blastx_gbnr_files/CPlasFal_156_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CPlasFal_156
        (655 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|914919            (U27338) PfEMP1 variant 1 of stra... -1   249  4.7e-23   3
A gi|886377            (L40609) variant-specific surface... -1   235  2.2e-22   3
A gi|886380            (L42636) variant-specific surface... -1   204  8.6e-22   3
A gi|886378            (L40609) variant-specific surface... -1   210  4.3e-21   3
A gi|886375            (L40608) variant-specific surface... -1   210  6.8e-21   3
A gi|1809295           (U67959) member of var gene famil... -1   204  5.7e-20   3
A gi|1297091           (U53324) 3D7var1 [Plasmodium falc... -1   200  4.0e-18   2
A pir||B26696          hypothetical protein 1 (CYb-COII ... +3    74  0.16      3
A gi|897642            (M14820) ORF2 bases 1807-2850; fi... +3    88  0.49      1
A pir||A05235          hypothetical protein A-288 - Tryp... +3    88  0.52      1
A pir||F22845          hypothetical protein 6 - Trypanos... +3    85  0.89      1
A pir||A44971          hypothetical protein 1 - Plasmodi... +2    57  0.91      2
A gi|1353533           (U38906) ORF16 [Bacteriophage r1t]   -1    63  0.93      1
A sp|P21358|RMAR_CANGA MITOCHONDRIAL RIBOSOMAL PROTEIN V... -1    67  0.94      2
A gi|862343            (L10908) Gcap1 gene product [Mus ... +1    62  0.97      1
A pir||S04682          ribosomal protein var1 - yeast (C... -1    65  0.99      2
A gnl|PID|e308184      (Z92968) F32H5A.5 [Caenorhabditis... +2    81  0.994     1
A sp|P14592|24KD_PLACH 24 KD ANTIGEN >gi|829214 (X04892)... +2    60  0.997     1
A gi|602930            (U13812) transposase [Haematobia ... -1    60  0.997     1
A pir||S51911          cryptogene protein G5(ND3) - Saur... +3    63  0.9997    1
A pir||C30010          hypothetical ORF-6 protein - Saur... +3    78  0.9997    1
A pir||I30010          NADH dehydrogenase (ubiquinone) (... +3    70  0.9998    2
A gi|501027            (U01849) ORF2 [Trypanosoma brucei]   +3    73  0.9998    1



>gi|914919 (U27338) PfEMP1 variant 1 of strain MC [Plasmodium falciparum]
           Length = 2924

  Minus Strand HSPs:

 Score = 249 (87.7 bits), Expect = 4.7e-23, Sum P(3) = 4.7e-23
 Identities = 49/78 (62%), Positives = 61/78 (78%), Frame = -1

Query:   607 KENELYGTNNTK-NTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHN---EHML 440
             KENEL+GTN+TK NT+ NS AK +++DPI NQLNLFH W+DRHRDMCEK + N   E +L
Sbjct:  2715 KENELFGTNHTKKNTSTNSVAKNTNTDPIHNQLNLFHTWLDRHRDMCEKWDTNNKKEELL 2774

Query:   439 NKLNEEWTMDHNENILNIHP 380
             +KL EEW  D+N    NI+P
Sbjct:  2775 DKLKEEWNKDNNSG--NINP 2792

 Score = 59 (20.8 bits), Expect = 4.7e-23, Sum P(3) = 4.7e-23
 Identities = 13/18 (72%), Positives = 16/18 (88%), Frame = -3

Query:   653 SLSTNHNVDIYDEVLKRK 600
             SL++N  VDIYDE+LKRK
Sbjct:  2699 SLNSN-KVDIYDELLKRK 2715

 Score = 41 (14.4 bits), Expect = 4.7e-23, Sum P(3) = 4.7e-23
 Identities = 11/33 (33%), Positives = 18/33 (54%), Frame = -3

Query:   371 LDDIHKINDETYNMISTNNIYYQ-DDNDKIPLD 276
             L+D+ K  +E Y     ++IYY   D+D   +D
Sbjct:  2859 LEDLDKPFNEPYYYDVQDDIYYDVHDHDTSTVD 2891


>gi|886377 (L40609) variant-specific surface protein [Plasmodium falciparum]
           Length = 3006

  Minus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 2.2e-22, Sum P(3) = 2.2e-22
 Identities = 46/76 (60%), Positives = 55/76 (72%), Frame = -1

Query:   607 KENELYGTNNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKL-NHNEHMLNKL 431
             KENEL+GTN+ K T+ +S AK +  DPI NQL LFHKW+DRHRDMCEKL NH+E  L KL
Sbjct:  2837 KENELFGTNHVKQTSIHSVAKPARDDPIHNQLELFHKWLDRHRDMCEKLKNHHER-LAKL 2895

Query:   430 NEEWTMDHNENILNIHP 380
              EEW  + +    N HP
Sbjct:  2896 KEEWENETHSG--NTHP 2910

 Score = 55 (19.4 bits), Expect = 2.2e-22, Sum P(3) = 2.2e-22
 Identities = 11/14 (78%), Positives = 12/14 (85%), Frame = -3

Query:   641 NHNVDIYDEVLKRK 600
             N + DIYDEVLKRK
Sbjct:  2824 NGDYDIYDEVLKRK 2837

 Score = 53 (18.7 bits), Expect = 2.2e-22, Sum P(3) = 2.2e-22
 Identities = 16/40 (40%), Positives = 26/40 (65%), Frame = -3

Query:   392 EYTPPST-LDDIHKINDETYNMISTNNIYYQ-DDNDKIPLDN 273
             E+T   T LDD+  IN+E Y  +  ++IYY  +D+D   +D+
Sbjct:  2935 EFTNMDTILDDLD-INNEPYYDVQ-DDIYYDVNDHDTSTVDS 2974

 Score = 40 (14.1 bits), Expect = 7.7e-21, Sum P(3) = 7.7e-21
 Identities = 7/18 (38%), Positives = 11/18 (61%), Frame = -3

Query:   635 NVDIYDEVLKRKRIIWNK 582
             N + Y++ +KRK   W K
Sbjct:   615 NCECYEKWIKRKEHEWEK 632


>gi|886380 (L42636) variant-specific surface protein [Plasmodium falciparum]
           Length = 2182

  Minus Strand HSPs:

 Score = 204 (71.8 bits), Expect = 8.6e-22, Sum P(3) = 8.6e-22
 Identities = 42/79 (53%), Positives = 53/79 (67%), Frame = -1

Query:   622 MMKFLKENELYGT-NNTKNTTFNSFAKQSHSD-PIMNQLNLFHKWIDRHRDMCEKLNHNE 449
             M+K  KENEL+GT ++ KN T N    Q+ SD PI NQ+NLFHKW+DRHRDMCEK  +N 
Sbjct:  1986 MLK-RKENELFGTQHHPKNITSNRVVTQTSSDDPITNQINLFHKWLDRHRDMCEKWKNNH 2044

Query:   448 HMLNKLNEEWTMDHNENILN 389
               L KL E W  + +   +N
Sbjct:  2045 ERLPKLKELWENETHSGDIN 2064

 Score = 66 (23.2 bits), Expect = 8.6e-22, Sum P(3) = 8.6e-22
 Identities = 18/60 (30%), Positives = 30/60 (50%), Frame = -3

Query:   386 TPPSTLDDIHKINDETYNMISTNNIYYQDDNDKIPLDNLGSTNIII**YSNNNIFHPPNL 207
             T  + LDD+ K N+  Y     ++IYY  ++DK   D++   +  +    NNN   P N+
Sbjct:  2104 TMDTILDDLEKYNEPYYYDFYKHDIYYDVNDDKASEDHINMDHNKM---DNNNSDVPTNV 2160

 Score = 63 (22.2 bits), Expect = 8.6e-22, Sum P(3) = 8.6e-22
 Identities = 13/18 (72%), Positives = 16/18 (88%), Frame = -3

Query:   653 SLSTNHNVDIYDEVLKRK 600
             +LS NH +DIYDE+LKRK
Sbjct:  1974 ALSGNH-IDIYDEMLKRK 1990


>gi|886378 (L40609) variant-specific surface protein [Plasmodium falciparum]
           Length = 2664

  Minus Strand HSPs:

 Score = 210 (73.9 bits), Expect = 4.3e-21, Sum P(3) = 4.3e-21
 Identities = 41/78 (52%), Positives = 54/78 (69%), Frame = -1

Query:   622 MMKFLKENELYGT-NNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEH 446
             M+K  KENEL+GT ++TK+T   + AK +  DPI NQ+NLFHKW+DRHRDMCEK  +N  
Sbjct:  2464 MLK-RKENELFGTKHHTKHTNTYNVAKPARDDPITNQINLFHKWLDRHRDMCEKWKNNHE 2522

Query:   445 MLNKLNEEWTMDHNENILN 389
              L KL E W  + +   +N
Sbjct:  2523 RLPKLKELWENETHSGDIN 2541

 Score = 63 (22.2 bits), Expect = 4.3e-21, Sum P(3) = 4.3e-21
 Identities = 13/18 (72%), Positives = 16/18 (88%), Frame = -3

Query:   653 SLSTNHNVDIYDEVLKRK 600
             +LS NH +DIYDE+LKRK
Sbjct:  2452 ALSGNH-IDIYDEMLKRK 2468

 Score = 56 (19.7 bits), Expect = 4.3e-21, Sum P(3) = 4.3e-21
 Identities = 17/60 (28%), Positives = 31/60 (51%), Frame = -3

Query:   386 TPPSTLDDIHKINDETYNMISTNNIYYQD-DNDKIPLDNLGSTNIII**YSNNNIFHPPN 210
             T  + LDD+ K N+  Y     ++I Y D D +K  +D++   +  +   +NNN+  P  
Sbjct:  2581 TMDTILDDLEKYNEPYYYDFYEDDIIYHDVDVEKSSMDDIYVDHNNV---TNNNMDVPTK 2637

Query:   209 L 207
             +
Sbjct:  2638 M 2638


>gi|886375 (L40608) variant-specific surface protein [Plasmodium falciparum]
           Length = 3078

  Minus Strand HSPs:

 Score = 210 (73.9 bits), Expect = 6.8e-21, Sum P(3) = 6.8e-21
 Identities = 41/78 (52%), Positives = 54/78 (69%), Frame = -1

Query:   622 MMKFLKENELYGT-NNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEH 446
             M+K  KENEL+GT ++TK+T   + AK +  DPI NQ+NLFHKW+DRHRDMCEK  +N  
Sbjct:  2878 MLK-RKENELFGTKHHTKHTNTYNVAKPARDDPITNQINLFHKWLDRHRDMCEKWKNNHE 2936

Query:   445 MLNKLNEEWTMDHNENILN 389
              L KL E W  + +   +N
Sbjct:  2937 RLPKLKELWENETHSGDIN 2955

 Score = 63 (22.2 bits), Expect = 6.8e-21, Sum P(3) = 6.8e-21
 Identities = 13/18 (72%), Positives = 16/18 (88%), Frame = -3

Query:   653 SLSTNHNVDIYDEVLKRK 600
             +LS NH +DIYDE+LKRK
Sbjct:  2866 ALSGNH-IDIYDEMLKRK 2882

 Score = 56 (19.7 bits), Expect = 6.8e-21, Sum P(3) = 6.8e-21
 Identities = 17/60 (28%), Positives = 31/60 (51%), Frame = -3

Query:   386 TPPSTLDDIHKINDETYNMISTNNIYYQD-DNDKIPLDNLGSTNIII**YSNNNIFHPPN 210
             T  + LDD+ K N+  Y     ++I Y D D +K  +D++   +  +   +NNN+  P  
Sbjct:  2995 TMDTILDDLEKYNEPYYYDFYEDDIIYHDVDVEKSSMDDIYVDHNNV---TNNNMDVPTK 3051

Query:   209 L 207
             +
Sbjct:  3052 M 3052


>gi|1809295 (U67959) member of var gene family; implicated in antigenic
            variation [Plasmodium falciparum]
            Length = 2647

  Minus Strand HSPs:

 Score = 204 (71.8 bits), Expect = 5.7e-20, Sum P(3) = 5.7e-20
 Identities = 36/63 (57%), Positives = 45/63 (71%), Frame = -1

Query:   607 KENELYGTNNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEHMLNKLN 428
             KENEL+GTN+ K T+ +S AK +  DPI NQL LFHKW+D HRDMCE+  ++   L KL 
Sbjct:  2417 KENELFGTNHVKQTSIHSVAKPTRDDPIHNQLELFHKWLDSHRDMCEQCKNDNERLAKLK 2476

Query:   427 EEW 419
             E W
Sbjct:  2477 ELW 2479

 Score = 65 (22.9 bits), Expect = 5.7e-20, Sum P(3) = 5.7e-20
 Identities = 12/18 (66%), Positives = 16/18 (88%), Frame = -3

Query:   653 SLSTNHNVDIYDEVLKRK 600
             +LS N ++DIYDE+LKRK
Sbjct:  2400 TLSGNEHIDIYDELLKRK 2417

 Score = 49 (17.2 bits), Expect = 5.7e-20, Sum P(3) = 5.7e-20
 Identities = 14/45 (31%), Positives = 23/45 (51%), Frame = -3

Query:   398 YIEYTPPST-----LDDIHKINDETYNMISTNNIYYQDDNDKIPLD 276
             Y++  P ++     LDD+ K N+  Y++    N    DDND   +D
Sbjct:  2570 YVDSNPDNSSMDTILDDLEKYNEPYYDVQDIYNDV-NDDNDISTVD 2614

 Score = 48 (16.9 bits), Expect = 7.2e-20, Sum P(3) = 7.2e-20
 Identities = 12/37 (32%), Positives = 19/37 (51%), Frame = -2

Query:   111 TIFDYIKNYNREKYEENDNTLIDD*YNYINPKRNMST 1
             TI D ++ YN   Y+      + D YN +N   ++ST
Sbjct:  2582 TILDDLEKYNEPYYD------VQDIYNDVNDDNDIST 2612


>gi|1297091 (U53324) 3D7var1 [Plasmodium falciparum]
            Length = 2042

  Minus Strand HSPs:

 Score = 200 (70.4 bits), Expect = 4.0e-18, Sum P(2) = 4.0e-18
 Identities = 37/67 (55%), Positives = 48/67 (71%), Frame = -1

Query:   607 KENELYGT-NNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEHMLNKL 431
             KENEL+GT ++TK+T   + AK +  DP+ NQLNLFH W+DRHR+MCEK  ++   L KL
Sbjct:  1810 KENELFGTKHHTKHTNTYNVAKPARDDPLHNQLNLFHTWLDRHRNMCEKWKNDNERLAKL 1869

Query:   430 NEEWTMD 410
              EEW  D
Sbjct:  1870 KEEWEND 1876

 Score = 72 (25.3 bits), Expect = 4.0e-18, Sum P(2) = 4.0e-18
 Identities = 13/14 (92%), Positives = 14/14 (100%), Frame = -3

Query:   641 NHNVDIYDEVLKRK 600
             NHNVDIYDE+LKRK
Sbjct:  1797 NHNVDIYDELLKRK 1810


>pir||B26696 hypothetical protein 1 (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6) (fragment)
            >gi|896286 (M10126) NH2 terminus uncertain [Leishmania tarentolae]
            Length = 443

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 0.18, Sum P(3) = 0.16
 Identities = 36/122 (29%), Positives = 57/122 (46%), Frame = +3

Query:   297 IILIIYIVCTYHIICFIINFMNIIKS*WGCIF-NIFSL*SI--VHSSFNLFNICSLWF-- 461
             + + IY++  Y + CFI+  + I    +  IF  +  + SI  V    N F I SL F  
Sbjct:   204 VFIFIYMLTFYVLFCFILIILLICFIYFYIIFIKLIIIQSITCVLIGLNSFAIVSLLFVL 263

Query:   462 ---NFSHISLCLSIHL*NR-FSWFIIGSLCDCLAKLLKVVFLVLFVPYNSFSFK-N---F 617
                NFS + L + I   N  F  ++   L   L+ ++ ++    F+ YN F  K N   F
Sbjct:   264 SVNNFSFLFL-IFISTKNYIFYMYLNFHLIYSLSLIILIILYYFFIVYNMFDIKYNENYF 322

Query:   618 IIN 626
             +IN
Sbjct:   323 LIN 325

 Score = 63 (22.2 bits), Expect = 3.1, Sum P(3) = 0.96
 Identities = 33/112 (29%), Positives = 56/112 (50%), Frame = +3

Query:   300 ILIIYIVCTYHIICFII--NFMNIIKS*WGCIFNIFSL*SIVHSSFNLFNICSLWFNFSH 473
             I+ I ++    I C +I  N   I+   +    N FS   ++  S   + I  ++ NF H
Sbjct:   233 IIFIKLIIIQSITCVLIGLNSFAIVSLLFVLSVNNFSFLFLIFISTKNY-IFYMYLNF-H 290

Query:   474 ISLCLS-IHL*NRFSWFIIGSLCDCLAKLLKVVFLVLFVPYNSFSFKNFIININI 635
             +   LS I L   + +FI+ ++ D   K  +  FL+ F+ + SF F N +I+I I
Sbjct:   291 LIYSLSLIILIILYYFFIVYNMFDI--KYNENYFLINFI-FFSF-FNNLLISIMI 341

 Score = 59 (20.8 bits), Expect = 8.6, Sum P(3) = 1.0
 Identities = 26/96 (27%), Positives = 47/96 (48%), Frame = +3

Query:   306 IIYIVCTYHIICFIINFMNIIKS*WGCIFNIFSL*SIVHSSFNLFNICSLWFNFSHISLC 485
             I Y+   +H+I  +   + II   +  ++N+F     +  + N F I  ++F+F + +L 
Sbjct:   282 IFYMYLNFHLIYSLSLIILIILYYFFIVYNMFD----IKYNENYFLINFIFFSFFN-NLL 336

Query:   486 LSIHL*NRFSWFIIGSLCDCLAKLLKVVFLVLFVPY 593
             +SI +   F    IGS+       LKV  L+L + Y
Sbjct:   337 ISIMIACIF--LCIGSIPIVFGFFLKVFCLLLHLSY 370

 Score = 48 (16.9 bits), Expect = 0.18, Sum P(3) = 0.16
 Identities = 10/25 (40%), Positives = 18/25 (72%), Frame = +1

Query:   193 IYVGSKFGG*KMLLLEYHYMMIFVD 267
             I + S+FG  K+L+L Y+YM+  ++
Sbjct:   116 ILISSRFGY-KILILWYYYMINLIN 139

 Score = 47 (16.5 bits), Expect = 0.18, Sum P(3) = 0.16
 Identities = 13/28 (46%), Positives = 17/28 (60%), Frame = +1

Query:    22 INIIVLIIN*CII--IFLILFTIIIFYI 99
             INII+L I    I  IFL+LF    F++
Sbjct:    41 INIIILTILDSYICFIFLLLFLFCFFFL 68

 Score = 41 (14.4 bits), Expect = 0.68, Sum P(3) = 0.49
 Identities = 10/24 (41%), Positives = 15/24 (62%), Frame = +1

Query:    28 IIVLIIN*CIIIFLILFTIIIFYI 99
             + ++II   IIIF+ L  I I +I
Sbjct:    79 VFMIIIMQYIIIFMFLHVIHILFI 102

 Score = 38 (13.4 bits), Expect = 1.3, Sum P(3) = 0.73
 Identities = 7/12 (58%), Positives = 11/12 (91%), Frame = +1

Query:    55 IIIFLILFTIII 90
             II+FL+L++ II
Sbjct:    10 IILFLLLYSFII 21


>gi|897642 (M14820) ORF2 bases 1807-2850; first start codon at 2032; putative
           [Trypanosoma brucei]
           Length = 272

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.67, P = 0.49
 Identities = 37/125 (29%), Positives = 60/125 (48%), Frame = +3

Query:   246 LYDDIC*SEIIKRNFVIIILIIYIVCTYHIICFIINFMNIIKS*WGCI--FNI-FSL*SI 416
             LY+ IC       NF+I  +  +I  T+HI    I+F N I + +G +  FN+ F     
Sbjct:    14 LYNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMFNVMFCAYLF 73

Query:   417 VHSSFNL-FNICSLWFNFSHISLCLSIHL*NRFSWFIIGSLCDCLAKLLKVVFLVLFVPY 593
                 F + F  C ++F    + + +   L   F  F+   LCD    ++ + F+ L + Y
Sbjct:    74 CLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCD----IVYLDFISLLLLY 129

Query:   594 NSFSFKNFI 620
              +F F NFI
Sbjct:   130 FNFIF-NFI 137


>pir||A05235 hypothetical protein A-288 - Trypanosoma brucei mitochondrion
            (SGC6)
            Length = 288

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.74, P = 0.52
 Identities = 37/125 (29%), Positives = 60/125 (48%), Frame = +3

Query:   246 LYDDIC*SEIIKRNFVIIILIIYIVCTYHIICFIINFMNIIKS*WGCI--FNI-FSL*SI 416
             LY+ IC       NF+I  +  +I  T+HI    I+F N I + +G +  FN+ F     
Sbjct:    30 LYNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMFNVMFCAYLF 89

Query:   417 VHSSFNL-FNICSLWFNFSHISLCLSIHL*NRFSWFIIGSLCDCLAKLLKVVFLVLFVPY 593
                 F + F  C ++F    + + +   L   F  F+   LCD    ++ + F+ L + Y
Sbjct:    90 CLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCD----IVYLDFISLLLLY 145

Query:   594 NSFSFKNFI 620
              +F F NFI
Sbjct:   146 FNFIF-NFI 153


>pir||F22845 hypothetical protein 6 - Trypanosoma brucei mitochondrion (SGC6)
            Length = 347

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 2.2, P = 0.89
 Identities = 36/125 (28%), Positives = 60/125 (48%), Frame = +3

Query:   246 LYDDIC*SEIIKRNFVIIILIIYIVCTYHIICFIINFMNIIKS*WGCIF--NI-FSL*SI 416
             LY+ IC       NF+I  +  +I  T+HI    I+F N I + +G ++  N+ F     
Sbjct:    89 LYNFICFFFAFGINFLIYYIEFFIFITFHIFFDFISFSNYIYNYFGILYMENVMFCAYLF 148

Query:   417 VHSSFNL-FNICSLWFNFSHISLCLSIHL*NRFSWFIIGSLCDCLAKLLKVVFLVLFVPY 593
                 F + F  C ++F    + + +   L   F  F+   LCD    ++ + F+ L + Y
Sbjct:   149 CLFYFVIYFLFCFIFFVIRCLFIVIMDFLFFNFDIFVSILLCD----IVYLDFISLLLLY 204

Query:   594 NSFSFKNFI 620
              +F F NFI
Sbjct:   205 FNFIF-NFI 212


>pir||A44971 hypothetical protein 1 - Plasmodium brasilianum
            Length = 96

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 11/26 (42%), Positives = 16/26 (61%), Frame = +2

Query:   296 YHLDNIYCLYLSYYMFH--H*FYEYH 367
             YH  + Y LY SY+ +H  H ++ YH
Sbjct:    34 YHSYHSYHLYHSYHSYHSYHSYHSYH 59

 Score = 55 (19.4 bits), Expect = 5.3, Sum P(2) = 1.0
 Identities = 11/29 (37%), Positives = 17/29 (58%), Frame = +2

Query:   287 FCHYHLDNIYCLYLSYYMFH--H*FYEYH 367
             F  YH  + Y  Y SY+++H  H ++ YH
Sbjct:    25 FHPYHSYHSYHSYHSYHLYHSYHSYHSYH 53

 Score = 45 (15.8 bits), Expect = 2.4, Sum P(2) = 0.91
 Identities = 8/14 (57%), Positives = 10/14 (71%), Frame = +1

Query:    52 CIIIFLILFTIIIF 93
             CI IF+  FT+I F
Sbjct:    10 CIFIFIFTFTLISF 23


>gi|1353533 (U38906) ORF16 [Bacteriophage r1t]
            Length = 79

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 2.7, P = 0.93
 Identities = 22/64 (34%), Positives = 32/64 (50%), Frame = -1

Query:   598 ELYGTNNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEHM----LNKL 431
             +LYG    +N  FN   K + S  I  +    H+    + D+C K NH++ M    L K+
Sbjct:    11 KLYGL--ARNNNFNVNHK-ALSVKISGRTKHNHELSQLYLDICNKYNHSKQMKWKDLYKI 67

Query:   430 NEEWTMD 410
              EE T D
Sbjct:    68 LEELTKD 74


>sp|P21358|RMAR_CANGA MITOCHONDRIAL RIBOSOMAL PROTEIN VAR1 >gi|600448 (X02893)
            var1 protein (aa 1-339) [Candida utilis]
            Length = 339

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 2.8, Sum P(2) = 0.94
 Identities = 31/129 (24%), Positives = 55/129 (42%), Frame = -1

Query:   622 MMKFLKENELYGTNNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEHM 443
             +MK LK N     NN       +     + + +MN+L+  +K++    +    L H  +M
Sbjct:     3 LMKLLKLN--INNNNNNKLLLKNLLLLMNKNRLMNKLSNNNKYLSELNNKGNSLQHLNNM 60

Query:   442 LNKLNEEWTMDHNENILNIHPHQLL-MIFIKLMM----KHII**VQTIYIIKMIMTKFLL 278
              N   + +  + N  I N    +L+  +  KLM     K II   + +Y I M +     
Sbjct:    61 NNWKLQNYNYNKNNTINNYINSKLINKLLYKLMSLKNNKIII--SKPLYKINMNVINIRF 118

Query:   277 IISDQQISSYNDI 239
                +    +YN+I
Sbjct:   119 YYYNMNNYNYNNI 131

 Score = 55 (19.4 bits), Expect = 2.8, Sum P(2) = 0.94
 Identities = 14/34 (41%), Positives = 19/34 (55%), Frame = -2

Query:    96 IKNYNREKYEE---NDNTLIDD*YNYINPKRNMS 4
             I N N+ KY     N+N  I++ YN IN   NM+
Sbjct:   225 INNINKLKYNNILLNNNNNINNIYNNININNNMN 258


>gi|862343 (L10908) Gcap1 gene product [Mus musculus] >prf||2022314A granule
           cell marker protein [Mus musculus] >prf||2022315A granule cell
           marker protein [Mus musculus]
           Length = 85

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 3.4, P = 0.97
 Identities = 17/37 (45%), Positives = 22/37 (59%), Frame = +1

Query:   391 SIYFH-YDP*SILHSIYLTYVRYGSTFHTYLYVCLSIY 501
             SIY   Y   SI  SIY TY+   +  HTY+Y+ + IY
Sbjct:    26 SIYLSIYLSISIYLSIY-TYIHTHTHTHTYIYIYIYIY 62


>pir||S04682 ribosomal protein var1 - yeast (Candida glabrata) mitochondrion
            (SGC2)
            Length = 336

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 4.6, Sum P(2) = 0.99
 Identities = 31/128 (24%), Positives = 54/128 (42%), Frame = -1

Query:   619 MKFLKENELYGTNNTKNTTFNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEHML 440
             MK LK N     NN       +     + + +MN+L+  +K++    +    L H  +M 
Sbjct:     1 MKLLKLN--INNNNNNKLLLKNLLLLMNKNRLMNKLSNNNKYLSELNNKGNSLQHLNNMN 58

Query:   439 NKLNEEWTMDHNENILNIHPHQLL-MIFIKLMM----KHII**VQTIYIIKMIMTKFLLI 275
             N   + +  + N  I N    +L+  +  KLM     K II   + +Y I M +      
Sbjct:    59 NWKLQNYNYNKNNTINNYINSKLINKLLYKLMSLKNNKIII--SKPLYKINMNVINIRFY 116

Query:   274 ISDQQISSYNDI 239
               +    +YN+I
Sbjct:   117 YYNMNNYNYNNI 128

 Score = 55 (19.4 bits), Expect = 4.6, Sum P(2) = 0.99
 Identities = 14/34 (41%), Positives = 19/34 (55%), Frame = -2

Query:    96 IKNYNREKYEE---NDNTLIDD*YNYINPKRNMS 4
             I N N+ KY     N+N  I++ YN IN   NM+
Sbjct:   222 INNINKLKYNNILLNNNNNINNIYNNININNNMN 255


>gnl|PID|e308184 (Z92968) F32H5A.5 [Caenorhabditis elegans]
            Length = 299

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 5.1, P = 0.99
 Identities = 27/93 (29%), Positives = 48/93 (51%), Frame = +2

Query:   359 EYHQELMGVYIQY--IFIMIHSPFF--IQFI*HMFVMVQLFTHISMSVYPFMK*I*LVHY 526
             EYH+ L+ ++  Y  +FI+     F   +F     ++  +F   + + YPF   I   HY
Sbjct:    64 EYHRVLLLIFESYPSLFILREGLSFWAYRFQCSSLLLKCIF-RFTYAKYPFAAEIWKKHY 122

Query:   527 RITM*LFGKTIKSRIFSIICSI*FVFF*ELHHKYQHY 637
             R+ M      + +  +SI+ +I FVF  + HH + +Y
Sbjct:   123 RLIM------VSTIFYSILLTIPFVFITKEHHGFDYY 153


>sp|P14592|24KD_PLACH 24 KD ANTIGEN >gi|829214 (X04892) 24 kd antigen (38 AA)
            (1 is 2nd base in codon) [Plasmodium chabaudi]
            Length = 37

  Plus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.7, P = 1.0
 Identities = 13/40 (32%), Positives = 23/40 (57%), Frame = +2

Query:   287 FCHYHLDNIYCLYLSYYMF-HH*FYEYHQELMGVYIQYIFI 406
             +C+Y +D     YL++Y   ++  Y Y Q L+ +Y  Y+ I
Sbjct:     2 YCYYMVD-----YLTFYNIKNYKIYTYAQRLLEIYFSYLSI 37


>gi|602930 (U13812) transposase [Haematobia irritans]
           Length = 77

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 5.7, P = 1.0
 Identities = 22/75 (29%), Positives = 36/75 (48%), Frame = -1

Query:   598 ELYGTNNTKNTT-FNSFAKQSHSDPIMNQLNLFHKWIDRHRDMCEKLNHNEHMLNKLNEE 422
             +L    NT N T + +  K +    +  +L L   WI + +D     N  +H   K+ +E
Sbjct:    10 DLVFIENTMNKTDYLNILKNNLPSSV-EKLGLHRSWIFQ-QD-----NDPKHTA-KVVKE 61

Query:   421 WTMDHNENILNIHPHQ 374
             W + H  N+L+ HP Q
Sbjct:    62 WLLHHTPNVLD-HPPQ 76


>pir||S51911 cryptogene protein G5(ND3) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 89

  Plus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 8.0, P = 1.0
 Identities = 14/52 (26%), Positives = 31/52 (59%), Frame = +3

Query:   294 IIILIIYIVCTYHII--CFI-INFMNIIKS*WGCIFN--IFSL*SIVHSSFN 434
             +I++++Y +C    +  CF+ + F +I+ + W C+    IF L  +++S F+
Sbjct:    33 LIVVVLYFMCKLFFVWFCFVFLLFWSIVFNIWFCVLFVFIFFLLILINSVFS 84


>pir||C30010 hypothetical ORF-6 protein - Sauroleishmania tarentolae
            mitochondrion (SGC6)
            Length = 245

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 8.1, P = 1.0
 Identities = 34/100 (34%), Positives = 49/100 (49%), Frame = +3

Query:   285 NFVIIILIIYIVCT-YHIICFIINFMNIIKS*WGCIFNIFSL*SIVHSSFNLFNICSLWF 461
             N   +I   Y+ C  Y IICFI  F+  +     C+F I      +  +F+++ I  L  
Sbjct:    35 NMFNVIFCSYLFCLFYFIICFIFCFIFFVIR---CLFVIIY--DFLFFNFDIY-ISFLMC 88

Query:   462 NFSHIS-LC-LSIHL*NRFSWFIIGSLCDCLAKLLKVVFLVLF 584
             +  +I  +C L I+    FS FI G  C     +L  VFLVLF
Sbjct:    89 DIIYIDYICFLLIYFGFIFS-FITGFFCFIF--VLNYVFLVLF 128


>pir||I30010 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 5 -
            Sauroleishmania tarentolae mitochondrion (SGC6)
            Length = 502

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 8.4, Sum P(2) = 1.0
 Identities = 22/67 (32%), Positives = 33/67 (49%), Frame = +3

Query:   429 FNLFNICSLWF--NFSHISLCLSIHL*NRFSWFIIGSLCDCLAKLL-KVVFLVLFVPYNS 599
             F + N CSLWF   F    L L + +   F +FI+  LC CL  +   V++    + +  
Sbjct:   388 FAILNSCSLWFLCGFYCKDLLLCLLMLTSF-FFILEFLCVCLFFIFFTVIYNYFLLFFLC 446

Query:   600 FSFKNFII 623
             F FK F +
Sbjct:   447 FVFKCFCL 454

 Score = 51 (18.0 bits), Expect = 8.4, Sum P(2) = 1.0
 Identities = 17/50 (34%), Positives = 27/50 (54%), Frame = +2

Query:   287 FCHYHLDNIY--CLYLSYYMFHH*FYEYHQELMGVYIQYIFIM--IHSPFFIQF 436
             FC   LD +Y  CL+  Y+MF+         ++GV+I + F +  +   FF  F
Sbjct:   327 FCCLSLD-LYVGCLFFCYHMFYKATLFI---VLGVWIHFFFGLQDVRCYFFTYF 376


>gi|501027 (U01849) ORF2 [Trypanosoma brucei]
           Length = 141

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 8.8, P = 1.0
 Identities = 29/99 (29%), Positives = 43/99 (43%), Frame = +3

Query:   288 FVIIILIIYIVCTYHIICFIINFMNIIKS*W--GCIFNIFSL*SIVHSSFNLFNICSLWF 461
             F  + + +  +C   ++CF + F  +I   W   CI   F    I+   F  F +C L+ 
Sbjct:    29 FCCLFVWVCFICFVIVVCFFLLFWVVIFY-WCFDCIVYFFCDVIILFIFFFYFVLCFLYC 87

Query:   462 NFSHISLCLSIHL*NRFSWFIIGSLCDCLAKLLKVVFLVLF 584
              F  + L           +F+I  LC C   L  VVFL LF
Sbjct:    88 CFYLVCLVFFCIFCCVLCYFLIYFLC-CF--LFWVVFLFLF 125


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=5.99
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.360   0.163   0.607
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.373   0.173   0.659
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.365   0.170   0.609
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.359   0.161   0.556
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.401   0.190   0.777
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.373   0.174   0.639
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      217       217      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   +2      0      218       218      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   +1      0      218       218      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   -1      0      218       218      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   -2      0      218       218      10. 63 3  12 22    0.10 35
                                                  32    0.12 38
   -3      0      217       217      10. 63 3  12 22    0.10 35
                                                  32    0.12 38


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  23
  No. of states in DFA:  593 (58 KB)
  Total size of DFA:  242 KB (256 KB)
  Time to generate neighborhood:  0.02u 0.02s 0.04t  Elapsed: 00:00:00
  No. of processors used:  6
  Search cpu time:  144.92u 0.46s 145.38t  Elapsed: 00:00:38
  Total cpu time:  145.00u 0.49s 145.49t  Elapsed: 00:00:38
  Start:  Fri Feb  6 20:47:27 1998   End:  Fri Feb  6 20:48:05 1998

Date: 16:32:28 on Sun 17 Dec 117.