV-----------YTVANTVDKETLQK---ELREAFRLFDKEGNGYISRPTL 446
             ++F EF  L+           +T    VD +       E REAFR+FDK G+GYI+   L
Sbjct:   153 IDFPEFLYLMAKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVNEL 212

Query:   447 KALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAG 572
             +  ++ + +     +L+  ++E D DG G I F EF  +M G
Sbjct:   213 RTTMRSLGETKQKLELQDMINEADADGDGTISFSEFVCVMTG 254

 Score = 127 (44.7 bits), Expect = 4.6e-05, P = 4.6e-05
 Identities = 26/63 (41%), Positives = 40/63 (63%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E RE+FRLFDK G+G I++  L  +++ I +  +   L+  ++E D DG G I+F EF  
Sbjct:    12 EYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGTIDFPEFLC 71

Query:   561 LMA 569
             +MA
Sbjct:    72 VMA 74

 Score = 126 (44.4 bits), Expect = 6.0e-05, P = 6.0e-05
 Identities = 29/105 (27%), Positives = 56/105 (53%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   GYI   ++   M ++ +   + +L+ +I + DADG G 
Sbjct:   183 QLTDDQILEFREAFRVFDKNGDGYITVNELRTTMRSLGETKQKLELQDMINEADADGDGT 242

Query:   309 LEFDEF-CALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPT 443
             + F EF C +   + +T  K       +E +R+ + +G G + R T
Sbjct:   243 ISFSEFVCVMTGKMIDTQSK-------KETYRVVN-QGQGQVQRHT 280

 Score = 89 (31.3 bits), Expect = 1.0, P = 0.64
 Identities = 36/164 (21%), Positives = 74/164 (45%), Frame = +3

Query:   108 DIDEIL--AEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDE-KQLRKLI 278
             D+ +++  A++DG    ++ +F  +  +  QG+  A +  +   A +   D+  + R+  
Sbjct:    48 DLQDLMNEADLDGDGTIDFPEFLCVMAKN-QGHDQAPRHTKKTMADKLTDDQITEYRESF 106

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
             R FD +G G +   E   +++++     K  LQ  + E     D +G+G I  P    L+
Sbjct:   107 RLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEV----DLDGDGTIDFPEFLYLM 162

Query:   459 -KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD*TITVD 599
              K    D +    +  + +        +EF E + +   + D  ITV+
Sbjct:   163 AKNQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVN 210

 Score = 81 (28.5 bits), Expect = 8.2, P = 1.0
 Identities = 32/145 (22%), Positives = 66/145 (45%), Frame = +3

Query:   108 DIDEILAEID--GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEK--QLRKL 275
             D+ +++ E+D  G    ++ +F  +  +  QG+  A +  +      Q  D++  + R+ 
Sbjct:   137 DLQDMMNEVDLDGDGTIDFPEFLYLMAKN-QGHDQAPRHTKKTMVDYQLTDDQILEFREA 195

Query:   276 IRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
              R FD +G G +  +E    + ++  T  K  LQ  + EA    D +G+G IS      +
Sbjct:   196 FRVFDKNGDGYITVNELRTTMRSLGETKQKLELQDMINEA----DADGDGTISFSEFVCV 251

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIE 542
             +      + D Q +     +   G G+++
Sbjct:   252 M---TGKMIDTQSKKETYRVVNQGQGQVQ 277


>gnl|PID|e340031 (Y14764) calmodulin [Lycopersicon esculentum]
            Length = 118

  Plus Strand HSPs:

 Score = 214 (75.3 bits), Expect = 6.8e-17, P = 6.8e-17
 Identities = 41/121 (33%), Positives = 76/121 (62%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     1 QIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 60

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+       D E   +EL+EAFR+FD++ NG+IS   L+ ++  + + L+DE+++  
Sbjct:    61 FLNLMARKMKDTDSE---EELKEAFRVFDEDQNGFISAAELRHVMTNLGEKLTDEEVDEM 117

Query:   504 V 506
             +
Sbjct:   118 I 118

 Score = 139 (48.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 25/63 (39%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     4 EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 63

Query:   561 LMA 569
             LMA
Sbjct:    64 LMA 66

 Score = 102 (35.9 bits), Expect = 0.00019, P = 0.00019
 Identities = 29/102 (28%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     4 EFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 59

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E+L+ A    DED +G I   E   +M
Sbjct:    60 EFLNLMARKMKDTDSEEELKEAFRVFDEDQNGFISAAELRHVM 102


>gi|2213610 (AC000103) F21J9.4 [Arabidopsis thaliana]
            Length = 186

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 47/142 (33%), Positives = 80/142 (56%), Frame = +3

Query:   141 SQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFD 320
             ++I E +  F  FD    G I + ++G IM ++  +  E++L K I + D  G G + F+
Sbjct:    33 TEIRELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEIDRKGDGYINFE 92

Query:   321 EFCALVYTVANT--VDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQL 494
             EF  L     NT  +D+  + + L++AF ++D +GNG IS   L  +L+ + D+ S  + 
Sbjct:    93 EFVEL-----NTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAEC 147

Query:   495 EAAVDEIDEDGSGKIEFEEFWELM 566
                +  +D+DG G I+FEEF  +M
Sbjct:   148 RKMIGGVDKDGDGTIDFEEFKIMM 171

 Score = 135 (47.5 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 29/75 (38%), Positives = 42/75 (56%), Frame = +3

Query:   378 KELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFW 557
             +EL   F+ FD  G+G IS   L A++  +  ++ +E+LE A+ EID  G G I FEEF 
Sbjct:    36 RELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEIDRKGDGYINFEEFV 95

Query:   558 ELMAGDAD*TITVDN 602
             EL     D    ++N
Sbjct:    96 ELNTKGMDQNDVLEN 110

 Score = 126 (44.4 bits), Expect = 5.9e-06, P = 5.9e-06
 Identities = 34/108 (31%), Positives = 58/108 (53%), Frame = +3

Query:   258 KQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISR 437
             ++L  + +KFD +G GK+   E  A++ ++ + V +E L+K + E     D++G+GYI+ 
Sbjct:    36 RELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITE----IDRKGDGYINF 91

Query:   438 PTLKALLKEIADDLSD--EQLEAAVDEIDEDGSGKIEFEEFWELMAGDAD 581
                  L  +  D  +D  E L+ A    D DG+G I  EE  E++    D
Sbjct:    92 EEFVELNTKGMDQ-NDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD 140

 Score = 94 (33.1 bits), Expect = 0.082, P = 0.079
 Identities = 25/118 (21%), Positives = 58/118 (49%), Frame = +3

Query:     9 QMVEQQLEKL*TKLHPLHNFEFQFQHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRG 188
             ++ E++LEK  T++    +    F+    +  + +D+         +E  +  F ++D  
Sbjct:    68 EVPEEELEKAITEIDRKGDGYINFEEFVELNTKGMDQ------NDVLENLKDAFSVYDID 121

Query:   189 KQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVD 362
               G I A ++ +++ ++  +    + RK+I   D DG G ++F+EF  ++ T+ +  D
Sbjct:   122 GNGSISAEELHEVLRSLGDECSIAECRKMIGGVDKDGDGTIDFEEF-KIMMTMGSRRD 178

 Score = 88 (31.0 bits), Expect = 0.43, P = 0.35
 Identities = 29/121 (23%), Positives = 58/121 (47%), Frame = +3

Query:    96 IMAEDIDEILAEIDGSQI--EEYQKFFDMFDRGKQGYIMATQIGQI-MHAMEQDFDEKQL 266
             I ++++  I+  + G ++  EE +K     DR   GYI   +  ++    M+Q+   + L
Sbjct:    53 ISSKELGAIMTSL-GHEVPEEELEKAITEIDRKGDGYINFEEFVELNTKGMDQNDVLENL 111

Query:   267 RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTL 446
             +     +D DG+G +  +E    ++ V  ++  E    E R+     DK+G+G I     
Sbjct:   112 KDAFSVYDIDGNGSISAEE----LHEVLRSLGDECSIAECRKMIGGVDKDGDGTIDFEEF 167

Query:   447 KALL 458
             K ++
Sbjct:   168 KIMM 171


>gnl|PID|e353158 (Z99707) caltractin [Arabidopsis thaliana]
            Length = 167

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 41/138 (29%), Positives = 83/138 (60%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E ++ FD+FD    G I A+++   M ++  + + +Q+ +L+ + D + SG ++FDEF  
Sbjct:    27 EIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVDKNQSGAIDFDEFVH 86

Query:   333 LVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             ++ T     +++++  EL +AF++ D + NG IS   +K + KE+ ++ +D  +E  ++E
Sbjct:    87 MMTTKFG--ERDSID-ELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEE 143

Query:   513 IDEDGSGKIEFEEFWELM 566
              D D  G++  EEF ++M
Sbjct:   144 ADRDKDGEVNLEEFMKMM 161

 Score = 120 (42.2 bits), Expect = 7.4e-06, P = 7.4e-06
 Identities = 21/64 (32%), Positives = 42/64 (65%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             ++E+RE F LFD +G+G I    L   ++ +  +++++Q+   + E+D++ SG I+F+EF
Sbjct:    25 RREIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVDKNQSGAIDFDEF 84

Query:   555 WELM 566
               +M
Sbjct:    85 VHMM 88

 Score = 81 (28.5 bits), Expect = 2.2, P = 0.89
 Identities = 16/64 (25%), Positives = 31/64 (48%), Frame = +3

Query:   147 IEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             I+E  K F + D    G I    I  I   + ++F +  + ++I + D D  G++  +EF
Sbjct:    98 IDELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADRDKDGEVNLEEF 157

Query:   327 CALV 338
               ++
Sbjct:   158 MKMM 161

 Score = 76 (26.8 bits), Expect = 8.5, P = 1.0
 Identities = 22/94 (23%), Positives = 46/94 (48%), Frame = +3

Query:   258 KQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISR 437
             +++R++   FD DGSG ++  E    + ++   ++ + + + + E     DK  +G I  
Sbjct:    26 REIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEV----DKNQSGAIDF 81

Query:   438 PTLKALLK-EIADDLSDEQLEAAVDEIDEDGSGKI 539
                  ++  +  +  S ++L  A   ID D +GKI
Sbjct:    82 DEFVHMMTTKFGERDSIDELSKAFKIIDHDNNGKI 116


>sp|P05434|CATR_CHLRE CALTRACTIN (CENTRIN) (20 KD CALCIUM-BINDING PROTEIN)
            >pir||BCKM caltractin - Chlamydomonas reinhardtii >gi|18127
            (X12634) caltractin (AA 1 - 169) [Chlamydomonas reinhardtii]
            >gi|18133 (X57973) caltractin [Chlamydomonas reinhardtii]
            Length = 169

  Plus Strand HSPs:

 Score = 212 (74.6 bits), Expect = 1.1e-16, P = 1.1e-16
 Identities = 43/141 (30%), Positives = 89/141 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             Q +E ++ FD+FD    G I A ++   M A+  +  +++++K+I + D DGSG ++F+E
Sbjct:    26 QKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEE 85

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  ++   A   ++++ ++E+ +AFRLFD + +G I+   L+ + KE+ ++L++E+L+  
Sbjct:    86 FLTMM--TAKMGERDS-REEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEM 142

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             + E D +   +I+ +EF  +M
Sbjct:   143 IAEADRNDDNEIDEDEFIRIM 163

 Score = 146 (51.4 bits), Expect = 2.1e-09, P = 2.1e-09
 Identities = 28/67 (41%), Positives = 44/67 (65%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+REAF LFD +G+G I    LK  ++ +  +   E+++  + EID+DGSG I+F
Sbjct:    24 EEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDF 83

Query:   546 EEFWELM 566
             EEF  +M
Sbjct:    84 EEFLTMM 90

 Score = 92 (32.4 bits), Expect = 0.10, P = 0.099
 Identities = 28/100 (28%), Positives = 50/100 (50%), Frame = +3

Query:   252 DEKQ-LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGY 428
             ++KQ +R+    FD DGSG ++  E    +  +     KE ++K + E     DK+G+G 
Sbjct:    25 EQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISE----IDKDGSGT 80

Query:   429 IS-RPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEE 551
             I     L  +  ++ +  S E++  A    D+D SG I  ++
Sbjct:    81 IDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKD 122

 Score = 76 (26.8 bits), Expect = 8.8, P = 1.0
 Identities = 15/63 (23%), Positives = 34/63 (53%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             EE  K F +FD    G I    + ++   + ++  E++L+++I + D +   +++ DEF 
Sbjct:   101 EEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFI 160

Query:   330 ALV 338
              ++
Sbjct:   161 RIM 163


>sp|P14649|MLEY_HUMAN MYOSIN LIGHT CHAIN 1, SLOW-TWITCH MUSCLE A ISOFORM
            (MLC1SA) (ALKALI) >pir||MOHUSA myosin alkali light chain, slow
            skeletal muscle - human >gi|34676 (X16434) myosin alkali light
            chain (AA 1-208) [Homo sapiens] >gi|188583 (M31211) myosin light
            chain 1 slow [Homo sapiens]
            Length = 208

  Plus Strand HSPs:

 Score = 208 (73.2 bits), Expect = 2.9e-16, P = 2.9e-16
 Identities = 46/149 (30%), Positives = 88/149 (59%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR-- 281
             D+ +++ E +  Q+EE+++ F++FDR   G I+ +Q G +M A+ Q+    ++ K++   
Sbjct:    53 DLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNP 112

Query:   282 KFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
             K D   S +++F+ F  ++  VA    + T +  L E FR+FDKEGNG +    L+ +L 
Sbjct:   113 KSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYL-EGFRVFDKEGNGKVMGAELRHVLT 171

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + +++E++E  +    ED +G I +E F
Sbjct:   172 TLGEKMTEEEVETVLAG-HEDSNGCINYEAF 201


>gi|2583169 (AF026473) calmodulin-related protein [Arabidopsis thaliana]
            Length = 161

  Plus Strand HSPs:

 Score = 207 (72.9 bits), Expect = 3.7e-16, P = 3.7e-16
 Identities = 41/144 (28%), Positives = 82/144 (56%), Frame = +3

Query:   138 GSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEF 317
             GS +++ +K F  FD+   G I   ++ +++ A+      ++   ++++FD DG+G ++ 
Sbjct:    13 GS-MDDIKKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDL 71

Query:   318 DEFCALVYT-VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQL 494
             DEF AL    +    +      +L+EAF L+D +GNG IS   L +++K + +  S +  
Sbjct:    72 DEFVALFQIGIGGGGNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDC 131

Query:   495 EAAVDEIDEDGSGKIEFEEFWELMA 569
             +  + ++D DG G + F+EF ++M+
Sbjct:   132 KKMISKVDIDGDGCVNFDEFKKMMS 156

 Score = 108 (38.0 bits), Expect = 0.00056, P = 0.00056
 Identities = 30/102 (29%), Positives = 55/102 (53%), Frame = +3

Query:   264 LRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPT 443
             ++K+ ++FD +G GK+  DE   ++  ++ T   E     +++    FD +GNG+I    
Sbjct:    18 IKKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQ----FDLDGNGFIDLDE 73

Query:   444 LKALLK-------EIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               AL +          +D+SD  L+ A +  D DG+G+I  +E   +M
Sbjct:    74 FVALFQIGIGGGGNNRNDVSD--LKEAFELYDLDGNGRISAKELHSVM 119

 Score = 101 (35.6 bits), Expect = 0.0058, P = 0.0058
 Identities = 19/58 (32%), Positives = 36/58 (62%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             ++++ F+ FDK G+G IS   LK +++ ++   S E+    + + D DG+G I+ +EF
Sbjct:    17 DIKKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLDGNGFIDLDEF 74

 Score = 93 (32.7 bits), Expect = 0.062, P = 0.060
 Identities = 17/62 (27%), Positives = 34/62 (54%), Frame = +3

Query:   141 SQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFD 320
             + + + ++ F+++D    G I A ++  +M  + +    +  +K+I K D DG G + FD
Sbjct:    90 NDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCKKMISKVDIDGDGCVNFD 149

Query:   321 EF 326
             EF
Sbjct:   150 EF 151


>sp|P15845|SM20_SCHMA 20 KD CALCIUM-BINDING PROTEIN (ANTIGEN SM20) >gi|161085
            (M94045) calcium binding protein [Schistosoma mansoni]
            Length = 154

  Plus Strand HSPs:

 Score = 205 (72.2 bits), Expect = 6.1e-16, P = 6.1e-16
 Identities = 48/159 (30%), Positives = 87/159 (54%), Frame = +3

Query:    99 MAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLI 278
             MA  ID+   + D  Q++  +  F  FD+  Q  I  T +G    A+        L++  
Sbjct:     1 MAFKIDDFTIQED--QVKIAKDVFKRFDKRGQEKISTTDLGPAFRALNLTVKPDTLKEWA 58

Query:   279 RKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
              + D D +G ++F+ F  + Y      D++  +++LR+AFR+ DK   G I    L+ +L
Sbjct:    59 DQVDDDATGFIDFNGFL-ICYGKKLQEDQD--ERDLRDAFRVLDKNKRGEIDVEDLRWIL 115

Query:   459 KEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELMAGD 575
             K + DDL++E+++  + + D DGSG ++F+EF++LM  +
Sbjct:   116 KGLGDDLTEEEIDDMIRDTDTDGSGFVDFDEFYKLMTSE 154

 Score = 99 (34.8 bits), Expect = 0.0076, P = 0.0075
 Identities = 20/57 (35%), Positives = 33/57 (57%), Frame = +3

Query:   168 FDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCALV 338
             F + D+ K+G I    +  I+  +  D  E+++  +IR  D DGSG ++FDEF  L+
Sbjct:    95 FRVLDKNKRGEIDVEDLRWILKGLGDDLTEEEIDDMIRDTDTDGSGFVDFDEFYKLM 151

 Score = 82 (28.9 bits), Expect = 1.2, P = 0.71
 Identities = 20/74 (27%), Positives = 38/74 (51%), Frame = +3

Query:   345 VANTVDKETLQKE----LREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDE 512
             +A  +D  T+Q++     ++ F+ FDK G   IS   L    + +   +  + L+   D+
Sbjct:     1 MAFKIDDFTIQEDQVKIAKDVFKRFDKRGQEKISTTDLGPAFRALNLTVKPDTLKEWADQ 60

Query:   513 IDEDGSGKIEFEEF 554
             +D+D +G I+F  F
Sbjct:    61 VDDDATGFIDFNGF 74


>gnl|PID|e333742 (AJ001092) calmodulin-like protein [Branchiostoma lanceolatum]
            Length = 104

  Plus Strand HSPs:

 Score = 203 (71.5 bits), Expect = 9.9e-16, P = 9.9e-16
 Identities = 39/105 (37%), Positives = 67/105 (63%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G ++F E
Sbjct:     2 QIAEFKEAFSLFDKDGDGTITTRELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 61

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALL 458
             F  ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++
Sbjct:    62 FLTMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVM 103

 Score = 135 (47.5 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 24/63 (38%), Positives = 43/63 (68%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D DG+G I+F EF  
Sbjct:     5 EFKEAFSLFDKDGDGTITTRELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 64

Query:   561 LMA 569
             +MA
Sbjct:    65 MMA 67

 Score = 103 (36.3 bits), Expect = 0.00014, P = 0.00014
 Identities = 28/102 (27%), Positives = 50/102 (49%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             + ++    FD DG G +   E    + TV  ++ +   + EL++     D +GNG I  P
Sbjct:     5 EFKEAFSLFDKDGDGTITTRE----LGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 60

Query:   441 T-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
               L  + +++ D  S+E++  A    D+DG+G I   E   +M
Sbjct:    61 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM 103


>gi|17352 (Z18162) calmodulin 1 [Arabidopsis thaliana]
          Length = 106

  Plus Strand HSPs:

 Score = 203 (71.5 bits), Expect = 9.9e-16, P = 9.9e-16
 Identities = 40/102 (39%), Positives = 66/102 (64%), Frame = +3

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             +L+ +I +  ADG+G ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS  
Sbjct:     5 ELQDMINEVXADGNGTIDFPEFLNLMAKKMKDTDSE---EELKEAFRVFDKDQNGFISAA 61

Query:   441 TLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
              L+ ++  + + L+DE++E  + E D DG G+I +EEF ++M
Sbjct:    62 ELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIM 103

 Score = 112 (39.4 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 18/68 (26%), Positives = 42/68 (61%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+ + G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    36 DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQIN 95

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:    96 YEEFVKIM 103

 Score = 72 (25.3 bits), Expect = 3.0, P = 0.95
 Identities = 20/63 (31%), Positives = 32/63 (50%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFW 557
             EL++       +GNG I  P  L  + K++ D  S+E+L+ A    D+D +G I   E  
Sbjct:     5 ELQDMINEVXADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELR 64

Query:   558 ELM 566
              +M
Sbjct:    65 HVM 67

 Score = 70 (24.6 bits), Expect = 6.8, P = 1.0
 Identities = 26/94 (27%), Positives = 44/94 (46%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFD-EKQLRKLIRKFDADGSGKLEFDEFC 329
             E Q   +       G I   +   +M    +D D E++L++  R FD D +G +   E  
Sbjct:     5 ELQDMINEVXADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAE-- 62

Query:   330 ALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
              L + + N  +K T  +E+ E  R  D +G+G I+
Sbjct:    63 -LRHVMTNLGEKLT-DEEVEEMIREADVDGDGQIN 95


>sp|P06706|TPC_HALRO TROPONIN C, BODY WALL MUSCLE >pir||A28853 troponin C,
            smooth muscle - sea squirt (Halocynthia roretzi) >prf||1001179A
            troponin C [Halocynthia roretzi]
            Length = 155

  Plus Strand HSPs:

 Score = 203 (71.5 bits), Expect = 9.9e-16, P = 9.9e-16
 Identities = 51/150 (34%), Positives = 89/150 (59%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDR-GKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDA 293
             E L E + SQ   ++  FD+F    K G I + ++G++M  + Q+  EK L+++I + D 
Sbjct:     2 EHLTEDEKSQ---FRAAFDIFVADAKDGTISSKELGKVMKMLGQNPTEKDLQEMIEEVDI 58

Query:   294 DGSGKLEFDEFCALVYTVANTVDK----ETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
             DGSG ++F+EFC ++Y      ++    E  +KEL EAFRLFD +G+G      LKA L 
Sbjct:    59 DGSGTIDFEEFCLMMYRQMQAQEEAKIPEREEKELSEAFRLFDLDGDGIGDE--LKAALD 116

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
                +++   +++  + + D++   +I++EE W  M
Sbjct:   117 GTGENVETWEVDEMMADGDKNHDSQIDYEE-WVTM 150

 Score = 105 (37.0 bits), Expect = 0.0010, P = 0.0010
 Identities = 23/68 (33%), Positives = 41/68 (60%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEG-NGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIE 542
             E  + + R AF +F  +  +G IS   L  ++K +  + +++ L+  ++E+D DGSG I+
Sbjct:     6 EDEKSQFRAAFDIFVADAKDGTISSKELGKVMKMLGQNPTEKDLQEMIEEVDIDGSGTID 65

Query:   543 FEEFWELM 566
             FEEF  +M
Sbjct:    66 FEEFCLMM 73


>sp|P30187|CBP2_ARATH 22 KD CALMODULIN-LIKE CALCIUM-BINDING PROTEIN (CABP-22)
            >pir||S35188 calmodulin-related protein (clone CaBP-22) -
            Arabidopsis thaliana >gi|16209 (Z12136) calcium binding protein
            [Arabidopsis thaliana]
            Length = 191

  Plus Strand HSPs:

 Score = 200 (70.4 bits), Expect = 2.1e-15, P = 2.1e-15
 Identities = 44/141 (31%), Positives = 80/141 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI E+++ F ++D+   G+I   + G +M ++  +  + +L++ I   D DG G + F E
Sbjct:     9 QISEFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTE 68

Query:   324 F-CALVYTVANTVDKETL-QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLE 497
             F CA+         K+T  +K+L++ FRLFD + NG+IS   ++ +   +    +DE+++
Sbjct:    69 FLCAMA--------KDTYSEKDLKKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEID 120

Query:   498 AAVDEIDEDGSGKIEFEEFWELM 566
               +   D DG G+I + EF  LM
Sbjct:   121 EIIKAADVDGDGQINYREFARLM 143

 Score = 121 (42.6 bits), Expect = 3.7e-05, P = 3.7e-05
 Identities = 25/77 (32%), Positives = 45/77 (58%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +AN   ++ +  E RE F ++DK G+G+I+     A+++ +  +L+  +L+  +++ D D
Sbjct:     1 MANKFTRQQIS-EFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLD 59

Query:   525 GSGKIEFEEFWELMAGD 575
             G G I F EF   MA D
Sbjct:    60 GDGTINFTEFLCAMAKD 76

 Score = 88 (31.0 bits), Expect = 0.46, P = 0.37
 Identities = 16/63 (25%), Positives = 36/63 (57%), Frame = +3

Query:   150 EEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFC 329
             ++ +K F +FD  K G+I A ++  +   +     ++++ ++I+  D DG G++ + EF 
Sbjct:    81 KDLKKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAADVDGDGQINYREFA 140

Query:   330 ALV 338
              L+
Sbjct:   141 RLM 143


>gi|2288981 (AC002335) calcium binding protein isolog [Arabidopsis thaliana]
            Length = 169

  Plus Strand HSPs:

 Score = 198 (69.7 bits), Expect = 3.3e-15, P = 3.3e-15
 Identities = 39/144 (27%), Positives = 84/144 (58%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E ++ F MFD+   G I   ++   +  +     +K L ++I K DA+G G ++ DEF +
Sbjct:    19 ELKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDIDEFES 78

Query:   333 LVYTVANTV--DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIA--DDLSDEQLEA 500
             L  ++ +    D ET ++++++AF +FD++G+G+I+   LK+++  +      + +  + 
Sbjct:    79 LYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGCKK 138

Query:   501 AVDEIDEDGSGKIEFEEFWELMAG 572
              + ++D DG G++ ++EF ++M G
Sbjct:   139 MIMQVDADGDGRVNYKEFLQMMKG 162

 Score = 107 (37.7 bits), Expect = 0.0012, P = 0.0012
 Identities = 21/67 (31%), Positives = 38/67 (56%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             EL+  F++FDK G+G I++  L   L+ +   + D+ L   + +ID +G G ++ +EF  
Sbjct:    19 ELKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDIDEFES 78

Query:   561 LMAGDAD 581
             L +   D
Sbjct:    79 LYSSIVD 85

 Score = 94 (33.1 bits), Expect = 0.058, P = 0.057
 Identities = 26/108 (24%), Positives = 51/108 (47%), Frame = +3

Query:   252 DEKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYI 431
             D  +L+++ + FD +G G++  +E    +  +   +      K+L +     D  G+G +
Sbjct:    16 DPSELKRVFQMFDKNGDGRITKEELNDSLENLGIYIP----DKDLTQMIHKIDANGDGCV 71

Query:   432 SRPTLKALLKEIADD------LSDEQLEAAVDEIDEDGSGKIEFEEFWELMA 569
                  ++L   I D+        +E ++ A +  D+DG G I  EE   +MA
Sbjct:    72 DIDEFESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSVMA 123

 Score = 89 (31.3 bits), Expect = 0.24, P = 0.22
 Identities = 21/71 (29%), Positives = 39/71 (54%), Frame = +3

Query:   135 DGSQIEEYQK-FFDMFDRGKQGYIMATQIGQIMHAM--EQDFDEKQLRKLIRKFDADGSG 305
             DG   EE  K  F++FD+   G+I   ++  +M ++  +Q       +K+I + DADG G
Sbjct:    90 DGETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGCKKMIMQVDADGDG 149

Query:   306 KLEFDEFCALV 338
             ++ + EF  ++
Sbjct:   150 RVNYKEFLQMM 160


>pir||S45681 troponin C - scallop (Chlamys nipponensis) >gnl|PID|d1013593
            (D85883) Troponin C [Chlamys nipponesis akazara]
            Length = 153

  Plus Strand HSPs:

 Score = 198 (69.7 bits), Expect = 3.3e-15, P = 3.3e-15
 Identities = 44/145 (30%), Positives = 85/145 (58%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI + ++ F  FD+ K+G +    +G I  ++     + +++    + D + +G+L  ++
Sbjct:    11 QISDAKQAFCNFDKKKEGTVSCKDLGAIFKSLGLVMKDDKIKDWSDEVDEEATGRLSCEQ 70

Query:   324 FCALV-YTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEA 500
             +  L  + +   +D    ++EL+EAFR+ DKE  G I    L+ +LK + D+L+++++E 
Sbjct:    71 WLKLFEWKLKEDLD----ERELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIEN 126

Query:   501 AVDEIDEDGSGKIEFEEFWELM-AGDA 578
              + E D DGSG +++EEF  LM + DA
Sbjct:   127 MIAETDTDGSGTVDYEEFKCLMMSSDA 153

 Score = 93 (32.7 bits), Expect = 0.048, P = 0.046
 Identities = 18/61 (29%), Positives = 38/61 (62%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEFWE 560
             + ++AF  FDK+  G +S   L A+ K +   + D++++   DE+DE+ +G++  E++ +
Sbjct:    14 DAKQAFCNFDKKKEGTVSCKDLGAIFKSLGLVMKDDKIKDWSDEVDEEATGRLSCEQWLK 73

Query:   561 L 563
             L
Sbjct:    74 L 74

 Score = 91 (32.0 bits), Expect = 0.088, P = 0.085
 Identities = 17/62 (27%), Positives = 36/62 (58%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E ++ F + D+ K+G I    +  I+ ++  +  E ++  +I + D DGSG ++++EF  
Sbjct:    87 ELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIENMIAETDTDGSGTVDYEEFKC 146

Query:   333 LV 338
             L+
Sbjct:   147 LM 148


>sp|P06704|CC31_YEAST CELL DIVISION CONTROL PROTEIN 31 >pir||S47549 cell
            division control protein CDC31 - yeast (Saccharomyces cerevisiae)
            >gi|525276 (X74500) Cdc31p [Saccharomyces cerevisiae]
            >gnl|PID|e252110 (Z75165) ORF YOR257w [Saccharomyces cerevisiae]
            Length = 161

  Plus Strand HSPs:

 Score = 193 (67.9 bits), Expect = 1.1e-14, P = 1.1e-14
 Identities = 43/158 (27%), Positives = 87/158 (55%), Frame = +3

Query:    81 QHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEK 260
             ++R ++ +  ++  L E    Q +E  + F +FD    G++   ++   M A+  +  ++
Sbjct:     3 KNRSSLQSGPLNSELLE---EQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKR 59

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             ++  LI ++D++G   +++D+F  ++      + K     E++ AF+LFD +  G IS  
Sbjct:    60 EILDLIDEYDSEGRHLMKYDDFYIVM---GEKILKRDPLDEIKRAFQLFDDDHTGKISIK 116

Query:   441 TLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              L+ + KE+ + L+DE+L A ++E D DG G+I   EF
Sbjct:   117 NLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEF 154

 Score = 103 (36.3 bits), Expect = 0.0030, P = 0.0030
 Identities = 21/91 (23%), Positives = 47/91 (51%), Frame = +3

Query:    69 EFQFQHRQAIMAEDIDEILAE--IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAME 242
             E+  + R  +  +D   ++ E  +    ++E ++ F +FD    G I    + ++   + 
Sbjct:    67 EYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELG 126

Query:   243 QDFDEKQLRKLIRKFDADGSGKLEFDEFCAL 335
             +   +++LR +I +FD DG G++  +EF A+
Sbjct:   127 ETLTDEELRAMIEEFDLDGDGEINENEFIAI 157

 Score = 102 (35.9 bits), Expect = 0.0041, P = 0.0041
 Identities = 19/67 (28%), Positives = 39/67 (58%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+ EAF LFD   +G++    LK  +K +  +L   ++   +DE D +G   +++
Sbjct:    19 EEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKY 78

Query:   546 EEFWELM 566
             ++F+ +M
Sbjct:    79 DDFYIVM 85


>gnl|PID|e340032 (Y14765) calmodulin [Lycopersicon esculentum]
            Length = 111

  Plus Strand HSPs:

 Score = 192 (67.6 bits), Expect = 1.4e-14, P = 1.4e-14
 Identities = 41/109 (37%), Positives = 67/109 (61%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++   QI E+++ F +FD+   G I   ++G +M ++ Q+  E +L+ +I + DADG+G 
Sbjct:     4 QLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT 63

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISR-PTLKAL 455
             ++F EF  L+       D E   +EL+EAFR+FDK+ NG+IS  P   AL
Sbjct:    64 IDFPEFLNLMAGKMKDTDSE---EELKEAFRVFDKDQNGFISAAPPSAAL 110

 Score = 147 (51.7 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 28/76 (36%), Positives = 50/76 (65%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A  + +E +  E +EAF LFDK+G+G I+   L  +++ +  + ++ +L+  ++E+D D
Sbjct:     1 MAEQLTEEQIS-EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query:   525 GSGKIEFEEFWELMAG 572
             G+G I+F EF  LMAG
Sbjct:    60 GNGTIDFPEFLNLMAG 75

 Score = 92 (32.4 bits), Expect = 0.0024, P = 0.0024
 Identities = 29/101 (28%), Positives = 51/101 (50%), Frame = +3

Query:   237 MEQDFDEKQL---RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLF 407
             M +   E+Q+   ++    FD DG G +   E    + TV  ++ +   + EL++     
Sbjct:     1 MAEQLTEEQISEFKEAFSLFDKDGDGCITTKE----LGTVMRSLGQNPTEAELQDMINEV 56

Query:   408 DKEGNGYISRPT-LKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             D +GNG I  P  L  +  ++ D  S+E+L+ A    D+D +G I
Sbjct:    57 DADGNGTIDFPEFLNLMAGKMKDTDSEEELKEAFRVFDKDQNGFI 101


>gi|1339865 (D85139) fast skeletal myosin light chain 1a [Cyprinus carpio]
            Length = 193

  Plus Strand HSPs:

 Score = 192 (67.6 bits), Expect = 1.4e-14, P = 1.4e-14
 Identities = 42/151 (27%), Positives = 85/151 (56%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             A D+  +  + +  Q+E+Y++ F +FDR     +   QI  IM A+ Q+   K++ K++ 
Sbjct:    36 AVDLSGVKVDFNQDQLEDYREAFGLFDRVGDNKVAYNQIADIMRALGQNPTNKEVTKILG 95

Query:   282 KFDAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
                AD   + +++F+ F  ++  V N+ +K T +  + E  R+FDKEGNG +    L+ +
Sbjct:    96 NPTADEMANKRVDFEGFLPMLQFVVNSPNKATYEDYV-EGLRVFDKEGNGTVMGAELRIV 154

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             L  + + +++ +++A +    ED +G + +E F
Sbjct:   155 LSTLGEKMTEVEIDALMQG-QEDENGCVNYEAF 186


>sp|P05976|MLE1_HUMAN MYOSIN LIGHT CHAIN 1, SKELETAL MUSCLE ISOFORM (MLC1F) (A1
            CATALYTIC) (ALKALI) >pir||MOHUA1 myosin alkali light chain 1, fast
            skeletal muscle, form 1 - human >gi|188592 (M20642) myosin light
            chain [Homo sapiens]
            Length = 194

  Plus Strand HSPs:

 Score = 191 (67.2 bits), Expect = 1.8e-14, P = 1.8e-14
 Identities = 42/149 (28%), Positives = 83/149 (55%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q +E+++ F +FDR     I  +Q+G ++ A+  +    ++RK++   
Sbjct:    39 DLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNP 98

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+ T + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    99 SNEELNAKKIEFEQFLPMMQAISNNKDQATYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 157

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   158 TLGEKMKEEEVEALMAG-QEDSNGCINYEAF 187

 Score = 77 (27.1 bits), Expect = 9.4, P = 1.0
 Identities = 19/66 (28%), Positives = 37/66 (56%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEI--DEDGSGKIEFE 548
             Q E +EAF LFD+ G+  I+   +  +L+ +  + ++ ++   +     +E  + KIEFE
Sbjct:    52 QDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFE 111

Query:   549 EFWELM 566
             +F  +M
Sbjct:   112 QFLPMM 117


>gi|1276637 (U35396) centrin ICL1c [Paramecium tetraurelia]
            Length = 182

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 2.4e-14, P = 2.4e-14
 Identities = 38/141 (26%), Positives = 79/141 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             ++ E ++ FD+FD      I   ++   M ++  +   + + ++I   D DGSG+++F E
Sbjct:    39 EVLEIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQIDFAE 98

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+   A   ++++ + ++++ F LFD E  G I+   L+ + KE+ + + D +L+  
Sbjct:    99 FLKLM--TARISERDS-KADIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEM 155

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +D  D DG  ++ FE+F+ +M
Sbjct:   156 IDRADSDGDAQVTFEDFYNIM 176

 Score = 120 (42.2 bits), Expect = 3.5e-05, P = 3.5e-05
 Identities = 25/69 (36%), Positives = 42/69 (60%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             ++E L  E++EAF LFD +G   I    LKA +  +  +  ++ +   + ++D DGSG+I
Sbjct:    37 EEEVL--EIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQI 94

Query:   540 EFEEFWELM 566
             +F EF +LM
Sbjct:    95 DFAEFLKLM 103

 Score = 93 (32.7 bits), Expect = 0.10, P = 0.096
 Identities = 15/58 (25%), Positives = 35/58 (60%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             + QK F++FD  + G I    + ++   + +  D+ +L+++I + D+DG  ++ F++F
Sbjct:   115 DIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEMIDRADSDGDAQVTFEDF 172


>gi|1276639 (U35397) centrin ICL1b [Paramecium tetraurelia] >gi|1666903
            (U76539) centrin [Paramecium tetraurelia]
            Length = 181

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 2.4e-14, P = 2.4e-14
 Identities = 38/141 (26%), Positives = 79/141 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             ++ E ++ FD+FD      I   ++   M ++  +   + + ++I   D DGSG+++F E
Sbjct:    38 EVLEIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQIDFAE 97

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+   A   ++++ + ++++ F LFD E  G I+   L+ + KE+ + + D +L+  
Sbjct:    98 FLKLM--TARISERDS-KADIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEM 154

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +D  D DG  ++ FE+F+ +M
Sbjct:   155 IDRADSDGDAQVTFEDFYNIM 175

 Score = 120 (42.2 bits), Expect = 3.3e-05, P = 3.3e-05
 Identities = 25/69 (36%), Positives = 42/69 (60%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             ++E L  E++EAF LFD +G   I    LKA +  +  +  ++ +   + ++D DGSG+I
Sbjct:    36 EEEVL--EIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQI 93

Query:   540 EFEEFWELM 566
             +F EF +LM
Sbjct:    94 DFAEFLKLM 102

 Score = 93 (32.7 bits), Expect = 0.099, P = 0.094
 Identities = 15/58 (25%), Positives = 35/58 (60%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             + QK F++FD  + G I    + ++   + +  D+ +L+++I + D+DG  ++ F++F
Sbjct:   114 DIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEMIDRADSDGDAQVTFEDF 171


>gi|1667586 (U76540) ICL1d centrin [Paramecium tetraurelia]
            Length = 181

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 2.4e-14, P = 2.4e-14
 Identities = 38/141 (26%), Positives = 79/141 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             ++ E ++ FD+FD      I   ++   M ++  +   + + ++I   D DGSG+++F E
Sbjct:    38 EVLEIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQIDFAE 97

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+   A   ++++ + ++++ F LFD E  G I+   L+ + KE+ + + D +L+  
Sbjct:    98 FLKLM--TARISERDS-KADIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEM 154

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +D  D DG  ++ FE+F+ +M
Sbjct:   155 IDRADSDGDAQVTFEDFYNIM 175

 Score = 120 (42.2 bits), Expect = 3.3e-05, P = 3.3e-05
 Identities = 25/69 (36%), Positives = 42/69 (60%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             ++E L  E++EAF LFD +G   I    LKA +  +  +  ++ +   + ++D DGSG+I
Sbjct:    36 EEEVL--EIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQI 93

Query:   540 EFEEFWELM 566
             +F EF +LM
Sbjct:    94 DFAEFLKLM 102

 Score = 93 (32.7 bits), Expect = 0.099, P = 0.094
 Identities = 15/58 (25%), Positives = 35/58 (60%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             + QK F++FD  + G I    + ++   + +  D+ +L+++I + D+DG  ++ F++F
Sbjct:   114 DIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEMIDRADSDGDAQVTFEDF 171


>sp|Q27179|CAT2_PARTE CALTRACTIN ICL1B (CENTRIN)
            Length = 182

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 2.4e-14, P = 2.4e-14
 Identities = 38/141 (26%), Positives = 79/141 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             ++ E ++ FD+FD      I   ++   M ++  +   + + ++I   D DGSG+++F E
Sbjct:    39 EVLEIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQIDFAE 98

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+   A   ++++ + ++++ F LFD E  G I+   L+ + KE+ + + D +L+  
Sbjct:    99 FLKLM--TARISERDS-KADIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEM 155

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +D  D DG  ++ FE+F+ +M
Sbjct:   156 IDRADSDGDAQVTFEDFYNIM 176

 Score = 120 (42.2 bits), Expect = 3.5e-05, P = 3.5e-05
 Identities = 25/69 (36%), Positives = 42/69 (60%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             ++E L  E++EAF LFD +G   I    LKA +  +  +  ++ +   + ++D DGSG+I
Sbjct:    37 EEEVL--EIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQI 94

Query:   540 EFEEFWELM 566
             +F EF +LM
Sbjct:    95 DFAEFLKLM 103

 Score = 93 (32.7 bits), Expect = 0.10, P = 0.096
 Identities = 15/58 (25%), Positives = 35/58 (60%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             + QK F++FD  + G I    + ++   + +  D+ +L+++I + D+DG  ++ F++F
Sbjct:   115 DIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEMIDRADSDGDAQVTFEDF 172


>sp|Q27178|CAT3_PARTE CALTRACTIN ICL1C (CENTRIN)
            Length = 183

  Plus Strand HSPs:

 Score = 190 (66.9 bits), Expect = 2.4e-14, P = 2.4e-14
 Identities = 38/141 (26%), Positives = 79/141 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             ++ E ++ FD+FD      I   ++   M ++  +   + + ++I   D DGSG+++F E
Sbjct:    40 EVLEIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQIDFAE 99

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+   A   ++++ + ++++ F LFD E  G I+   L+ + KE+ + + D +L+  
Sbjct:   100 FLKLM--TARISERDS-KADIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEM 156

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +D  D DG  ++ FE+F+ +M
Sbjct:   157 IDRADSDGDAQVTFEDFYNIM 177

 Score = 120 (42.2 bits), Expect = 3.7e-05, P = 3.7e-05
 Identities = 25/69 (36%), Positives = 42/69 (60%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             ++E L  E++EAF LFD +G   I    LKA +  +  +  ++ +   + ++D DGSG+I
Sbjct:    38 EEEVL--EIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQI 95

Query:   540 EFEEFWELM 566
             +F EF +LM
Sbjct:    96 DFAEFLKLM 104

 Score = 93 (32.7 bits), Expect = 0.10, P = 0.097
 Identities = 15/58 (25%), Positives = 35/58 (60%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             + QK F++FD  + G I    + ++   + +  D+ +L+++I + D+DG  ++ F++F
Sbjct:   116 DIQKVFNLFDSERAGVITLKDLRKVAKELGETMDDSELQEMIDRADSDGDAQVTFEDF 173


>sp|Q27177|CAT1_PARTE CALTRACTIN ICL1A (CENTRIN) >gi|1276635 (U35344) centrin
            ICL1a [Paramecium tetraurelia]
            Length = 181

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 3.0e-14, P = 3.0e-14
 Identities = 37/141 (26%), Positives = 79/141 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             ++ E ++ FD+FD      I   ++   M ++  +   + + ++I   D DGSG+++F E
Sbjct:    38 EVLEIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQIDFAE 97

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F  L+   A   ++++ + ++++ F LFD E  G ++   L+ + KE+ + + D +L+  
Sbjct:    98 FLKLM--TARISERDS-KADIQKVFNLFDSERAGVVTLKDLRKVAKELGETMDDSELQEM 154

Query:   504 VDEIDEDGSGKIEFEEFWELM 566
             +D  D DG  ++ FE+F+ +M
Sbjct:   155 IDRADSDGDAQVTFEDFYNIM 175

 Score = 120 (42.2 bits), Expect = 3.3e-05, P = 3.3e-05
 Identities = 25/69 (36%), Positives = 42/69 (60%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             ++E L  E++EAF LFD +G   I    LKA +  +  +  ++ +   + ++D DGSG+I
Sbjct:    36 EEEVL--EIKEAFDLFDTDGTQSIDPKELKAAMTSLGFEAKNQTIYQMISDLDTDGSGQI 93

Query:   540 EFEEFWELM 566
             +F EF +LM
Sbjct:    94 DFAEFLKLM 102

 Score = 92 (32.4 bits), Expect = 0.13, P = 0.12
 Identities = 14/58 (24%), Positives = 35/58 (60%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEF 326
             + QK F++FD  + G +    + ++   + +  D+ +L+++I + D+DG  ++ F++F
Sbjct:   114 DIQKVFNLFDSERAGVVTLKDLRKVAKELGETMDDSELQEMIDRADSDGDAQVTFEDF 171


>sp|P54357|MLE2_DROME MYOSIN II ESSENTIAL LIGHT CHAIN (NONMUSCLE MYOSIN
            ESSENTIAL LIGHT CHAIN) >bbs|175359 nonmuscle myosin II essential
            light chain, DnELC [Drosophila melanogaster, Peptide, 147 aa]
            >gi|1143822 (U25057) nonmuscle myosin essential light chain
            [Drosophila melanogaster]
            Length = 147

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 3.0e-14, P = 3.0e-14
 Identities = 44/150 (29%), Positives = 80/150 (53%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGS 302
             +A     Q+ E+Q+ F++FD    G I  +Q+G+ + A+ Q+  E  ++K   +   D  
Sbjct:     1 MAAYTEDQLAEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE- 59

Query:   303 GKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLS 482
              ++ F+ F  +   ++     +T   +  E  R FDK+ +GYIS   L+ LL  + + L+
Sbjct:    60 -RISFEVFLPIYQAISKARSGDTAD-DFIEGLRHFDKDASGYISSAELRHLLTTLGEKLT 117

Query:   483 DEQLEAAVDEIDEDGSGKIEFEEFWEL-MAG 572
             DE++E  +  + ED  G I +EEF  + M+G
Sbjct:   118 DEEVEQLLANM-EDQQGNINYEEFVRMVMSG 147


>gi|1181841 (U45430) fast-twitch myosin light chain 1 [Bos taurus]
            Length = 168

  Plus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 3.0e-14, P = 3.0e-14
 Identities = 42/149 (28%), Positives = 84/149 (56%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q +E+++ F +FDR  +  I  +Q+G ++ A+  +    +++K++   
Sbjct:    13 DLSAIKIEFSKQQQDEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNP 72

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF+EF  ++  ++N  D+ T + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    73 SNEEMNAKKIEFEEFLPMLQAISNNKDQGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 131

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   132 TLGEKMKEEEVEALMAG-QEDSNGCINYEAF 161


>gi|1339869 (D85141) fast skeletal myosin light chain 3 [Cyprinus carpio]
            Length = 151

  Plus Strand HSPs:

 Score = 188 (66.2 bits), Expect = 3.8e-14, P = 3.8e-14
 Identities = 41/142 (28%), Positives = 80/142 (56%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD--GS 302
             E    QIE++++ F +FDR     +   Q+  IM A+ Q+   K ++K++    AD   +
Sbjct:     4 EFSADQIEDFKEAFGLFDRVGDNKVAYNQVADIMRALGQNPTNKDVKKILGDPSADDMAN 63

Query:   303 GKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLS 482
              +++FD F  ++ TV + V K T    + E  R+FDKEGNG +    L+ +L  + + ++
Sbjct:    64 KRIDFDAFLPMLKTV-DAVQKGTYDDYV-EGLRVFDKEGNGTVMGAELRIVLSTLGEKMT 121

Query:   483 DEQLEAAVDEIDEDGSGKIEFEEF 554
             + ++++ +    ED +G + +E+F
Sbjct:   122 EPEIDSLMQG-QEDENGSVHYEDF 144


>sp|P35622|TPC_PATYE TROPONIN C (TN-C) >pir||A53051 troponin C (Ca(2+)-binding
            domains) - scallop (Patinopecten yessoensis) >bbs|143799 troponin
            C, TnC {Ca(2+)-binding domains} [Patinopecten yessoensis=Ezo-giant
            scallops, striated adductor muscle, Peptide, 152 aa]
            Length = 152

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 4.9e-14, P = 4.9e-14
 Identities = 43/145 (29%), Positives = 81/145 (55%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI + ++ F   D+ K+G +    +G I  ++     + +++    + D + +G+L  D 
Sbjct:    10 QILDAKQAFCNVDKKKEGTVSCKDLGAIFKSLGLLVKDDKIKDWSDEMDEEATGRLNCD- 68

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
               A +      + ++  ++EL+EAFR+ DKE  G I    L+ +L  + D+L++E++E  
Sbjct:    69 --AWIQLFERKLKEDLDERELKEAFRVLDKEKKGVIKVDVLRWILSSLGDELTEEEIENM 126

Query:   504 VDEIDEDGSGKIEFEEFWELM-AGDA 578
             + E D DGSG +++EEF  LM + DA
Sbjct:   127 IAETDTDGSGTVDYEEFKCLMMSSDA 152

 Score = 93 (32.7 bits), Expect = 0.046, P = 0.045
 Identities = 17/62 (27%), Positives = 37/62 (59%), Frame = +3

Query:   153 EYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDEFCA 332
             E ++ F + D+ K+G I    +  I+ ++  +  E+++  +I + D DGSG ++++EF  
Sbjct:    86 ELKEAFRVLDKEKKGVIKVDVLRWILSSLGDELTEEEIENMIAETDTDGSGTVDYEEFKC 145

Query:   333 LV 338
             L+
Sbjct:   146 LM 147

 Score = 77 (27.1 bits), Expect = 5.0, P = 0.99
 Identities = 18/68 (26%), Positives = 40/68 (58%), Frame = +3

Query:   360 DKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKI 539
             +K+ L  + ++AF   DK+  G +S   L A+ K +   + D++++   DE+DE+ +G++
Sbjct:     8 EKQIL--DAKQAFCNVDKKKEGTVSCKDLGAIFKSLGLLVKDDKIKDWSDEMDEEATGRL 65

Query:   540 EFEEFWEL 563
               + + +L
Sbjct:    66 NCDAWIQL 73


>sp|P02604|MLE1_CHICK MYOSIN LIGHT CHAIN 1, SKELETAL MUSCLE ISOFORM (A1
            CATALYTIC) (ALKALI) (MLC-1)
            Length = 190

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 4.9e-14, P = 4.9e-14
 Identities = 43/151 (28%), Positives = 82/151 (54%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             A D+  I  E    Q +++++ F +FDR     I  +Q+G I+ A+ Q+    ++ K++ 
Sbjct:    33 AIDLKSIKIEFSKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILG 92

Query:   282 KFDAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
                 +   + K+ F+EF  ++   AN  D+ T + +  E  R+FDKEGNG +    L+ +
Sbjct:    93 NPSKEEMNAKKITFEEFLPMLQAAANNKDQGTFE-DFVEGLRVFDKEGNGTVMGAELRHV 151

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             L  + + +++E++E  +    ED +G I +E F
Sbjct:   152 LATLGEKMTEEEVEELMKG-QEDSNGCINYEAF 183


>gi|602988 (L38596) MLC1f/3f gene product [Xenopus laevis]
           Length = 190

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 4.9e-14, P = 4.9e-14
 Identities = 40/151 (26%), Positives = 84/151 (55%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             A D+  +  E    Q +++++ F +FDR     I   Q+  +M A+ Q+    +++K++ 
Sbjct:    33 AFDLSSVKIEFSQDQQDDFKEAFLLFDRTGDSKIALNQVADVMRALGQNPTNAEVKKILG 92

Query:   282 KFDAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
                A+   + ++EF++F  ++  +AN  D+ + + +  E  R+FDKEGNG +    L+ +
Sbjct:    93 NPSAEEMNAKRIEFEQFLPMLQAIANNKDQGSFE-DFVEGLRVFDKEGNGTVMGAELRHV 151

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             L  + + + +E++E+ +    ED +G I +E F
Sbjct:   152 LATLGEKMREEEVESLLAG-QEDSNGCINYEAF 183


>pir||MOCHLA myosin alkali light chain 1, fast skeletal muscle, form 1 -
            chicken
            Length = 192

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 4.9e-14, P = 4.9e-14
 Identities = 43/151 (28%), Positives = 82/151 (54%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             A D+  I  E    Q +++++ F +FDR     I  +Q+G I+ A+ Q+    ++ K++ 
Sbjct:    35 AIDLKSIKIEFSKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILG 94

Query:   282 KFDAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
                 +   + K+ F+EF  ++   AN  D+ T + +  E  R+FDKEGNG +    L+ +
Sbjct:    95 NPSKEEMNAKKITFEEFLPMLQAAANNKDQGTFE-DFVEGLRVFDKEGNGTVMGAELRHV 153

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             L  + + +++E++E  +    ED +G I +E F
Sbjct:   154 LATLGEKMTEEEVEELMKG-QEDSNGCINYEAF 185


>gi|2183227 (AF001981) calmodulin-like protein [Dictyostelium discoideum]
            Length = 149

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 6.3e-14, P = 6.3e-14
 Identities = 42/144 (29%), Positives = 85/144 (59%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGS 302
             +A+ D +Q   Y++ F++FD+ K G I   ++G +M ++  +  +++L+ + ++ D DGS
Sbjct:     1 MAKEDTTQAL-YKEAFNLFDKDKDGKITIQELGIVMRSVGSNPTQQELKDIAKEID-DGS 58

Query:   303 GKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLS 482
             G ++F +F +L+       D E    ++++AF++FDK+GNGY +   LK  L  I + L+
Sbjct:    59 GLVDFSKFSSLMTRKMKYSDSEA---DIKQAFKVFDKKGNGYANIQDLKHTLTSIGEKLT 115

Query:   483 DEQLEAAVDEIDEDGSGKIEFEEF 554
              E+ +  + +  +   G+I  +EF
Sbjct:   116 KEEFDNMLKDA-KTVDGQIHVDEF 138

 Score = 113 (39.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 24/68 (35%), Positives = 42/68 (61%), Frame = +3

Query:   363 KETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIE 542
             ++T Q   +EAF LFDK+ +G I+   L  +++ +  + + ++L+    EID DGSG ++
Sbjct:     4 EDTTQALYKEAFNLFDKDKDGKITIQELGIVMRSVGSNPTQQELKDIAKEID-DGSGLVD 62

Query:   543 FEEFWELM 566
             F +F  LM
Sbjct:    63 FSKFSSLM 70


>gi|171189 (M14078) Ca2+-binding protein [Saccharomyces cerevisiae]
           Length = 161

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 6.3e-14, P = 6.3e-14
 Identities = 43/158 (27%), Positives = 86/158 (54%), Frame = +3

Query:    81 QHRQAIMAEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEK 260
             ++R ++ +  ++  L E    Q +E  + F +FD    G++   ++   M A+  +  ++
Sbjct:     3 KNRSSLQSGPLNSELLE---EQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKR 59

Query:   261 QLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRP 440
             ++  LI ++D++G   + +D+F  ++      + K     E++ AF+LFD +  G IS  
Sbjct:    60 EILDLIDEYDSEGRHLMLYDDFYIVM---GEKILKRDPLDEIKRAFQLFDDDHIGKISIK 116

Query:   441 TLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              L+ + KE+ + L+DE+L A ++E D DG G+I   EF
Sbjct:   117 NLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEF 154

 Score = 104 (36.6 bits), Expect = 0.0022, P = 0.0022
 Identities = 21/91 (23%), Positives = 48/91 (52%), Frame = +3

Query:    69 EFQFQHRQAIMAEDIDEILAE--IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAME 242
             E+  + R  ++ +D   ++ E  +    ++E ++ F +FD    G I    + ++   + 
Sbjct:    67 EYDSEGRHLMLYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHIGKISIKNLRRVAKELG 126

Query:   243 QDFDEKQLRKLIRKFDADGSGKLEFDEFCAL 335
             +   +++LR +I +FD DG G++  +EF A+
Sbjct:   127 ETLTDEELRAMIEEFDLDGDGEINENEFIAI 157

 Score = 98 (34.5 bits), Expect = 0.014, P = 0.014
 Identities = 19/67 (28%), Positives = 38/67 (56%), Frame = +3

Query:   366 ETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEF 545
             E  ++E+ EAF LFD   +G++    LK  +K +  +L   ++   +DE D +G   + +
Sbjct:    19 EEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMLY 78

Query:   546 EEFWELM 566
             ++F+ +M
Sbjct:    79 DDFYIVM 85


>prf||2112200A myosin:SUBUNIT=light chain 1 [Bos taurus]
            Length = 168

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 6.3e-14, P = 6.3e-14
 Identities = 41/149 (27%), Positives = 84/149 (56%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q +E+++ F +FDR  +  I  +Q+G ++ A+  +    +++K++   
Sbjct:    13 DLSAIKIEFSKQQQDEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNP 72

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+ T + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    73 SNEEMNAKKIEFEQFLPMLQAISNNKDQGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 131

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   132 TLGEKMKEEEVEALMAG-QEDSNGCINYEAF 161


>gi|1339867 (D85140) fast skeletal myosin light chain 1b [Cyprinus carpio]
            Length = 193

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 6.3e-14, P = 6.3e-14
 Identities = 41/151 (27%), Positives = 84/151 (55%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             A D+  +  + +  Q+E+Y++ F +FDR     +   QI  IM A+ Q+   K++ K++ 
Sbjct:    36 AVDLSGVKVDFNQDQLEDYREAFGLFDRVGDSKVAYNQIADIMRALGQNPTNKEVTKILG 95

Query:   282 KFDAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
                A    + +++F+ F  ++  V N+ +K T +  + E  R+FDKEGNG +    L+ +
Sbjct:    96 NPTAHEMANKRVDFEGFLPMLQFVVNSPNKATYEDYV-EGLRVFDKEGNGTVMGAELRIV 154

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             L  + + +++ +++A +    ED +G + +E F
Sbjct:   155 LSTLGEKMNEAEIDALMQG-QEDENGCVNYEAF 186


>gi|1654359 (U67860) myosin IC light chain [Acanthamoeba castellanii]
            Length = 149

  Plus Strand HSPs:

 Score = 185 (65.1 bits), Expect = 8.0e-14, P = 8.0e-14
 Identities = 40/142 (28%), Positives = 81/142 (57%), Frame = +3

Query:   129 EIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGK 308
             ++D   ++E ++ F  FD+ K G + A ++G+IM  M  +    +L  +I+  +  G G 
Sbjct:     4 KLDDEMVDEIKQAFAKFDKDKDGRVNALELGKIMREMGHNPTYGELETMIK--ENGGGGV 61

Query:   309 LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDE 488
             ++ + F  +V    ++VD E   ++L EAF++FDK+G G+IS   L+++L  + + L+D+
Sbjct:    62 MDVNGFLGMVAKNYSSVDNE---RDLIEAFQVFDKDGKGFISVMELRSILCNMGEKLTDQ 118

Query:   489 QLEAAVDEIDEDGSGKIEFEEF 554
             ++E  +      G G +++  F
Sbjct:   119 EVEEMLRNACIQGDGNVDYTAF 140


>prf||1810397A myosin:SUBUNIT=light chain:ISOTYPE=II [Acanthamoeba castellanii]
            Length = 154

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 44/143 (30%), Positives = 74/143 (51%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE 323
             QI EYQ  F++FD+ K+G I    +   M AM     +  +R++I++ D   +G ++F E
Sbjct:     8 QIAEYQGVFELFDKEKRGTIDFDALKAGMLAMRMHPKDSDIRQMIKEADVSKTGSIDFTE 67

Query:   324 FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAA 503
             F   V  +   V K     E+  AF  FD++  G I+   LK  L  I D LS++++   
Sbjct:    68 F---VGVLTRKVGKMDSPDEILRAFNTFDRQDRGEIAVDDLKRALMNIGDKLSEKEVREV 124

Query:   504 VDEIDEDGSGKIEFEEFWELMAG 572
             + E  ++  G   +E+F ++M G
Sbjct:   125 LKEASDE-EGMFNYEKFVQIMVG 146

 Score = 81 (28.5 bits), Expect = 1.7, P = 0.82
 Identities = 20/58 (34%), Positives = 27/58 (46%), Frame = +3

Query:   381 ELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             E +  F LFDKE  G I    LKA +  +     D  +   + E D   +G I+F EF
Sbjct:    11 EYQGVFELFDKEKRGTIDFDALKAGMLAMRMHPKDSDIRQMIKEADVSKTGSIDFTEF 68


>sp|P02602|MLE1_RABIT MYOSIN LIGHT CHAIN 1, SKELETAL MUSCLE ISOFORM (MLC1F) (A1
            CATALYTIC) (ALKALI) >pir||MORBLA myosin alkali light chain 1, fast
            skeletal muscle, form 1 - rabbit >gi|1633 (X54041) myosin light
            chain 1 [Oryctolagus cuniculus]
            Length = 192

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 40/149 (26%), Positives = 83/149 (55%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q +E+++ F ++DR     I  +Q+G ++ A+  +    +++K++   
Sbjct:    37 DLSAIKIEFSKEQQDEFKEAFLLYDRTGDSKITLSQVGDVLRALGTNPTNAEVKKVLGNP 96

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+ T + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    97 SNEEMNAKKIEFEQFLPMLQAISNNKDQGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 155

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   156 TLGEKMKEEEVEALMAG-QEDSNGCINYEAF 185


>gi|188590 (M31212) myosin light chain 3 [Homo sapiens]
           Length = 151

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 43/144 (29%), Positives = 80/144 (55%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+  + ++ K++   K D  
Sbjct:     1 MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTDAEVLKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L+F+ F  ++ TVA   D+ T +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NVKVLDFEHFLPMLQTVAKNKDQGTYEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEF 554
             +++E++E  V    ED +G I +E F
Sbjct:   120 MTEEEVEMLVAG-HEDSNGCINYEAF 144


>sp|P06741|MLE3_HUMAN MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM (A2
            CATALYTIC) (ALKALI) (MLC3F) >pir||MOHUA2 myosin alkali light chain
            1, fast skeletal muscle, form 2 - human >gi|34689 (X05451) MLC-3
            (AA 1 - 150) [Homo sapiens] >gi|188594 (M20643) myosin light chain
            [Homo sapiens] >prf||1607304A myosin alkali L 3F [Homo sapiens]
            Length = 150

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 40/137 (29%), Positives = 79/137 (57%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD--GSGKLEF 317
             QI E+++ F +FDR     I  +Q+G ++ A+  +    ++RK++     +   + K+EF
Sbjct:     7 QIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEF 66

Query:   318 DEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLE 497
             ++F  ++  ++N  D+ T + +  E  R+FDKEGNG +    L+ +L  + + + +E++E
Sbjct:    67 EQFLPMMQAISNNKDQATYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVE 125

Query:   498 AAVDEIDEDGSGKIEFEEF 554
             A +    ED +G I +E F
Sbjct:   126 ALMAG-QEDSNGCINYEAF 143


>gi|212347 (J00887) myosin a1 light chain (partial) [Gallus gallus]
           Length = 177

  Plus Strand HSPs:

 Score = 184 (64.8 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 43/151 (28%), Positives = 82/151 (54%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             A D+  I  E    Q +++++ F +FDR     I  +Q+G I+ A+ Q+    ++ K++ 
Sbjct:    20 AIDLKSIKIEFFKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILG 79

Query:   282 KFDAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKAL 455
                 +   + K+ F+EF  ++   AN  D+ T + +  E  R+FDKEGNG +    L+ +
Sbjct:    80 NPSKEEMNAKKITFEEFLPMLQAAANNKDQGTFE-DFVEGLRVFDKEGNGTVMGAELRHV 138

Query:   456 LKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             L  + + +++E++E  +    ED +G I +E F
Sbjct:   139 LATLGEKMTEEEVEELMKG-QEDSNGCINYEAF 170


>sp|P42322|CALB_NAEGR CALCINEURIN B SUBUNIT (PROTEIN PHOSPHATASE 2B REGULATORY
            SUBUNIT) >gi|458230 (U04380) calcineurin B [Naegleria gruberi]
            Length = 177

  Plus Strand HSPs:

 Score = 183 (64.4 bits), Expect = 1.3e-13, P = 1.3e-13
 Identities = 53/154 (34%), Positives = 84/154 (54%), Frame = +3

Query:    93 AIMAEDIDEILAEIDGSQ--IEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQL 266
             ++  E+++E+    + +Q  I++  K F   D+   G I   +   I            +
Sbjct:     7 SLRPEEVEEMQKGTNFTQKEIKKLYKRFKKLDKDGNGTISKDEFLMIPELAVNPL----V 62

Query:   267 RKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTL 446
             +++I  FD +G G + F EF A +       DK   Q++L  AF+++D +G+GYIS   L
Sbjct:    63 KRVISIFDENGDGSVNFKEFIAALSVFNAQGDK---QRKLEFAFKVYDIDGDGYISNGEL 119

Query:   447 KALLKE-IADDLSDEQLEAAVD----EIDEDGSGKIEFEEF 554
               +LK  + ++LSD QL+  VD    E DEDG GKI FEEF
Sbjct:   120 FTVLKMMVGNNLSDVQLQQIVDKTILEADEDGDGKISFEEF 160

 Score = 96 (33.8 bits), Expect = 0.039, P = 0.039
 Identities = 31/107 (28%), Positives = 54/107 (50%), Frame = +3

Query:   246 DFDEKQLRKLIRKF---DADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKE 416
             +F +K+++KL ++F   D DG+G +  DEF  +     N + K  +         +FD+ 
Sbjct:    21 NFTQKEIKKLYKRFKKLDKDGNGTISKDEFLMIPELAVNPLVKRVIS--------IFDEN 72

Query:   417 GNGYISRPTLKALLKEIADDLSDEQ--LEAAVDEIDEDGSGKIEFEEFWELM 566
             G+G ++     A L  + +   D+Q  LE A    D DG G I   E + ++
Sbjct:    73 GDGSVNFKEFIAALS-VFNAQGDKQRKLEFAFKVYDIDGDGYISNGELFTVL 123

 Score = 86 (30.3 bits), Expect = 0.65, P = 0.48
 Identities = 22/68 (32%), Positives = 37/68 (54%), Frame = +3

Query:   351 NTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGS 530
             N   KE   K+L + F+  DK+GNG IS+     ++ E+A    +  ++  +   DE+G 
Sbjct:    21 NFTQKEI--KKLYKRFKKLDKDGNGTISKDEF-LMIPELA---VNPLVKRVISIFDENGD 74

Query:   531 GKIEFEEF 554
             G + F+EF
Sbjct:    75 GSVNFKEF 82


>bbs|166470 (S77858) non-muscle myosin alkali light chain [rats,
            Sprague-Dawley, new-born, heart ventricle, Peptide, 151 aa] [Rattus
            sp.]
            Length = 151

  Plus Strand HSPs:

 Score = 183 (64.4 bits), Expect = 1.3e-13, P = 1.3e-13
 Identities = 43/148 (29%), Positives = 81/148 (54%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+    ++ K++   K D  
Sbjct:     1 MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L+F+ F  ++ TVA   D+ T +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NVKVLDFEHFLPMLQTVAKNKDQGTYEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +++E++E  V    ED +G I +EE   ++
Sbjct:   120 MTEEEVEMLVAG-HEDSNGCINYEELLRMV 148


>gi|205474 (L00088) myosin light chain [Rattus norvegicus]
           Length = 191

  Plus Strand HSPs:

 Score = 182 (64.1 bits), Expect = 1.7e-13, P = 1.7e-13
 Identities = 41/149 (27%), Positives = 83/149 (55%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q EE+++ F +FDR  +  I  +Q+G ++ A+  +    +++K++   
Sbjct:    36 DLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNP 95

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+   + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    96 SNEEMNAKKIEFEQFLPMMQAISNNKDQGGYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 154

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   155 TLGEKMKEEEVEALLAG-QEDSNGCINYEAF 184

 Score = 77 (27.1 bits), Expect = 9.1, P = 1.0
 Identities = 19/66 (28%), Positives = 38/66 (57%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEI--DEDGSGKIEFE 548
             Q+E +EAF LFD+ G   I+   +  +L+ +  + ++ +++  +     +E  + KIEFE
Sbjct:    49 QEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFE 108

Query:   549 EFWELM 566
             +F  +M
Sbjct:   109 QFLPMM 114


>sp|P02600|MLE1_RAT MYOSIN LIGHT CHAIN 1, SKELETAL MUSCLE ISOFORM (MLC1F) (A1
            CATALYTIC) (ALKALI)
            Length = 189

  Plus Strand HSPs:

 Score = 182 (64.1 bits), Expect = 1.7e-13, P = 1.7e-13
 Identities = 41/149 (27%), Positives = 83/149 (55%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q EE+++ F +FDR  +  I  +Q+G ++ A+  +    +++K++   
Sbjct:    34 DLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNP 93

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+   + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    94 SNEEMNAKKIEFEQFLPMMQAISNNKDQGGYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 152

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   153 TLGEKMKEEEVEALLAG-QEDSNGCINYEAF 182

 Score = 77 (27.1 bits), Expect = 8.9, P = 1.0
 Identities = 19/66 (28%), Positives = 38/66 (57%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEI--DEDGSGKIEFE 548
             Q+E +EAF LFD+ G   I+   +  +L+ +  + ++ +++  +     +E  + KIEFE
Sbjct:    47 QEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFE 106

Query:   549 EFWELM 566
             +F  +M
Sbjct:   107 QFLPMM 112


>pir||MORTA1 myosin alkali light chain 1, fast skeletal muscle, form 1 - rat
            Length = 190

  Plus Strand HSPs:

 Score = 182 (64.1 bits), Expect = 1.7e-13, P = 1.7e-13
 Identities = 41/149 (27%), Positives = 83/149 (55%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q EE+++ F +FDR  +  I  +Q+G ++ A+  +    +++K++   
Sbjct:    35 DLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNP 94

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+   + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    95 SNEEMNAKKIEFEQFLPMMQAISNNKDQGGYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 153

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   154 TLGEKMKEEEVEALLAG-QEDSNGCINYEAF 183

 Score = 77 (27.1 bits), Expect = 9.0, P = 1.0
 Identities = 19/66 (28%), Positives = 38/66 (57%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEI--DEDGSGKIEFE 548
             Q+E +EAF LFD+ G   I+   +  +L+ +  + ++ +++  +     +E  + KIEFE
Sbjct:    48 QEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFE 107

Query:   549 EFWELM 566
             +F  +M
Sbjct:   108 QFLPMM 113


>sp|P16475|MLEN_HUMAN MYOSIN LIGHT CHAIN ALKALI, NON-MUSCLE ISOFORM (MLC3NM)
            (LC17A) (LC17-NM) >pir||S13672 myosin catalytic light chain B -
            bovine >pir||MOHU6M myosin alkali light chain 6, smooth muscle form
            - human >gi|576 (X54978) 17,000 dalton myosin light chain [Bos
            taurus]
            Length = 151

  Plus Strand HSPs:

 Score = 182 (64.1 bits), Expect = 1.7e-13, P = 1.7e-13
 Identities = 43/144 (29%), Positives = 79/144 (54%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+    ++ K++   K D  
Sbjct:     1 MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L+F+ F  ++ TVA   D+ T +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NVKVLDFEHFLPMLQTVAKNKDQGTYEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEF 554
             +++E++E  V    ED +G I +E F
Sbjct:   120 MTEEEVEMLVAG-HEDSNGCINYEAF 144


>sp|P24572|MLES_HUMAN MYOSIN LIGHT CHAIN ALKALI, SMOOTH-MUSCLE ISOFORM (MLC3SM)
            (LC17B) (LC17-GI) >pir||S13671 myosin catalytic light chain A -
            bovine >pir||MOHU6N myosin alkali light chain 6, nonmuscle form -
            human >gi|578 (X54977) 17,000 dalton myosin light chain [Bos
            taurus] >gi|189018 (M22919) non-muscle myosin light chain [Homo
            sapiens]
            Length = 151

  Plus Strand HSPs:

 Score = 182 (64.1 bits), Expect = 1.7e-13, P = 1.7e-13
 Identities = 43/143 (30%), Positives = 79/143 (55%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+    ++ K++   K D  
Sbjct:     1 MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L+F+ F  ++ TVA   D+ T +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NVKVLDFEHFLPMLQTVAKNKDQGTYEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEE 551
             +++E++E  V    ED +G I +EE
Sbjct:   120 MTEEEVEMLVAG-HEDSNGCINYEE 143


>sp|P02605|MLE3_CHICK MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM (A2
            CATALYTIC) (ALKALI) (MLC-3)
            Length = 150

  Plus Strand HSPs:

 Score = 182 (64.1 bits), Expect = 1.7e-13, P = 1.7e-13
 Identities = 40/137 (29%), Positives = 78/137 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD--GSGKLEF 317
             QI+++++ F +FDR     I  +Q+G I+ A+ Q+    ++ K++     +   + K+ F
Sbjct:     7 QIDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITF 66

Query:   318 DEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLE 497
             +EF  ++   AN  D+ T + +  E  R+FDKEGNG +    L+ +L  + + +++E++E
Sbjct:    67 EEFLPMLQAAANNKDQGTFE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVE 125

Query:   498 AAVDEIDEDGSGKIEFEEF 554
               +    ED +G I +E F
Sbjct:   126 ELMKG-QEDSNGCINYEAF 143


>pir||JC5174 calcineurin B - fruit fly (Drosophila melanogaster)
            Length = 170

  Plus Strand HSPs:

 Score = 180 (63.4 bits), Expect = 2.7e-13, P = 2.7e-13
 Identities = 54/155 (34%), Positives = 83/155 (53%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             E+ +  D  +I    K F   D    G   A  + + M   E       ++++I  FDAD
Sbjct:    10 EMCSNFDADEIRRLGKRFRKLDLDNSG---ALSVDEFMSLPELQ-QNPLVQRVIDIFDAD 65

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE-IAD 473
             G+G+++F EF   V   +   DK  L K LR AFR++D + +GYIS   L  +LK  + +
Sbjct:    66 GNGEVDFKEFIQGVSQFSVKGDK--LSK-LRFAFRIYDMDNDGYISNGELFQVLKMMVGN 122

Query:   474 DLSDEQLEAAVDEI----DEDGSGKIEFEEFWELMAGDAD 581
             +L D QL+  VD+     D+D  GKI F+EF  ++ G+ D
Sbjct:   123 NLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVV-GNTD 161

 Score = 98 (34.5 bits), Expect = 0.019, P = 0.019
 Identities = 22/74 (29%), Positives = 42/74 (56%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAME-QDFDEKQLRKLIRK---F-DAD 296
             + G ++ + +  F ++D    GYI   ++ Q++  M   +  + QL++++ K   F D D
Sbjct:    84 VKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKD 143

Query:   297 GSGKLEFDEFCALV 338
               GK+ FDEFC++V
Sbjct:   144 EDGKISFDEFCSVV 157

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.73
 Identities = 31/110 (28%), Positives = 51/110 (46%), Frame = +3

Query:   246 DFDE-KQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGN 422
             D DE ++L K  RK D D SG L  DEF +L     N + +  +         +FD +GN
Sbjct:    16 DADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVID--------IFDADGN 67

Query:   423 GYISRPTLKALLKEIA---DDLSDEQLEAAVDEIDEDGS-GKIEFEEFWELMAGD 575
             G +        + + +   D LS  +    + ++D DG     E  +  ++M G+
Sbjct:    68 GEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGN 122

 Score = 76 (26.8 bits), Expect = 8.9, P = 1.0
 Identities = 29/113 (25%), Positives = 48/113 (42%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDE-KQLRKLI 278
             A  +DE ++  +  Q    Q+  D+FD    G +   +  Q +       D+  +LR   
Sbjct:    37 ALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAF 96

Query:   279 RKFDADGSGKLEFDE-FCALVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             R +D D  G +   E F  L   V N +    LQ+ + +     DK+ +G IS
Sbjct:    97 RIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKIS 149


>pir||I57590 myosin light chain MLC1-f - rat >gi|205485 (M12022) myosin light
            chain MLC1-f [Rattus norvegicus]
            Length = 189

  Plus Strand HSPs:

 Score = 180 (63.4 bits), Expect = 2.7e-13, P = 2.7e-13
 Identities = 41/149 (27%), Positives = 83/149 (55%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q EE+++ F +FDR  +  I  +Q+G ++ A+  +    +++K++   
Sbjct:    34 DLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNP 93

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+   + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    94 SNEEMNAKKIEFEQFLPMMQAISNNKDQGGYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 152

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   153 ILGEKMKEEEVEALLAG-QEDSNGCINYEAF 182

 Score = 77 (27.1 bits), Expect = 8.9, P = 1.0
 Identities = 19/66 (28%), Positives = 38/66 (57%), Frame = +3

Query:   375 QKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEI--DEDGSGKIEFE 548
             Q+E +EAF LFD+ G   I+   +  +L+ +  + ++ +++  +     +E  + KIEFE
Sbjct:    47 QEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFE 106

Query:   549 EFWELM 566
             +F  +M
Sbjct:   107 QFLPMM 112


>sp|P02607|MLES_CHICK MYOSIN LIGHT CHAIN ALKALI, SMOOTH-MUSCLE ISOFORM
            (GIZZARD) (G2 CATALYTIC) (LC17-GI) >gi|212393 (M15645) myosin
            alkali light chain [Gallus gallus]
            Length = 151

  Plus Strand HSPs:

 Score = 180 (63.4 bits), Expect = 2.7e-13, P = 2.7e-13
 Identities = 41/143 (28%), Positives = 79/143 (55%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+    ++ K++   K D  
Sbjct:     1 MCDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L+F++F  ++ T+A   D+   +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NLKTLKFEQFLPMMQTIAKNKDQGCFEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEE 551
             +++E++E  V    ED +G I +EE
Sbjct:   120 MTEEEVEQLVAG-HEDSNGCINYEE 143


>sp|P08296|MLEN_CHICK MYOSIN LIGHT CHAIN ALKALI, NON-MUSCLE ISOFORM
            (FIBROBLAST) (G2 CATALYTIC) (LC17-NM) >gi|212395 (M15646) myosin
            alkali light chain [Gallus gallus]
            Length = 151

  Plus Strand HSPs:

 Score = 180 (63.4 bits), Expect = 2.7e-13, P = 2.7e-13
 Identities = 41/144 (28%), Positives = 79/144 (54%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+    ++ K++   K D  
Sbjct:     1 MCDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L+F++F  ++ T+A   D+   +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NLKTLKFEQFLPMMQTIAKNKDQGCFEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEEF 554
             +++E++E  V    ED +G I +E F
Sbjct:   120 MTEEEVEQLVAG-HEDSNGCINYEAF 144


>gi|1314712 (U54615) calcium-dependent protein kinase [Arabidopsis thaliana]
            Length = 196

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.5e-13, P = 3.5e-13
 Identities = 48/154 (31%), Positives = 77/154 (50%), Frame = +3

Query:   120 ILAE-IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             ++AE +   ++E+ +  F+  D    G +   ++   +        E +++ LI   D  
Sbjct:    15 VIAEFLSTEEVEDIKVMFNKMDTDNDGIVSIEELKAGLRDFSTQLAESEVQMLIEAVDTK 74

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
             G G L++ EF A    V+  + K    + LR+AF  FDK+GNGYI    L   LKE   D
Sbjct:    75 GKGTLDYGEFVA----VSLHLQKVANDEHLRKAFSYFDKDGNGYILPQELCDALKE---D 127

Query:   477 LSDEQLEAAVD---EIDEDGSGKIEFEEFWELMAGDAD 581
               D+ ++ A D   E+D D  G+I +EEF  +M    D
Sbjct:   128 GGDDCVDVANDIFQEVDTDKDGRISYEEFAAMMKTGTD 165

 Score = 90 (31.7 bits), Expect = 0.29, P = 0.25
 Identities = 16/70 (22%), Positives = 40/70 (57%), Frame = +3

Query:   345 VANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLEAAVDEIDED 524
             +A  +  E ++ +++  F   D + +G +S   LKA L++ +  L++ +++  ++ +D  
Sbjct:    16 IAEFLSTEEVE-DIKVMFNKMDTDNDGIVSIEELKAGLRDFSTQLAESEVQMLIEAVDTK 74

Query:   525 GSGKIEFEEF 554
             G G +++ EF
Sbjct:    75 GKGTLDYGEF 84


>pir||JC1221 calcineurin B beta-2 - mouse >bbs|112956 (S43865)
            calmodulin-dependent protein phosphatase regulatory subunit beta 2
            isoform, calcineurin B beta 2 isoform [mice, testis, Peptide, 179
            aa] [Mus sp.]
            Length = 179

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.5e-13, P = 3.5e-13
 Identities = 52/150 (34%), Positives = 83/150 (55%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             E+    D  +I    K F   D  K G +    I + M   E       + ++I  FD D
Sbjct:    10 ELCNHFDQEEIRRLGKSFRKLDLDKSGSL---SIEEFMRLPELQ-QNPLVGRVIDIFDTD 65

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE-IAD 473
             G+G+++F EF  +V T   +V  +  QK LR AFR++D + +G+IS   L  +LK  + +
Sbjct:    66 GNGEVDFHEF--IVGTSQFSVKGDEEQK-LRFAFRIYDMDNDGFISNGELFQVLKMMVGN 122

Query:   474 DLSDEQLEAAVDE----IDEDGSGKIEFEEFWELM 566
             +L D QL+  VD+    +D+DG G+I FEEF +++
Sbjct:   123 NLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVV 157

 Score = 85 (29.9 bits), Expect = 0.88, P = 0.58
 Identities = 20/77 (25%), Positives = 42/77 (54%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAME-QDFDEKQLRKLIRK----FDAD 296
             + G + ++ +  F ++D    G+I   ++ Q++  M   +  + QL++L+ K     D D
Sbjct:    84 VKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDWQLQQLVDKSILVLDKD 143

Query:   297 GSGKLEFDEFCALVYTV 347
             G G++ F+EF  +V T+
Sbjct:   144 GDGRISFEEFSDVVKTM 160

 Score = 84 (29.6 bits), Expect = 1.2, P = 0.69
 Identities = 26/93 (27%), Positives = 47/93 (50%), Frame = +3

Query:   162 KFFDMFDRGKQGYIMATQ--IGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLEFDE-FCA 332
             +  D+FD    G +   +  +G    +++ D +E++LR   R +D D  G +   E F  
Sbjct:    57 RVIDIFDTDGNGEVDFHEFIVGTSQFSVKGD-EEQKLRFAFRIYDMDNDGFISNGELFQV 115

Query:   333 LVYTVANTVDKETLQKELREAFRLFDKEGNGYIS 434
             L   V N +    LQ+ + ++  + DK+G+G IS
Sbjct:   116 LKMMVGNNLKDWQLQQLVDKSILVLDKDGDGRIS 149

 Score = 77 (27.1 bits), Expect = 7.8, P = 1.0
 Identities = 29/106 (27%), Positives = 47/106 (44%), Frame = +3

Query:   249 FDEKQLRKL---IRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             FD++++R+L    RK D D SG L  +EF  L     N +    +         +FD +G
Sbjct:    15 FDQEEIRRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGRVID--------IFDTDG 66

Query:   420 NGYISRPTLKALLKEIADDLSDEQ-LEAAVDEIDEDGSGKIEFEEFWELM 566
             NG +          + +    +EQ L  A    D D  G I   E ++++
Sbjct:    67 NGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVL 116


>sp|P05977|MLE1_MOUSE MYOSIN LIGHT CHAIN 1, SKELETAL MUSCLE ISOFORM (MLC1F) (A1
            CATALYTIC) (ALKALI) >gi|387481 (K02241) myosin light chain 1f [Mus
            musculus]
            Length = 188

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.5e-13, P = 3.5e-13
 Identities = 40/149 (26%), Positives = 83/149 (55%), Frame = +3

Query:   108 DIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKF 287
             D+  I  E    Q E++++ F +FDR  +  I  +Q+G ++ A+  +    +++K++   
Sbjct:    33 DLSAIKIEFSKEQQEDFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNP 92

Query:   288 DAD--GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLK 461
               +   + K+EF++F  ++  ++N  D+   + +  E  R+FDKEGNG +    L+ +L 
Sbjct:    93 SNEEMNAKKIEFEQFLPMMQAISNNKDQGGYE-DFVEGLRVFDKEGNGTVMGAELRHVLA 151

Query:   462 EIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
              + + + +E++EA +    ED +G I +E F
Sbjct:   152 TLGEKMKEEEVEALLAG-QEDSNGCINYEAF 181


>gi|212349 (J00888) myosin a2 light chain [Gallus gallus]
           Length = 150

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.5e-13, P = 3.5e-13
 Identities = 39/137 (28%), Positives = 77/137 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD--GSGKLEF 317
             +I ++++ F +FDR     I  +Q+G I+ A+ Q+    ++ K++     +   + K+ F
Sbjct:     7 EINDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITF 66

Query:   318 DEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLE 497
             +EF  ++   AN  D+ T + +  E  R+FDKEGNG +    L+ +L  + + +++E++E
Sbjct:    67 EEFLPMLQAAANNKDQGTFE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVE 125

Query:   498 AAVDEIDEDGSGKIEFEEF 554
               +    ED +G I +E F
Sbjct:   126 ELIKG-QEDSNGCINYEAF 143


>pir||MOCH6N myosin alkali light chain 6, nonmuscle form - chicken
            Length = 152

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.5e-13, P = 3.5e-13
 Identities = 41/143 (28%), Positives = 78/143 (54%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+    ++ K++   K D  
Sbjct:     1 MCDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L F++F  ++ T+A   D+   +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NLKTLNFEQFLPMMQTIAKNKDQGCFEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEE 551
             +++E++E  V    ED +G I +EE
Sbjct:   120 MTEEEVEQLVAG-HEDSNGCINYEE 143


>gnl|PID|e311091 (Z93780) myosin light chain [Fugu rubripes]
            Length = 203

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.5e-13, P = 3.5e-13
 Identities = 46/163 (28%), Positives = 85/163 (52%), Frame = +3

Query:   102 AEDIDEILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR 281
             A D+  +  E    QIE+Y++ F +FDR     +   QI  IM A+ Q+   K++ K++ 
Sbjct:    34 AVDLSAVKIEFSPDQIEDYREAFGLFDRVGDNKVAYNQIADIMRALGQNPTNKEVTKMLG 93

Query:   282 K-------------FDADGSGK-LEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
                           F AD + K +EF+ F  ++ T+ N+ +K   +  + E  R+FDKEG
Sbjct:    94 NPNTEEMLNVCGGVFSADMANKRVEFEGFLPMLQTIINSPNKAGFEDYV-EGLRVFDKEG 152

Query:   420 NGYISRPTLKALLKEIADDLSDEQLEAAVDEIDEDGSGKIEFEEF 554
             NG +    L+ +L  + + +++ +++A +    ED +G + +E F
Sbjct:   153 NGTVMGAELRIVLSTLGEKMNEAEIDALMAG-QEDENGCVNYEAF 196


>pir||MOCHG2 myosin alkali light chain 6, smooth muscle form - chicken
            Length = 151

  Plus Strand HSPs:

 Score = 179 (63.0 bits), Expect = 3.5e-13, P = 3.5e-13
 Identities = 41/143 (28%), Positives = 78/143 (54%), Frame = +3

Query:   123 LAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIR--KFDAD 296
             + +    Q  E+++ F +FDR   G I+ +Q G +M A+ Q+    ++ K++   K D  
Sbjct:     1 MCDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEM 60

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADD 476
                 L F++F  ++ T+A   D+   +  + E  R+FDKEGNG +    ++ +L  + + 
Sbjct:    61 NLKTLNFEQFLPMMQTIAKNKDQGCFEDYV-EGLRVFDKEGNGTVMGAEIRHVLVTLGEK 119

Query:   477 LSDEQLEAAVDEIDEDGSGKIEFEE 551
             +++E++E  V    ED +G I +EE
Sbjct:   120 MTEEEVEQLVAG-HEDSNGCINYEE 143


>gnl|PID|e353289 (AJ001919) calmodulin [Branchiostoma lanceolatum]
            Length = 89

  Plus Strand HSPs:

 Score = 178 (62.7 bits), Expect = 4.4e-13, P = 4.4e-13
 Identities = 33/89 (37%), Positives = 57/89 (64%), Frame = +3

Query:   300 SGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDL 479
             +G ++F EF  ++       D E   +E+REAFR+FDK+GNG+IS   L+ ++  + + L
Sbjct:     1 NGTIDFPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKL 57

Query:   480 SDEQLEAAVDEIDEDGSGKIEFEEFWELM 566
             +DE+++  + E D DG G++ +EEF  +M
Sbjct:    58 TDEEVDEMIREADIDGDGQVNYEEFVTMM 86

 Score = 106 (37.3 bits), Expect = 6.7e-05, P = 6.7e-05
 Identities = 18/68 (26%), Positives = 41/68 (60%), Frame = +3

Query:   135 DGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDADGSGKLE 314
             D    EE ++ F +FD+   G+I A ++  +M  + +   ++++ ++IR+ D DG G++ 
Sbjct:    19 DTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVN 78

Query:   315 FDEFCALV 338
             ++EF  ++
Sbjct:    79 YEEFVTMM 86

 Score = 73 (25.7 bits), Expect = 0.29, P = 0.25
 Identities = 21/64 (32%), Positives = 37/64 (57%), Frame = +3

Query:   243 QDFD-EKQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEG 419
             +D D E+++R+  R FD DG+G +   E   L + + N  +K T  +E+ E  R  D +G
Sbjct:    18 KDTDSEEEIREAFRVFDKDGNGFISAAE---LRHVMTNLGEKLT-DEEVDEMIREADIDG 73

Query:   420 NGYIS 434
             +G ++
Sbjct:    74 DGQVN 78


>sp|P48451|CALB_DROME CALCINEURIN B SUBUNIT, ISOFORM 1 (PROTEIN PHOSPHATASE 2B
            REGULATORY SUBUNIT) >pir||A44307 phosphoprotein phosphatase (EC
            3.1.3.16) calmodulin-stimulated regulatory subunit - fruit fly
            (Drosophila melanogaster) >gi|157049 (M97215) calcineurin B
            [Drosophila melanogaster]
            Length = 170

  Plus Strand HSPs:

 Score = 178 (62.7 bits), Expect = 4.4e-13, P = 4.4e-13
 Identities = 54/155 (34%), Positives = 83/155 (53%), Frame = +3

Query:   117 EILAEIDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD 296
             ++ +  D  +I    K F   D    G   A  I + M   E       ++++I  FDAD
Sbjct:    10 DMCSNFDADEIRRLGKRFRKLDLDNSG---ALSIDEFMSLPELQ-QNPLVQRVIDIFDAD 65

Query:   297 GSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKE-IAD 473
             G+G+++F EF   V   +   DK  L K LR AFR++D + +GYIS   L  +LK  + +
Sbjct:    66 GNGEVDFKEFIQGVSQFSVRGDK--LSK-LRFAFRIYDMDNDGYISNGELFQVLKMMVGN 122

Query:   474 DLSDEQLEAAVDEI----DEDGSGKIEFEEFWELMAGDAD 581
             +L D QL+  VD+     D+D  GKI F+EF  ++ G+ D
Sbjct:   123 NLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVV-GNTD 161

 Score = 97 (34.1 bits), Expect = 0.025, P = 0.025
 Identities = 22/74 (29%), Positives = 42/74 (56%), Frame = +3

Query:   132 IDGSQIEEYQKFFDMFDRGKQGYIMATQIGQIMHAME-QDFDEKQLRKLIRK---F-DAD 296
             + G ++ + +  F ++D    GYI   ++ Q++  M   +  + QL++++ K   F D D
Sbjct:    84 VRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFADKD 143

Query:   297 GSGKLEFDEFCALV 338
               GK+ FDEFC++V
Sbjct:   144 EDGKISFDEFCSVV 157

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.64
 Identities = 31/110 (28%), Positives = 51/110 (46%), Frame = +3

Query:   246 DFDE-KQLRKLIRKFDADGSGKLEFDEFCALVYTVANTVDKETLQKELREAFRLFDKEGN 422
             D DE ++L K  RK D D SG L  DEF +L     N + +  +         +FD +GN
Sbjct:    16 DADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID--------IFDADGN 67

Query:   423 GYISRPTLKALLKEIA---DDLSDEQLEAAVDEIDEDGS-GKIEFEEFWELMAGD 575
             G +        + + +   D LS  +    + ++D DG     E  +  ++M G+
Sbjct:    68 GEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGN 122


>sp|P02603|MLE3_RABIT MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM (A2
            CATALYTIC) (ALKALI) (MLC3F) >pir||MORBL2 myosin alkali light 1,
            fast skeletal muscle, form 2 - rabbit >gi|1639 (X54044) myosin
            light chain 3 [Oryctolagus cuniculus]
            Length = 150

  Plus Strand HSPs:

 Score = 177 (62.3 bits), Expect = 5.6e-13, P = 5.6e-13
 Identities = 38/137 (27%), Positives = 79/137 (57%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD--GSGKLEF 317
             QI E+++ F ++DR     I  +Q+G ++ A+  +    +++K++     +   + K+EF
Sbjct:     7 QIAEFKEAFLLYDRTGDSKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEF 66

Query:   318 DEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLE 497
             ++F  ++  ++N  D+ T + +  E  R+FDKEGNG +    L+ +L  + + + +E++E
Sbjct:    67 EQFLPMLQAISNNKDQGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVE 125

Query:   498 AAVDEIDEDGSGKIEFEEF 554
             A +    ED +G I +E F
Sbjct:   126 ALMAG-QEDSNGCINYEAF 143


>pir||MOCHA2 myosin alkali light chain 1, fast skeletal muscle, form 2 -
            chicken
            Length = 149

  Plus Strand HSPs:

 Score = 177 (62.3 bits), Expect = 5.6e-13, P = 5.6e-13
 Identities = 39/137 (28%), Positives = 77/137 (56%), Frame = +3

Query:   144 QIEEYQKFFDMFDRGKQGYIMATQIGQIMHAMEQDFDEKQLRKLIRKFDAD--GSGKLEF 317
             +I ++++ F +FDR     I  +Q+G I+ A+ Q+    ++ K++     +   + K+ F
Sbjct:     6 EINDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITF 65

Query:   318 DEFCALVYTVANTVDKETLQKELREAFRLFDKEGNGYISRPTLKALLKEIADDLSDEQLE 497
             +EF  ++   AN  D+ T + +  E  R+FDKEGNG +    L+ +L  + + +++E++E
Sbjct:    66 EEFLPMLQAAANNKDQGTFE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVE 124

Query:   498 AAVDEIDEDGSGKIEFEEF 554
               +    ED +G I +E F
Sbjct:   125 ELMKG-QEDSNGCINYEAF 142


WARNING:  HSPs involving 572 database sequences were not reported due to the
          limiting value of parameter B = 250.


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.99
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.335   0.150   0.441
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.375   0.171   0.721
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.354   0.154   0.543
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.352   0.157   0.551
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.352   0.159   0.531
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.345   0.145   0.463
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   +2      0      263       262      10. 63 3  12 22   0.092 36
                                                  32    0.11 39
   +1      0      264       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   -1      0      264       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   -2      0      263       262      10. 63 3  12 22   0.092 36
                                                  32    0.11 39
   -3      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39


Statistics:

  Database:  ../../_tempdbs/nrdb
    Title:  ../../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  822
  No. of states in DFA:  596 (59 KB)
  Total size of DFA:  255 KB (256 KB)
  Time to generate neighborhood:  0.03u 0.00s 0.03t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  194.87u 0.63s 195.50t  Elapsed: 00:00:33
  Total cpu time:  195.64u 0.69s 196.33t  Elapsed: 00:00:34
  Start:  Wed Feb  4 16:53:32 1998   End:  Wed Feb  4 16:54:06 1998

WARNINGS ISSUED:  2

Date: 16:30:31 on Sun 17 Dec 117.