blastx_gbnr_files/CBrugiaQ_2864_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CBrugiaQ_2864
        (466 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|d1005422     (D21877) Nucleosome assembry prot... -2   420  9.8e-39   1
A gi|1065952           (U40800) coded for by C. elegans ... -2   415  3.3e-38   1
A sp|P55209|NPL1_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIK... -2   401  1.0e-36   1
A sp|P28656|NPL1_MOUSE NUCLEOSOME ASSEMBLY PROTEIN 1-LIK... -2   398  2.1e-36   1
A pir||S16863          gene DN38 protein - mouse (fragme... -2   398  2.1e-36   1
A sp|Q99733|NPL4_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIK... -2   370  1.9e-33   1
A gi|1072120           (U39553) nucleosome assembly prot... -2   326  9.0e-29   1
A gi|549975            (U12858) nucleosome assembly prot... -2   296  1.4e-25   1
A pir||S60892          nucleosome assembly protein 1 - s... -2   287  1.2e-24   1
A gi|1778378           (U81289) NAP1Ps [Pisum sativum]      -2   264  3.3e-22   1
A dbj||D89271_1        (D89271) similar to Saccharomyces... -2   234  5.3e-19   1
A sp|P51860|NPL2_MOUSE NUCLEOSOME ASSEMBLY PROTEIN 1-LIK... -2   239  6.1e-19   1
A sp|Q99457|NPL3_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIK... -2   219  1.2e-16   1
A gi|172034            (M63555) nucleosome assembly prot... -2   213  3.2e-16   1
A sp|P25293|NAP1_YEAST NUCLEOSOME ASSEMBLY PROTEIN >pir|... -2   213  3.2e-16   1
A pir||S59561          nucleosome assembly protein I - w... -2   156  9.3e-11   1
A gi|2253411           (AF007219) PP2A inhibitor [Tetrao... -2    91  0.00021   2
A pir||I64837          Set beta isoform - rat >bbs|14366... -2    87  0.00087   2
A pir||I51908          Set alpha isoform - rat >bbs|1436... -2    87  0.0010    2
A sp|Q01105|SET_HUMAN  SET PROTEIN (HLA-DR ASSOCIATED PR... -2    87  0.0018    2
A pir||A45018          template activating factor-I, spl... -2    87  0.0018    2
A pir||I59377          template activating factor-I, spl... -2    87  0.0020    2
A sp|P53997|SET_DROME  SET PROTEIN >gi|940889 (U30470) S... -2    97  0.015     1
A pir||A60396          antigen 7H8/5 - Plasmodium falcip... +2    68  0.31      1
A gi|1184965           (U46757) P74 [Bombyx mori nuclear... +2    61  0.90      1
A gi|1245612           (U52309) envelope glycoprotein, V... -2    61  0.90      1
A gi|1245624           (U52315) envelope glycoprotein, V... -2    61  0.90      1
A gnl|PID|e330200      (Z81111) T01G5.6 [Caenorhabditis ... +2    69  0.92      1
A gi|1245608           (U52307) envelope glycoprotein, V... -2    60  0.95      1
A gi|2226074           (AF005044) OrfF [Escherichia coli]   +1    67  0.997     1
A gi|540222            (U14543) envelope glycoprotein [H... -2    57  0.999     1
A sp|P31703|GSPE_ERWCA GENERAL SECRETION PATHWAY PROTEIN... -2    60  0.9997    2



>gnl|PID|d1005422 (D21877) Nucleosome assembry protein homologue [Hemicentrotus
            pulcherrimus]
            Length = 430

  Minus Strand HSPs:

 Score = 420 (147.8 bits), Expect = 9.8e-39, P = 9.8e-39
 Identities = 81/152 (53%), Positives = 112/152 (73%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             +TL F F  N+YFT T L K Y ++  PDE D F ++GP II ++G EIDWK+ KNVT K
Sbjct:   246 FTLEFFFTANDYFTNTVLNKSYQMKAEPDESDPFSFEGPEIIGSQGCEIDWKKNKNVTVK 305

Query:   276 IIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGN-DDDIETQELLQADFE 103
             +IKKKQK KG    R +TKTV+ DSFFNFF+PP    + E+ G  ++D ET+ LL ADFE
Sbjct:   306 VIKKKQKHKGRGTTRLVTKTVQTDSFFNFFNPPKAPEE-EVDGEIEEDEETEALLSADFE 364

Query:   102 IGQLFRDQIVPRAVLFYTKEAMDENEIFDYDADE 1
             IG L R++I+PRAVL++T EA++++E ++ +A+E
Sbjct:   365 IGHLIRERIIPRAVLYFTGEAIEDDE-YEEEAEE 397


>gi|1065952 (U40800) coded for by C. elegans cDNA yk112c11.5; coded for by C.
            elegans cDNA yk90e2.5; coded for by C. elegans cDNA yk105c11.5;
            coded for by C. elegans cDNA yk51g2.5; coded for by C. elegans cDNA
            yk51b12.5; coded for by C. elegans cDNA CEE...
            Length = 316

  Minus Strand HSPs:

 Score = 415 (146.1 bits), Expect = 3.3e-38, P = 3.3e-38
 Identities = 77/155 (49%), Positives = 109/155 (70%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P  + + FHF  N YF    L K Y L   PD +    +DGP +I A G  I+W++GKNV
Sbjct:   153 PAGFKIEFHFATNPYFKNQVLTKTYLLGFDPDAEAPLQFDGPHVIRAVGDTIEWEDGKNV 212

Query:   285 TKKIIKKKQKKGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQADF 106
             TKK +KKKQKKG+ AG+F+TKTVKADSFFNFF+PP  ++K+E + ++DD + +E L+ D+
Sbjct:   213 TKKAVKKKQKKGANAGKFLTKTVKADSFFNFFEPP--KSKDERNEDEDDEQAEEFLELDY 270

Query:   105 EIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDADE 1
             E+GQ  RD I+PRAVLFYT E +  +++FD+  ++
Sbjct:   271 EMGQAIRDTIIPRAVLFYTGE-LQSDDMFDFPGED 304


>sp|P55209|NPL1_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 1 (NAP-1 RELATED
            PROTEIN) >pir||S40510 hNRP protein - human >gi|189067 (M86667) NAP
            [Homo sapiens]
            Length = 391

  Minus Strand HSPs:

 Score = 401 (141.2 bits), Expect = 1.0e-36, P = 1.0e-36
 Identities = 80/154 (51%), Positives = 105/154 (68%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P S+ L FHFEPNEYFT   L K Y ++  PD+ D F +DGP I+   G +IDWK+GKNV
Sbjct:   209 PMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNV 268

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T K IKKKQK KG    R +TKTV  DSFFNFF PP +    ++   DDD E   +L AD
Sbjct:   269 TLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDL---DDDAEA--ILAAD 323

Query:   108 FEIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDAD 4
             FEIG   R++I+PR+VL++T EA+++++  DYD +
Sbjct:   324 FEIGHFLRERIIPRSVLYFTGEAIEDDDD-DYDEE 357


>sp|P28656|NPL1_MOUSE NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 1 (NAP-1 RELATED
            PROTEIN) (BRAIN PROTEIN DN38) >pir||JS0707 nucleosome assembly
            protein 1 - mouse >gnl|PID|d1002632 (D12618) nucleosome assembly
            protein-1 [Mus musculus]
            Length = 391

  Minus Strand HSPs:

 Score = 398 (140.1 bits), Expect = 2.1e-36, P = 2.1e-36
 Identities = 79/154 (51%), Positives = 105/154 (68%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P S+ L FHFEPN+YFT   L K Y ++  PD+ D F +DGP I+   G +IDWK+GKNV
Sbjct:   209 PMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNV 268

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T K IKKKQK KG    R +TKTV  DSFFNFF PP +    ++   DDD E   +L AD
Sbjct:   269 TLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENGDL---DDDAEA--ILAAD 323

Query:   108 FEIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDAD 4
             FEIG   R++I+PR+VL++T EA+++++  DYD +
Sbjct:   324 FEIGHFLRERIIPRSVLYFTGEAIEDDDD-DYDEE 357


>pir||S16863 gene DN38 protein - mouse (fragment) >gi|50722 (X61449) DN38 [Mus
            musculus]
            Length = 344

  Minus Strand HSPs:

 Score = 398 (140.1 bits), Expect = 2.1e-36, P = 2.1e-36
 Identities = 79/154 (51%), Positives = 105/154 (68%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P S+ L FHFEPN+YFT   L K Y ++  PD+ D F +DGP I+   G +IDWK+GKNV
Sbjct:   160 PMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNV 219

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T K IKKKQK KG    R +TKTV  DSFFNFF PP +    ++   DDD E   +L AD
Sbjct:   220 TLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENGDL---DDDAEA--ILAAD 274

Query:   108 FEIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDAD 4
             FEIG   R++I+PR+VL++T EA+++++  DYD +
Sbjct:   275 FEIGHFLRERIIPRSVLYFTGEAIEDDDD-DYDEE 308


>sp|Q99733|NPL4_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 4 (NUCLEOSOME ASSEMBLY
            PROTEIN 2) (NAP2) >gi|1679779 (U77456) nucleosome assembly protein
            2 [Homo sapiens]
            Length = 375

  Minus Strand HSPs:

 Score = 370 (130.2 bits), Expect = 1.9e-33, P = 1.9e-33
 Identities = 75/150 (50%), Positives = 103/150 (68%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P S+ L FHFEPN+YFT + L K Y ++  PD+ D F ++GP I++  G  IDWK+GKNV
Sbjct:   201 PMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNV 260

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T K IKKKQK KG    R ITK V  +SFFNFF+P  ++   +    D+D E    L +D
Sbjct:   261 TVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNP--LKASGDGESLDEDSEFT--LASD 316

Query:   108 FEIGQLFRDQIVPRAVLFYTKEAMDENEIFD 16
             FEIG  FR++IVPRAVL++T EA+++++ F+
Sbjct:   317 FEIGHFFRERIVPRAVLYFTGEAIEDDDNFE 347


>gi|1072120 (U39553) nucleosome assembly protein NAP-1 [Drosophila
            melanogaster]
            Length = 370

  Minus Strand HSPs:

 Score = 326 (114.8 bits), Expect = 9.0e-29, P = 9.0e-29
 Identities = 71/153 (46%), Positives = 98/153 (64%), Frame = -2

Query:   459 SYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTK 280
             SYTL FHF+ NEYF+ + L K Y L+   D +D F ++GP I    G  I+W++  N+T 
Sbjct:   187 SYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTV 246

Query:   279 KIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPP-LMENKNEISGNDDDIETQELLQADF 106
             K I+KKQK K   A R I K V  DSFFNFF PP +  ++ EI   DDD  +Q++L  DF
Sbjct:   247 KTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEI---DDD--SQQILATDF 301

Query:   105 EIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDADE 1
             EIG   R +I+P+AVL+YT + +D+ +  D D +E
Sbjct:   302 EIGHFLRARIIPKAVLYYTGDIVDDED--DEDEEE 334

 Score = 323 (113.7 bits), Expect = 1.9e-28, P = 1.9e-28
 Identities = 75/161 (46%), Positives = 100/161 (62%), Frame = -2

Query:   459 SYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTK 280
             SYTL FHF+ NEYF+ + L K Y L+   D +D F ++GP I    G  I+W++  N+T 
Sbjct:   187 SYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTV 246

Query:   279 KIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPP-LMENKNEISGNDDDIETQELLQADF 106
             K I+KKQK K   A R I K V  DSFFNFF PP +  ++ EI   DDD  +Q++L  DF
Sbjct:   247 KTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEI---DDD--SQQILATDF 301

Query:   105 EIGQLFRDQIVPRAVLFYT-----------KEAMDENEIFDYDADE 1
             EIG   R +I+P+AVL+YT           +E  DENE  +YD D+
Sbjct:   302 EIGHFLRARIIPKAVLYYTGDIVDDEDDEDEEEYDENEEDEYDDDD 347


>gi|549975 (U12858) nucleosome assembly protein I-like protein; similar to
           mouse nap I, PIR Accession Number JS0707 [Arabidopsis thaliana]
           Length = 382

  Minus Strand HSPs:

 Score = 296 (104.2 bits), Expect = 1.4e-25, P = 1.4e-25
 Identities = 67/155 (43%), Positives = 94/155 (60%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P  + L F F+ N YF  T L K Y +    DED+      P++  A GTEIDW  GK +
Sbjct:   177 PKGFKLEFFFDTNPYFKNTVLTKSYHMI---DEDE------PLLEKAMGTEIDWYPGKCL 227

Query:   285 TKKIIKKKQKKGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQADF 106
             T+KI+KKK KKGS   + ITK    +SFFNFF PP + +++E    +   + Q L++ D+
Sbjct:   228 TQKILKKKPKKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDY 287

Query:   105 EIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDADE 1
             +IG   R++I+PRAV ++T EAM E E F+ D DE
Sbjct:   288 DIGSTIREKIIPRAVSWFTGEAM-EAEDFEIDDDE 321


>pir||S60892 nucleosome assembly protein 1 - soybean >gi|1161252 (L38856)
            nucleosome assembly protein 1 [Glycine max]
            Length = 358

  Minus Strand HSPs:

 Score = 287 (101.0 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 65/155 (41%), Positives = 93/155 (60%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P  + L F F+ N YF+ T L K Y +    DED+      P++  A GTEI+W  GK +
Sbjct:   161 PKGFKLDFFFDTNPYFSNTVLTKTYHMI---DEDE------PILEKAIGTEIEWYPGKCL 211

Query:   285 TKKIIKKKQKKGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDI--ETQELLQA 112
             T+K++KKK KKGS   + ITKT   +SFFNFF PP  E   + +  D+D+  E Q  ++ 
Sbjct:   212 TQKVLKKKPKKGSKNAKPITKTESCESFFNFFKPP--EVPEDDADIDEDLAEELQNQMEQ 269

Query:   111 DFEIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDADE 1
             D++IG   RD+I+P AV ++T EA   +E  D + DE
Sbjct:   270 DYDIGSTLRDKIIPHAVSWFTGEAAQGDEFEDLEDDE 306


>gi|1778378 (U81289) NAP1Ps [Pisum sativum]
            Length = 366

  Minus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 3.3e-22, P = 3.3e-22
 Identities = 61/155 (39%), Positives = 88/155 (56%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P  + L F F+ N YF+ + L K Y +    DED+      P++  A GTEI W  GK +
Sbjct:   162 PKGFKLEFFFDSNPYFSNSVLTKIYHMV---DEDE------PILEKAIGTEIQWLPGKCL 212

Query:   285 TKKIIKKKQKKGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQADF 106
             T+K++KKK KKG+   + ITKT   +SFFNFF+PP +   +E    D   E Q  ++ D+
Sbjct:   213 TQKVLKKKPKKGAKNAKPITKTETCESFFNFFNPPEVPEDDEDIDEDMAEELQNQMEQDY 272

Query:   105 EIGQLFRDQIVPRAVLFYTKEAMDENEIFDYDADE 1
             +IG   RD+I+P +  ++T EA    E  D D DE
Sbjct:   273 DIGSTIRDKIIPMS--WFTGEAAQGEEFGDLD-DE 304


>dbj||D89271_1 (D89271) similar to Saccharomyces cerevisiae nucleosome assembly
            protein, SWISS-PROT Accession Number p25293 [Schizosaccharomyces
            pombe]
            Length = 353

  Minus Strand HSPs:

 Score = 234 (82.4 bits), Expect = 5.3e-19, P = 5.3e-19
 Identities = 55/152 (36%), Positives = 95/152 (62%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKK--FYTLQVAPDEDDIFDYDGPVIINAKGTEIDW-KEGKNV 286
             Y L F F+ N+YFT   L K  +Y   ++P  + ++D+       A+G +I+W K  KN+
Sbjct:   184 YKLEFEFDSNDYFTNKILTKTYYYKDDLSPSGEFLYDH-------AEGDKINWIKPEKNL 236

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T ++  KKQ+ + +   R +  TV  DSFFNFF PP +++     G DD  +T ELL+ D
Sbjct:   237 TVRVETKKQRNRKTNQTRLVRTTVPNDSFFNFFSPPQLDDDESDDGLDD--KT-ELLELD 293

Query:   108 FEIGQLFRDQIVPRAVLFYTKEA--MDENEIFDYDADE 1
             +++G++F+DQI+P A+  + +E    D N++ + D+++
Sbjct:   294 YQLGEVFKDQIIPLAIDCFLEEGDLSDFNQMDEEDSED 331


>sp|P51860|NPL2_MOUSE NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 2 (BRAIN-SPECIFIC
            PROTEIN, X-LINKED) >gnl|PID|e264690 (X92352) homology to nucleosome
            assembly proteins; specifically expressed in neurons [Mus musculus]
            Length = 460

  Minus Strand HSPs:

 Score = 239 (84.1 bits), Expect = 6.1e-19, P = 6.1e-19
 Identities = 61/147 (41%), Positives = 81/147 (55%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P S+TL FHF+PNEYF    L K Y L+      D   Y G  I  A G +IDW EGKNV
Sbjct:   282 PLSFTLEFHFKPNEYFKNELLTKTYVLKSKLACYDPHPYRGTAIEYATGCDIDWNEGKNV 341

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T + IKKKQ+ +     R +T+    DSFFNFF P      + IS N   +E       D
Sbjct:   342 TLRTIKKKQRHRVWGTVRTVTEDFPKDSFFNFFSP------HGISLNGG-VEND-----D 389

Query:   108 FEIGQLFRDQIVPRAVLFYTKEAMDENE 25
             F +G   R  I+PR+VLF++ +A++  +
Sbjct:   390 FLLGHNLRTYIIPRSVLFFSGDALESQQ 417


>sp|Q99457|NPL3_HUMAN NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 3 >gnl|PID|d1009538
            (D50370) nucleosome assembly protein [Homo sapiens]
            Length = 506

  Minus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 1.2e-16, P = 1.2e-16
 Identities = 53/141 (37%), Positives = 75/141 (53%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P SYT  FHF PN YF    L K Y ++  PD +D F   G  I + KG +ID + GK+V
Sbjct:   353 PVSYTFEFHFLPNPYFRNEVLVKTYIIKAKPDHNDPFFSWGWEIEDCKGCKIDRRRGKDV 412

Query:   285 TKKIIKKKQKKGSAAGRFIT--KTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQA 112
             T   +   Q + +A G      + V   SFFNFF PP +    ++   +D I     L  
Sbjct:   413 T---VTTTQSRTTATGEIEIQPRVVPNASFFNFFSPPEIPMIGKLEPREDAI-----LDE 464

Query:   111 DFEIGQLFRDQIVPRAVLFYTKE 43
             DFEIGQ+  D ++ +++ +YT E
Sbjct:   465 DFEIGQILHDNVILKSIYYYTGE 487


>gi|172034 (M63555) nucleosome assembly protein [Saccharomyces cerevisiae]
           Length = 417

  Minus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 3.2e-16, P = 3.2e-16
 Identities = 57/152 (37%), Positives = 88/152 (57%), Frame = -2

Query:   456 YTLTFHFEP--NEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGK-NV 286
             + L F F+   N +FT   L K Y  Q        F YD     +A+G EI WK+   NV
Sbjct:   229 FKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYD-----HAEGCEISWKDNAHNV 283

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T  +  +KQ+ K +   R I K    +SFFNFFDPP ++N+++    ++D+E  E L  D
Sbjct:   284 TVDLEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLE--ERLALD 341

Query:   108 FEIGQLFRDQIVPRAVLFYTKEAMD-ENEIFDYDADE 1
             + IG+  +D+++PRAV ++T  A++ E E  + +ADE
Sbjct:   342 YSIGEQLKDKLIPRAVDWFTGAALEFEFEEDEEEADE 378


>sp|P25293|NAP1_YEAST NUCLEOSOME ASSEMBLY PROTEIN >pir||S38122 nucleosome
            assembly protein I - yeast (Saccharomyces cerevisiae) >gi|486499
            (Z28273) ORF YKR048c [Saccharomyces cerevisiae]
            Length = 417

  Minus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 3.2e-16, P = 3.2e-16
 Identities = 57/152 (37%), Positives = 88/152 (57%), Frame = -2

Query:   456 YTLTFHFEP--NEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGK-NV 286
             + L F F+   N +FT   L K Y  Q        F YD     +A+G EI WK+   NV
Sbjct:   229 FKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYD-----HAEGCEISWKDNAHNV 283

Query:   285 TKKIIKKKQK-KGSAAGRFITKTVKADSFFNFFDPPLMENKNEISGNDDDIETQELLQAD 109
             T  +  +KQ+ K +   R I K    +SFFNFFDPP ++N+++    ++D+E  E L  D
Sbjct:   284 TVDLEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLE--ERLALD 341

Query:   108 FEIGQLFRDQIVPRAVLFYTKEAMD-ENEIFDYDADE 1
             + IG+  +D+++PRAV ++T  A++ E E  + +ADE
Sbjct:   342 YSIGEQLKDKLIPRAVDWFTGAALEFEFEEDEEEADE 378


>pir||S59561 nucleosome assembly protein I - wheat (fragment) >gi|904028
            (U26918) nucleosome assembly protein I [Triticum aestivum]
            Length = 103

  Minus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 9.3e-11, P = 9.3e-11
 Identities = 38/95 (40%), Positives = 53/95 (55%), Frame = -2

Query:   465 PDSYTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNV 286
             P  + L F  + N +F  + L K Y +    DEDD      P++  A GTEI+W  GKNV
Sbjct:    18 PKGFKLEFFIDTNPFFKNSVLTKSYHMV---DEDD------PILEKAIGTEIEWYPGKNV 68

Query:   285 TKKIIKKKQKKGSAAGRFITKTVKADSFFNFFDPP 181
             T+KI+KKK KKGS   + IT+ +K+    + F  P
Sbjct:    69 TQKILKKKPKKGSKNTKPITQKLKSARASSTFSAP 103


>gi|2253411 (AF007219) PP2A inhibitor [Tetraodon fluviatilis]
            Length = 272

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.00021, Sum P(2) = 0.00021
 Identities = 29/89 (32%), Positives = 45/89 (50%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKGSAAGRFITKTVKADSFFNFF 190
               + + K    AGR   +  + +SFF +F
Sbjct:   170 SSQTQNK----AGRK-RQHEEPESFFTWF 193

 Score = 87 (30.6 bits), Expect = 0.00082, Sum P(2) = 0.00082
 Identities = 23/69 (33%), Positives = 35/69 (50%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKG 250
               + + K G
Sbjct:   170 SSQTQNKAG 178

 Score = 56 (19.7 bits), Expect = 0.00021, Sum P(2) = 0.00021
 Identities = 12/30 (40%), Positives = 18/30 (60%), Frame = -2

Query:   114 ADFEIGQLFRDQIVPRAVLFYTKEAMDENE 25
             AD E+G++ +D I P  + +Y    MDE E
Sbjct:   201 AD-ELGEVIKDDIWPNPLQYYLVPDMDEEE 229


>pir||I64837 Set beta isoform - rat >bbs|143664 (S68987) Set beta
            isoform=leukemogenesis protein {alternatively spliced} [rats,
            neonatal kidney, Peptide, 277 aa] [Rattus sp.]
            Length = 277

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.00087, Sum P(2) = 0.00087
 Identities = 28/89 (31%), Positives = 43/89 (48%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKGSAAGRFITKTVKADSFFNFF 190
                + Q K S   +      + +SFF +F
Sbjct:   170 S-SQTQNKASRKRQH----EEPESFFTWF 193

 Score = 83 (29.2 bits), Expect = 0.0030, Sum P(2) = 0.0030
 Identities = 24/70 (34%), Positives = 35/70 (50%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKGS 247
                + Q K S
Sbjct:   170 S-SQTQNKAS 178

 Score = 56 (19.7 bits), Expect = 0.00087, Sum P(2) = 0.00087
 Identities = 15/39 (38%), Positives = 22/39 (56%), Frame = -2

Query:   114 ADFEIGQLFRDQIVPRAVLFYTKEAMD--ENEIFDYDADE 1
             AD E+G++ +D I P  + +Y    MD  E E  D D D+
Sbjct:   201 AD-ELGEVIKDDIWPNPLQYYLVPDMDDEEGEAEDDDDDD 239

 Score = 40 (14.1 bits), Expect = 0.036, Sum P(2) = 0.036
 Identities = 8/24 (33%), Positives = 14/24 (58%), Frame = -2

Query:   186 PPLMENKNEISGNDDDIETQELLQ 115
             P + + + E   +DDD E +E L+
Sbjct:   223 PDMDDEEGEAEDDDDDDEEEEGLE 246


>pir||I51908 Set alpha isoform - rat >bbs|143660 (S68589) Set alpha
            isoform=leukemogenesis protein {alternatively spliced} [rats,
            neonatal kidney, Peptide, 289 aa] [Rattus sp.] >prf||2008109A set
            gene [Rattus norvegicus]
            Length = 289

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.0010, Sum P(2) = 0.0010
 Identities = 28/89 (31%), Positives = 43/89 (48%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   134 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 181

Query:   276 IIKKKQKKGSAAGRFITKTVKADSFFNFF 190
                + Q K S   +      + +SFF +F
Sbjct:   182 S-SQTQNKASRKRQH----EEPESFFTWF 205

 Score = 83 (29.2 bits), Expect = 0.0034, Sum P(2) = 0.0034
 Identities = 24/70 (34%), Positives = 35/70 (50%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   134 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 181

Query:   276 IIKKKQKKGS 247
                + Q K S
Sbjct:   182 S-SQTQNKAS 190

 Score = 56 (19.7 bits), Expect = 0.0010, Sum P(2) = 0.0010
 Identities = 15/39 (38%), Positives = 22/39 (56%), Frame = -2

Query:   114 ADFEIGQLFRDQIVPRAVLFYTKEAMD--ENEIFDYDADE 1
             AD E+G++ +D I P  + +Y    MD  E E  D D D+
Sbjct:   213 AD-ELGEVIKDDIWPNPLQYYLVPDMDDEEGEAEDDDDDD 251

 Score = 40 (14.1 bits), Expect = 0.042, Sum P(2) = 0.041
 Identities = 8/24 (33%), Positives = 14/24 (58%), Frame = -2

Query:   186 PPLMENKNEISGNDDDIETQELLQ 115
             P + + + E   +DDD E +E L+
Sbjct:   235 PDMDDEEGEAEDDDDDDEEEEGLE 258


>sp|Q01105|SET_HUMAN SET PROTEIN (HLA-DR ASSOCIATED PROTEIN II) (PHAPII)
            (PHOSPHATASE 2A INHIBITOR I2PP2A) >gi|403009 (X75091) PHAPII
            (Putative HLA DR Associated Protein II) [Homo sapiens] >gi|1263308
            (U51924) phosphatase 2A inhibitor I2PP2A [Homo sapiens]
            Length = 277

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 28/89 (31%), Positives = 43/89 (48%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKGSAAGRFITKTVKADSFFNFF 190
                + Q K S   +      + +SFF +F
Sbjct:   170 S-SQTQNKASRKRQH----EEPESFFTWF 193

 Score = 83 (29.2 bits), Expect = 0.0060, Sum P(2) = 0.0060
 Identities = 24/70 (34%), Positives = 35/70 (50%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKGS 247
                + Q K S
Sbjct:   170 S-SQTQNKAS 178

 Score = 53 (18.7 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 11/30 (36%), Positives = 18/30 (60%), Frame = -2

Query:   114 ADFEIGQLFRDQIVPRAVLFYTKEAMDENE 25
             AD E+G++ +D I P  + +Y    MD+ E
Sbjct:   201 AD-ELGEVIKDDIWPNPLQYYLVPDMDDEE 229

 Score = 36 (12.7 bits), Expect = 0.092, Sum P(2) = 0.088
 Identities = 8/24 (33%), Positives = 14/24 (58%), Frame = -2

Query:   186 PPLMENKNEISGNDDDIETQELLQ 115
             P + + + E   +DDD E +E L+
Sbjct:   223 PDMDDEEGEGEEDDDDDEEEEGLE 246


>pir||A45018 template activating factor-I, splice form beta - human >gi|338039
            (M93651) set [Homo sapiens]
            Length = 277

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 28/89 (31%), Positives = 43/89 (48%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKGSAAGRFITKTVKADSFFNFF 190
                + Q K S   +      + +SFF +F
Sbjct:   170 S-SQTQNKASRKRQH----EEPESFFTWF 193

 Score = 83 (29.2 bits), Expect = 0.0060, Sum P(2) = 0.0060
 Identities = 24/70 (34%), Positives = 35/70 (50%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   122 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 169

Query:   276 IIKKKQKKGS 247
                + Q K S
Sbjct:   170 S-SQTQNKAS 178

 Score = 53 (18.7 bits), Expect = 0.0018, Sum P(2) = 0.0018
 Identities = 11/30 (36%), Positives = 18/30 (60%), Frame = -2

Query:   114 ADFEIGQLFRDQIVPRAVLFYTKEAMDENE 25
             AD E+G++ +D I P  + +Y    MD+ E
Sbjct:   201 AD-ELGEVIKDDIWPNPLQYYLVPDMDDEE 229

 Score = 36 (12.7 bits), Expect = 0.092, Sum P(2) = 0.088
 Identities = 8/24 (33%), Positives = 14/24 (58%), Frame = -2

Query:   186 PPLMENKNEISGNDDDIETQELLQ 115
             P + + + E   +DDD E +E L+
Sbjct:   223 PDMDDEEGEGEEDDDDDEEEEGLE 246


>pir||I59377 template activating factor-I, splice form alpha - human
            >gnl|PID|d1008730 (D45198) template acyivating factor-I alpha [Homo
            sapiens]
            Length = 290

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.0020, Sum P(2) = 0.0020
 Identities = 28/89 (31%), Positives = 43/89 (48%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   135 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 182

Query:   276 IIKKKQKKGSAAGRFITKTVKADSFFNFF 190
                + Q K S   +      + +SFF +F
Sbjct:   183 S-SQTQNKASRKRQH----EEPESFFTWF 206

 Score = 83 (29.2 bits), Expect = 0.0070, Sum P(2) = 0.0070
 Identities = 24/70 (34%), Positives = 35/70 (50%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTELKKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTKK 277
             Y + F+F+ N YF    L K + L  + D         P   ++K TEI WK GK++TK+
Sbjct:   135 YRIDFYFDENPYFENKVLSKEFHLNESGD---------P---SSKSTEIKWKSGKDLTKR 182

Query:   276 IIKKKQKKGS 247
                + Q K S
Sbjct:   183 S-SQTQNKAS 191

 Score = 53 (18.7 bits), Expect = 0.0020, Sum P(2) = 0.0020
 Identities = 11/30 (36%), Positives = 18/30 (60%), Frame = -2

Query:   114 ADFEIGQLFRDQIVPRAVLFYTKEAMDENE 25
             AD E+G++ +D I P  + +Y    MD+ E
Sbjct:   214 AD-ELGEVIKDDIWPNPLQYYLVPDMDDEE 242

 Score = 36 (12.7 bits), Expect = 0.11, Sum P(2) = 0.10
 Identities = 8/24 (33%), Positives = 14/24 (58%), Frame = -2

Query:   186 PPLMENKNEISGNDDDIETQELLQ 115
             P + + + E   +DDD E +E L+
Sbjct:   236 PDMDDEEGEGEEDDDDDEEEEGLE 259


>sp|P53997|SET_DROME SET PROTEIN >gi|940889 (U30470) SET [Drosophila
            melanogaster]
            Length = 268

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.016, P = 0.015
 Identities = 27/70 (38%), Positives = 38/70 (54%), Frame = -2

Query:   456 YTLTFHFEPNEYFTQTEL-KKFYTLQVAPDEDDIFDYDGPVIINAKGTEIDWKEGKNVTK 280
             Y + FHF+ N YF    L K+F+    A  E+     D P    +  T I WKEGKN+ K
Sbjct:   122 YRINFHFDENPYFENKVLTKEFHLNSAAASENG----DWPA---STSTPIKWKEGKNLLK 174

Query:   279 KIIKK----KQKKGS 247
              ++ K    K+K+ S
Sbjct:   175 LLLTKPYGNKKKRNS 189


>pir||A60396 antigen 7H8/5 - Plasmodium falciparum (fragment)
            Length = 90

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 0.36, P = 0.31
 Identities = 17/29 (58%), Positives = 19/29 (65%), Frame = +2

Query:   122 SS*VSMSSSFPLISFLFSMSGGSKKLKKE 208
             SS  S+S S P  SFLFS+S   KK KKE
Sbjct:    34 SSPFSLSLSLPFSSFLFSLSFSLKKRKKE 62


>gi|1184965 (U46757) P74 [Bombyx mori nuclear polyhedrosis virus]
            Length = 61

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 2.3, P = 0.90
 Identities = 13/28 (46%), Positives = 18/28 (64%), Frame = +2

Query:   212 AFTVFVMKRPAALPFFCFFLIIFFVTFF 295
             AFT FV+ +   L FF FF+I   +TF+
Sbjct:    19 AFTAFVIHKQ--LIFFIFFVIFLMITFY 44


>gi|1245612 (U52309) envelope glycoprotein, V1-V2 region [Human
            immunodeficiency virus type 1] >gi|1245622 (U52314) envelope
            glycoprotein, V1-V2 region [Human immunodeficiency virus type 1]
            Length = 79

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 2.3, P = 0.90
 Identities = 13/47 (27%), Positives = 23/47 (48%), Frame = -2

Query:   177 MENKNEISGNDDDIETQELLQADFEIGQLFRDQIVPRAVLFYTKEAM 37
             ++N N I+ + + IE  E+    F I    RD++     LFY  + +
Sbjct:    10 VKNANNINNSTEPIENGEMKNCSFNITTNIRDKMKKEHALFYNLDVV 56


>gi|1245624 (U52315) envelope glycoprotein, V1-V2 region [Human
            immunodeficiency virus type 1]
            Length = 79

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 2.3, P = 0.90
 Identities = 13/47 (27%), Positives = 22/47 (46%), Frame = -2

Query:   177 MENKNEISGNDDDIETQELLQADFEIGQLFRDQIVPRAVLFYTKEAM 37
             ++N N  S + + IE  E+    F I    RD++     LFY  + +
Sbjct:    10 VKNANNTSNSSEPIENGEMKNCSFNITTNIRDKVQREHALFYNLDVV 56


>gnl|PID|e330200 (Z81111) T01G5.6 [Caenorhabditis elegans]
            Length = 103

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 2.5, P = 0.92
 Identities = 19/64 (29%), Positives = 30/64 (46%), Frame = +2

Query:   152 PLISFLFSMSGGSKKLKKESAFTVFVMKRPAALPFFCFFLIIFFVTFFPSFQ-SISVPLA 328
             PL+S LF+   G  + ++    +  +  +    P FC F  I FV   P F   ISVP  
Sbjct:     4 PLLSHLFARFTGRARRREGYTTSKKLQFKQITTPTFCRFSPIAFVVSVPYFDLEISVPTG 63

Query:   329 LIIT 340
             + ++
Sbjct:    64 IFVS 67


>gi|1245608 (U52307) envelope glycoprotein, V1-V2 region [Human
            immunodeficiency virus type 1] >gi|1245610 (U52308) envelope
            glycoprotein, V1-V2 region [Human immunodeficiency virus type 1]
            >gi|1245620 (U52313) envelope glycoprotein, V1-V2 region [Human
            immunodeficiency virus type 1]
            Length = 79

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 3.0, P = 0.95
 Identities = 13/47 (27%), Positives = 22/47 (46%), Frame = -2

Query:   177 MENKNEISGNDDDIETQELLQADFEIGQLFRDQIVPRAVLFYTKEAM 37
             ++N N  S + + IE  E+    F I    RD++     LFY  + +
Sbjct:    10 VKNANNTSNSTEPIENGEMKNCSFNITTNIRDKVQREHALFYNLDVV 56


>gi|2226074 (AF005044) OrfF [Escherichia coli]
            Length = 103

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 5.8, P = 1.0
 Identities = 13/42 (30%), Positives = 23/42 (54%), Frame = +1

Query:   169 IFHEWRVEEVEERVSFHSFRNETTSSAAFLLLFLNNFLCNVF 294
             I HEW+  ++ E+V+      + T + AF+ +FLN    + F
Sbjct:    55 IIHEWKNADISEQVTLVRLYLKVTFTCAFVAVFLNYLFSDEF 96


>gi|540222 (U14543) envelope glycoprotein [Human immunodeficiency virus type 1]
           Length = 78

  Minus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 6.6, P = 1.0
 Identities = 14/50 (28%), Positives = 24/50 (48%), Frame = -2

Query:   171 NKNEISGNDDDIETQELLQADFEIGQLFRDQIVPRAVLFYTKE--AMDEN 28
             N    +G++  +E  E+    F I    RD+I     LFY  +  +++EN
Sbjct:    19 NTTNTTGSEGRMEEGEMKNCSFNITTSIRDKIEKEYALFYKSDVVSIEEN 68


>sp|P31703|GSPE_ERWCA GENERAL SECRETION PATHWAY PROTEIN E (TYPE II TRAFFIC
            WARDEN ATPASE) (PECTIC ENZYMES SECRETION PROTEIN OUTE) >pir||S32859
            outE protein - Erwinia carotovora subsp. carotovora >gi|42187
            (X70049) outE gene product [Erwinia carotovora]
            Length = 498

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 8.2, Sum P(2) = 1.0
 Identities = 17/33 (51%), Positives = 20/33 (60%), Frame = -2

Query:   396 FYTL-QVAPDEDDIFDYD--GPVI--INAKGTE 313
             FYTL +  PD DD+ D D   P+I  INA  TE
Sbjct:    98 FYTLVEELPDSDDLLDADDDAPIIRLINAMLTE 130

 Score = 57 (20.1 bits), Expect = 8.2, Sum P(2) = 1.0
 Identities = 20/85 (23%), Positives = 46/85 (54%), Frame = -3

Query:   281 RKLLRKSRRKAALLVVSLRKL*KLTLSST---SSTLHSWKIRMKSVEMMM-TLKLRNCCK 114
             R++LR  R+ A+LLV  ++ + KL ++          + ++  +++++ + TL      +
Sbjct:   159 REILRPQRKLASLLVSRIKVMAKLDIAEKRVPQDGRMALRVGGRAIDVRVSTLPSNYGER 218

Query:   113 LILRLVSYSVTKLCLEQCCFTQRKQ 39
             ++LRL+  +  KL LE    ++R +
Sbjct:   219 VVLRLLDKNSVKLDLELLGMSERNR 243


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.88
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.367   0.164   0.627
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.349   0.148   0.471
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.347   0.155   0.506
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.385   0.176   0.782
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.316   0.137   0.395    same    same    same
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.354   0.151   0.478
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      154       154      10. 61 3  12 22   0.095 34
                                                  30    0.12 36
   +2      0      155       155      10. 61 3  12 22   0.096 34
                                                  30    0.12 36
   +1      0      155       155      10. 61 3  12 22   0.096 34
                                                  30    0.12 36
   -1      0      155       155      10. 61 3  12 22   0.096 34
                                                  30    0.12 36
   -2      0      155       155      10. 61 3  12 22    0.10 34
                                                  30    0.12 36
   -3      0      154       154      10. 61 3  12 22   0.095 34
                                                  30    0.12 36


Statistics:

  Database:  ../../_tempdbs/nrdb
    Title:  ../../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  32
  No. of states in DFA:  594 (59 KB)
  Total size of DFA:  186 KB (192 KB)
  Time to generate neighborhood:  0.02u 0.00s 0.02t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  106.66u 0.64s 107.30t  Elapsed: 00:00:21
  Total cpu time:  106.72u 0.70s 107.42t  Elapsed: 00:00:21
  Start:  Thu Feb  5 02:11:14 1998   End:  Thu Feb  5 02:11:35 1998

Date: 16:29:17 on Sun 17 Dec 117.