blastx_gbnr_files/CPlasFal_172_blastx.Z


BLASTX 2.0a10MP-WashU [15-May-1997] [Build 16:56:44 May 19 1997]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CPlasFal_172
        (791 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  ../_tempdbs/nrdb
           267,798 sequences; 79,948,537 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|858754            (L10740) aspartic proteinase [Pla... -3  1056  4.0e-106  1
A sp|P46925|PLM2_PLAFA PLASMEPSIN 2 PRECURSOR (ASPARTIC ... -3  1045  5.9e-105  1
A sp|P39898|PLM1_PLAFA PLASMEPSIN 1 PRECURSOR (ASPARTIC ... -3   581  8.7e-56   1
A pdb|1SME|A           Plasmodium falciparum >pdb|1SME|B... -3   406  3.0e-37   1
A gnl|PID|e280545      (Y09123) aspartic proteinase [Cen... -3   177  1.0e-10   1
A pdb|1LYA|A           Homo sapiens >pdb|1LYA|C Homo sap... -3   157  1.1e-10   1
A gi|1858020           (U90321) cathepsin D [Oncorhynchu... -3   173  2.0e-10   1
A sp|Q01294|CARP_NEUCR VACUOLAR PROTEASE A PRECURSOR >gi... -3   171  3.7e-10   1
A gi|510880            (X80067) putative aspartic protea... -3   165  3.8e-10   1
A pir||S49349          cyprosin - cardoon >gi|556819 (X8... -3   171  6.3e-10   1
A sp|P52115|RENI_SHEEP RENIN PRECURSOR, RENAL (ANGIOTENS... -3   169  6.7e-10   1
A gi|944988            (Z50755) R12H7.2 [Caenorhabditis ... -3   168  1.1e-09   1
A gi|1354272           (U51036) aspartic proteinase [Ara... -3   168  1.4e-09   1
A sp|P42211|ASPR_ORYSA ASPARTIC PROTEINASE PRECURSOR >pi... -3   168  1.4e-09   1
A sp|Q05744|CATD_CHICK CATHEPSIN D PRECURSOR >pir||I5118... -3   166  1.6e-09   1
A pir||JC5077          aspartic proteinase (EC 3.4.23.-)... -3   165  2.7e-09   1
A gi|1326165           (U55032) aspartic protease [Brass... -3   165  3.5e-09   1
A sp|Q42456|APR1_ORYSA ASPARTIC PROTEINASE ORYZASIN 1 PR... -3   163  6.2e-09   1
A gi|2351395           (U67173) proteinase A [Pichia ang... -3   161  7.2e-09   1
A gi|2160151           (AC000375) Strong similarity to B... -3   161  7.9e-09   1
A sp|P18242|CATD_MOUSE CATHEPSIN D PRECURSOR >pir||KHMSD... -3   160  9.5e-09   1
A pdb|1RNE|            Renin (Activated, Glycosylated, I... -3   157  1.4e-08   1
A bbs|130434           cathepsin D {EC 3.4.23.5} [cattle... -3   157  1.5e-08   1
A gi|337347            (M26901) renin [Homo sapiens]        -3   157  2.1e-08   1
A gi|162845            (M19699) aspartyl protease NM1 [B... -3   137  2.3e-08   1
A gi|2510              (X13669) pre-aspartyl proteinase ... -3   156  2.4e-08   1
A pir||S03433          candidapepsin (EC 3.4.23.24) prec... -3   156  2.4e-08   1
A gi|206611            (M37278) renin [Rattus norvegicus]   -3   155  2.7e-08   1
A sp|P24268|CATD_RAT   CATHEPSIN D PRECURSOR >pir||KHRTD... -3   156  2.8e-08   1
A gi|1420936           (U61396) Vigna unguiculata aspart... -3   157  3.3e-08   1
A pir||KHPGD           cathepsin D (EC 3.4.23.5) - pig      -3   154  3.4e-08   1
A sp|P00795|CATD_PIG   CATHEPSIN D                          -3   154  3.4e-08   1
A gi|206609            (J02941) preprorenin (EC 3.4.99.1... -3   155  3.6e-08   1
A gi|57046             (X07033) renin (AA 1-702) [Rattus... -3   155  3.6e-08   1
A sp|P08424|RENI_RAT   RENIN PRECURSOR, RENAL (ANGIOTENS... -3   155  3.6e-08   1
A sp|P40782|CYP1_CYNCA CYPROSIN PRECURSOR >prf||2124255A... -3   156  3.8e-08   1
A gi|509163            (X69193) cyprosin [Cynara cardunc... -3   156  3.8e-08   1
A sp|Q28057|PAG2_BOVIN PREGNANCY-ASSOCIATED GLYCOPROTEIN... -3   154  4.2e-08   1
A pdb|1HRN|A           Homo sapiens >pdb|1HRN|B Homo sap... -3   153  4.2e-08   1
A sp|P16476|PEPE_CHICK EMBRYONIC PEPSINOGEN PRECURSOR >p... -3   154  4.3e-08   1
A prf||1403354A        pepsinogen [Gallus gallus]           -3   154  4.3e-08   1
A sp|P00792|PEPA_BOVIN PEPSINOGEN A >pir||PEBO pepsin A ... -3   134  4.9e-08   1
A sp|P00793|PEPA_CHICK PEPSINOGEN A >pir||PECH pepsin A ... -3   153  5.2e-08   1
A gi|1778026           (U60995) aspartic proteinase [Sch... -3   154  5.4e-08   1
A sp|P25796|CATE_CAVPO CATHEPSIN E PRECURSOR >pir||A4335... -3   153  5.9e-08   1
A gi|2102722           (U90750) aspartic protease precur... -3   153  7.1e-08   1
A gi|2347147           (L41346) aspartic proteinase prec... -3   153  7.2e-08   1
A sp|P10977|CARV_CANAL VACUOLAR ASPARTIC PROTEASE PRECUR... -3   152  8.9e-08   1
A gi|951449            (L46681) aspartic protease precur... -3   153  9.7e-08   1
A gi|871442            (X00810) renin [Mus musculus]        -3   151  1.0e-07   1
A sp|P06281|RENI_MOUSE RENIN PRECURSOR, RENAL (ANGIOTENS... -3   151  1.1e-07   1
A sp|P16228|CATE_RAT   CATHEPSIN E PRECURSOR >pir||S6646... -3   150  1.2e-07   1
A pir||I46617          pregnancy-associated glycoprotein... -3   149  1.8e-07   1
A gi|200688            (M32352) renin (Ren-1-d) [Mus mus... -3   149  1.9e-07   1
A sp|Q29079|PAG2_PIG   PREGNANCY-ASSOCIATED GLYCOPROTEIN... -3   149  2.1e-07   1
A sp|P42210|ASPR_HORVU ASPARTIC PROTEINASE PRECURSOR >pi... -3   150  2.2e-07   1
A sp|Q03168|ASPP_AEDAE LYSOSOMAL ASPARTIC PROTEASE PRECU... -3   148  2.3e-07   1
A pir||S03266          aspartic proteinase (EC 3.4.23.-)... -3   128  2.3e-07   1
A pir||S66465          cathepsin E (EC 3.4.23.34) precur... -3   148  2.4e-07   1
A sp|P00796|RENS_MOUSE RENIN PRECURSOR, SUBMANDIBULAR GL... -3   148  2.5e-07   1
A prf||0807285A        renin precursor [Mus musculus]       -3   148  2.5e-07   1
A prf||1301217A        proteinase A,Asp [Saccharomyces c... -3   146  2.8e-07   1
A pdb|1JXR|A           Structure Of Yeast Proteinase A C... -3   146  2.8e-07   1
A prf||2124395A        Asp protease [Schistosoma japonicum] -3   147  2.9e-07   1
A sp|P70269|CATE_MOUSE CATHEPSIN E PRECURSOR >gnl|PID|e2... -3   147  3.2e-07   1
A gnl|PID|e312266      (Y10928) cathepsin E [Mus musculus]  -3   147  3.2e-07   1
A pdb|1SMR|A           Mus musculus                         -3   145  3.8e-07   1
A prf||1004236A        renin [Mus musculus]                 -3   145  3.8e-07   1
A sp|P07267|CARP_YEAST SACCHAROPEPSIN PRECURSOR (ASPARTA... -3   146  4.4e-07   1
A gi|53952             (V00845) renin [Mus musculus] >gi... -3   145  5.6e-07   1
A gi|1938411           (U97000) similar to eukaryotic as... -3   144  7.1e-07   1
A gi|1938413           (U97000) similar to eukaryotic as... -3   143  9.1e-07   1
A pir||S35971          aspartic proteinase - Eimeria ace... -3   144  9.7e-07   1
A bbs|174324           pepsinogen A [turtles, Peptide, 3... -3   142  1.0e-06   1
A gnl|PID|d1019747     (D88899) kidney-derived aspartic ... -3   143  1.1e-06   1
A sp|P27822|PEP3_RABIT PEPSINOGEN III PRECURSOR (PEPSINO... -3   142  1.2e-06   1
A sp|P11489|PEPA_MACMU PEPSINOGEN A PRECURSOR >pir||PEMQ... -3   142  1.2e-06   1
A sp|P03954|PEP1_MACFU PEPSINOGEN A-1 PRECURSOR (PEPSINO... -3   142  1.2e-06   1
A pir||JC4870          pepsinogen precursor - soft-shell... -3   140  1.5e-06   1
A sp|P43159|CATE_RABIT CATHEPSIN E PRECURSOR >pir||S3686... -3   140  2.1e-06   1
A pir||S47096          cynarase - cardoon                   -3   138  4.1e-06   1
A gi|1938408           (U97000) similar to eukaryotic as... -3   137  4.7e-06   1
A sp|P03955|PEPC_MACFU PROGASTRICSIN PRECURSOR (PEPSINOG... -3   136  5.6e-06   1
A sp|P28712|PEP1_RABIT PEPSINOGEN II-1 PRECURSOR (PEPSIN... -3   136  5.9e-06   1
A sp|P27678|PEP4_MACFU PEPSINOGEN A-4 PRECURSOR (PEPSINO... -3   136  5.9e-06   1
A gi|162856            (M14077) chymosin [Bos taurus]       -3   135  7.6e-06   1
A pdb|1PSN|            Pepsin 3a (E.C.3.4.23.1) >pdb|1PS... -3   133  9.2e-06   1
A prf||2124254A        pepsin:ISOTYPE=3a [Homo sapiens] ... -3   133  9.2e-06   1
A prf||2124254C        pepsin:ISOTYPE=3c [Homo sapiens]     -3   133  9.2e-06   1
A gnl|PID|d1020384     (AB002695) aspartic endopeptidase... -3   136  9.6e-06   1
A pir||I47176          preprochymosin - pig (fragment) >... -3   134  9.8e-06   1
A sp|P27677|PEP2_MACFU PEPSINOGEN A-2 OR A-3 PRECURSOR (... -3   134  1.0e-05   1
A pdb|1HTR|B           Homo sapiens                         -3   132  1.2e-05   1
A gi|387014            (M18667) pepsinogen [Homo sapiens]   -3   133  1.3e-05   1
A sp|P28713|PEP4_RABIT PEPSINOGEN II-4 PRECURSOR (PEPSIN... -3   133  1.3e-05   1
A sp|P20142|PEPC_HUMAN PROGASTRICSIN PRECURSOR (PEPSINOG... -3   133  1.3e-05   1
A sp|P00790|PEPA_HUMAN PEPSINOGEN A PRECURSOR >pir||PEHU... -3   133  1.3e-05   1
A gi|499671            (L33856) rhizopuspepsin I [Rhizop... -3   132  1.3e-05   1
A sp|P04073|PEPC_RAT   PROGASTRICSIN PRECURSOR (PEPSINOG... -3   133  1.3e-05   1
A gi|915540            (U30251) pregnancy-specific antig... -3   133  1.4e-05   1
A sp|P27821|PEP2_RABIT PEPSINOGEN II-2/3 PRECURSOR (PEPS... -3   132  1.7e-05   1
A pir||C38302          pepsin (EC 3.4.23.-) II-2/3 precu... -3   132  1.7e-05   1
A gi|387013            (M26032) pepsinogen A [Homo sapiens] -3   132  1.7e-05   1
A pir||A30142          pepsin A (EC 3.4.23.1) 5 precurso... -3   132  1.7e-05   1
A pir||B30142          pepsin A (EC 3.4.23.1) 4 precurso... -3   132  1.7e-05   1
A gi|1507727           (U34889) aspartic protease [Caeno... -3   132  1.7e-05   1
A pir||B43356          gastricsin (EC 3.4.23.3) precurso... -3   132  1.8e-05   1
A bbs|146598           aspartic hemoglobinase II, ASP HG... -3   111  1.9e-05   1
A gi|169742            (M63451) rhizopuspepsinogen [Rhiz... -3   131  2.3e-05   1
A gi|169740            (J02651) rhizopuspepsin precursor... -3   130  2.4e-05   1
A sp|P06026|CARP_RHICH RHIZOPUSPEPSIN PRECURSOR >gi|4996... -3   130  3.0e-05   1
A pir||A26681          rhizopuspepsin (EC 3.4.23.21) II ... -3   130  3.0e-05   1
A gi|162858            (J00002) preprochymosin a [Bos ta... -3   129  3.7e-05   1
A gi|162860            (J00003) preprochymosin b [Bos ta... -3   129  3.7e-05   1
A sp|P00794|CHYM_BOVIN PROCHYMOSIN A AND B PRECURSORS (P... -3   129  3.7e-05   1
A pir||CMBO            chymosin (EC 3.4.23.4) precursor ... -3   129  3.7e-05   1
A pir||A34657          cathepsin E (EC 3.4.23.34) - rat ... -3   108  4.0e-05   1
A gnl|PID|e274112      (Y08567) aspartic protease [Pagot... -3   129  4.2e-05   1
A pir||A39314          gastricsin (EC 3.4.23.3) precurso... -3   128  4.9e-05   1
A gi|164604            (J04601) pepsinogen A precursor [... -3   128  4.9e-05   1
A sp|P00791|PEPA_PIG   PEPSINOGEN A PRECURSOR >pir||PEPG... -3   128  5.0e-05   1
A sp|P10602|CAR1_RHINI RHIZOPUSPEPSIN 1 PRECURSOR (ASPAR... -3   128  5.0e-05   1
A pdb|2PSG|            Pepsinogen >pdb|3PSG|  Pepsinogen    -3   127  6.0e-05   1
A prf||0803215A        rennin,pro [Bos taurus]              -3   127  6.1e-05   1
A pdb|1PSA|A           Sus scrofa >pdb|1PSA|B Sus scrofa    -3   125  7.9e-05   1
A pdb|3PEP|            Pepsin (E.C.3.4.23.1) >pdb|4PEP| ... -3   125  7.9e-05   1
A pdb|5PEP|            Pepsin (E.C.3.4.23.1)                -3   125  7.9e-05   1
A pdb|1CMS|            Chymosin B (Formerly Known As Ren... -3   124  0.00010   1
A pdb|3CMS|            Chymosin B (Formerly Known As Ren... -3   124  0.00010   1
A pdb|2APR|            Acid Proteinase (Rhizopuspepsin) ... -3   123  0.00014   1
A pir||A41415          rhizopuspepsin (EC 3.4.23.21) I -... -3   123  0.00014   1
A sp|P18276|CHYM_SHEEP PROCHYMOSIN PRECURSOR, B-FORM (PR... -3   124  0.00014   1
A sp|Q29078|PAG1_PIG   PREGNANCY-ASSOCIATED GLYCOPROTEIN... -3   123  0.00019   1
A prf||1402278B        rhizopuspepsin II [Rhizopus chine... -3   121  0.00023   1
A sp|Q28389|PAG_HORSE  PREGNANCY-ASSOCIATED GLYCOPROTEIN... -3   122  0.00024   1
A bbs|174327           pepsinogen 2 [tuna, Peptide, 360 aa] -3   121  0.00028   1
A pir||A61388          renin (EC 3.4.23.15) - rabbit (fr... -3   118  0.00037   1
A gnl|PID|e4885        (X01696) renin part 3 (263 is 1st... -3    99  0.00040   1
A sp|Q29432|PAG1_BOVIN PREGNANCY-ASSOCIATED GLYCOPROTEIN... -3   120  0.00040   1
A gi|2055443           (U94794) pregnancy-associated gly... -3   118  0.00056   1
A gi|2055445           (U94795) pregnancy-associated gly... -3   118  0.00058   1
A gi|402686            (L06153) pregnancy-specific glyco... -3   118  0.00068   1
A gi|2055433           (U94789) pregnancy-associated gly... -3   117  0.00089   1
A sp|P43232|CAR5_RHINI RHIZOPUSPEPSIN 5 PRECURSOR (ASPAR... -3   117  0.00093   1
A sp|Q03700|CAR4_RHINI RHIZOPUSPEPSIN 4 PRECURSOR (ASPAR... -3   116  0.0012    1
A gi|2055437           (U94791) pregnancy-associated gly... -3   115  0.0015    1
A sp|Q03699|CAR3_RHINI RHIZOPUSPEPSIN 3 PRECURSOR (ASPAR... -3   114  0.0020    1
A gi|1465799           (U64851) coded for by C. elegans ... -3   113  0.0026    1
A sp|P27823|PEPF_RABIT PEPSINOGEN F PRECURSOR >gi|165602... -3   112  0.0034    1
A pir||A38302          pepsin (EC 3.4.23.-) F precursor ... -3   112  0.0034    1
A sp|P43231|CAR2_RHINI RHIZOPUSPEPSIN 2 PRECURSOR (ASPAR... -3   112  0.0035    1
A pir||JH0240          aspartic proteinase (EC 3.4.23.-)... -3   105  0.0038    1
A gi|1118134           (U41746) coded for by C. elegans ... -3   109  0.0042    2
A gi|2055435           (U94790) pregnancy-associated gly... -3   111  0.0043    1
A gi|2055439           (U94792) pregnancy-associated gly... -3   107  0.012     1
A gnl|PID|e250444      (Z75527) C15C8.3 [Caenorhabditis ... -3   106  0.019     1
A gnl|PID|e308073      (Y11825) extracellular aspartic p... -3   105  0.021     1
A pdb|1MPP|            Pepsin (Renin) (E.C.3.4.23.23) >p... -3   102  0.040     1
A bbs|119595           rennin [Mucor pusillus, Peptide, ... -3   102  0.052     1
A pir||A25767          mucorpepsin (EC 3.4.23.23) - Rhiz... -3   102  0.052     1
A sp|P09177|CARP_RHIPU MUCOROPEPSIN PRECURSOR (MUCOR REN... -3   102  0.052     1
A sp|Q28755|PAG1_SHEEP PREGNANCY-ASSOCIATED GLYCOPROTEIN... -3    99  0.094     1
A pir||A41545          pregnancy-specific antigen precur... -3    99  0.094     1
A gi|466338            (L12449) secreted aspartyl protei... -3    99  0.097     1
A gi|466340            (L12450) secreted aspartyl protei... -3    99  0.097     1
A gi|466344            (L12452) secreted aspartyl protei... -3    99  0.097     1
A sp|P28872|CAR1_CANAL CANDIDAPEPSIN 1 PRECURSOR (ASPART... -3    99  0.097     1
A pdb|2ASI|            Aspartic Proteinase Hydrolase, As... -3    97  0.14      1
A pdb|2RMP|A           Rhizomucor miehei                    -3    97  0.14      1
A pdb|1ZAP|            Secreted Aspartic Protease From C... -3    96  0.16      1
A bbs|176780           SAP2=major secreted aspartic prot... -3    96  0.16      1
A pdb|1EAG|A           Secreted Aspartic Proteinase (Sap... -3    96  0.16      1
A sp|Q12303|YL12_YEAST PUTATIVE ASPARTYL PROTEASE YLR121... -3    98  0.18      1
A gi|578113            (X62289) aspartic proteinase [Can... -3    96  0.20      1
A prf||2005365A        Asp protease [Candida albicans]      -3    96  0.20      1
A sp|P28871|CAR2_CANAL CANDIDAPEPSIN 2 PRECURSOR (ASPART... -3    96  0.20      1
A prf||2124256A        Asp protease:ISOTYPE=prepro=1-56 ... -3    96  0.20      1
A pir||PN0134          pepsin (EC 3.4.23.-) 2 - horse (f... -3    73  0.25      1
A gi|1515341           (U39852) coded for by C. elegans ... -3    95  0.27      1
A sp|P43092|CAR3_CANAL CANDIDAPEPSIN 3 PRECURSOR (ASPART... -3    93  0.39      1
A gi|578121            (X56867) microbial aspartic prote... -3    92  0.47      1
A gi|899394            (Z50046) unknown [Saccharomyces c... -3    87  0.48      1
A gi|2055441           (U94793) pregnancy-associated gly... -3    91  0.54      1
A sp|P43093|CAR4_CANAL CANDIDAPEPSIN 4 PRECURSOR (ASPART... -3    90  0.69      1
A pir||PN0137          pepsin (EC 3.4.23.-) 5 - horse (f... -3    67  0.73      1
A sp|P43095|CAR6_CANAL CANDIDAPEPSIN 6 PRECURSOR (ASPART... -3    89  0.78      1
A sp|Q57745|Y297_METJA HYPOTHETICAL PROTEIN MJ0297 >pir|... -3    64  0.85      2
A gnl|PID|e243970      (Z72490) parasite pepsinogen [Hae... -3    88  0.87      1
A gi|1513232           (U66366) ORFveg109 [Dictyostelium... -3    83  0.95      1
A gi|35952             (X00063) renin (aa 105 to 401); p... -3    84  0.97      1
A sp|P53379|MKC7_YEAST ASPARTIC PROTEINASE MKC7 PRECURSO... -3    87  0.98      1
A pir||S57971          MKC7 protein - yeast (Saccharomyc... -3    87  0.98      1
A sp|P43054|YGYB_MYCHO HYPOTHETICAL 25.5 KD PROTEIN IN G... -3    81  0.98      1
A gnl|PID|e288229      (Z82092) ZK384.b [Caenorhabditis ... -3    81  0.99      1
A pir||PT0434          aspartic hemoglobinase - Plasmodi... -3    62  0.990     1
A gi|600040            (X02156) URF 1 [Saccharomyces cer... +3    60  0.9995    1
A gi|2315320           (AF016435) Similar to aspartyl pr... -3    82  0.9997    1



>gi|858754 (L10740) aspartic proteinase [Plasmodium falciparum]
           Length = 455

  Minus Strand HSPs:

 Score = 1056 (371.7 bits), Expect = 4.0e-106, P = 4.0e-106
 Identities = 199/202 (98%), Positives = 200/202 (99%), Frame = -3

Query:   606 NQMDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQEGFQILYVLLFCSVMCGLFYYV 427
             NQMDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQ+GFQILYVLLFCSVMCGLFYYV
Sbjct:     1 NQMDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYV 60

Query:   426 YENVWLQRDNEMNEILKNSEHLTIGFKVGNAHGRILKTIKTHKLKNYIKESVNFLNSGLT 247
             YENVWLQRDNEMNEILKNSEHLTIGFKV NAH RILKTIKTHKLKNYIKESVNFLNSGLT
Sbjct:    61 YENVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLT 120

Query:   246 KTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLT 67
             KTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLT
Sbjct:   121 KTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLT 180

Query:    66 KHLYDSSKSRTYEKDGTKVEMN 1
             KHLYDSSKSRTYEKDGTKVEMN
Sbjct:   181 KHLYDSSKSRTYEKDGTKVEMN 202


>sp|P46925|PLM2_PLAFA PLASMEPSIN 2 PRECURSOR (ASPARTIC HEMOGLOBINASE II)
            (PFAPD)
            Length = 453

  Minus Strand HSPs:

 Score = 1045 (367.9 bits), Expect = 5.9e-105, P = 5.9e-105
 Identities = 197/200 (98%), Positives = 198/200 (99%), Frame = -3

Query:   600 MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQEGFQILYVLLFCSVMCGLFYYVYE 421
             MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQ+GFQILYVLLFCSVMCGLFYYVYE
Sbjct:     1 MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE 60

Query:   420 NVWLQRDNEMNEILKNSEHLTIGFKVGNAHGRILKTIKTHKLKNYIKESVNFLNSGLTKT 241
             NVWLQRDNEMNEILKNSEHLTIGFKV NAH RILKTIKTHKLKNYIKESVNFLNSGLTKT
Sbjct:    61 NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT 120

Query:   240 NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH 61
             NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH
Sbjct:   121 NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH 180

Query:    60 LYDSSKSRTYEKDGTKVEMN 1
             LYDSSKSRTYEKDGTKVEMN
Sbjct:   181 LYDSSKSRTYEKDGTKVEMN 200


>sp|P39898|PLM1_PLAFA PLASMEPSIN 1 PRECURSOR (ASPARTIC HEMOGLOBINASE I) (PFAPG)
            >pir||S41717 aspartic hemoglobinase - Plasmodium falciparum
            >gi|482941 (X75787) aspartic hemoglobinase [Plasmodium falciparum]
            Length = 452

  Minus Strand HSPs:

 Score = 581 (204.5 bits), Expect = 8.7e-56, P = 8.7e-56
 Identities = 104/200 (52%), Positives = 146/200 (73%), Frame = -3

Query:   600 MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQEGFQILYVLLFCSVMCGLFYYVYE 421
             M ++++E DF   F K+ S  +    +N+    KIQ+ FQILYV  F  +   LFYY+ +
Sbjct:     1 MALSIKE-DFSSAFAKNESAVNSSTFNNNMKTWKIQKRFQILYVFFFLLITGALFYYLID 59

Query:   420 NVWLQRDNEMNEILKNSEHLTIGFKVGNAHGRILKTIKTHKLKNYIKESVNFLNSGLTKT 241
             NV   ++ ++NEI+  S+H+ IGF + N+H RI+KT+K H+LKNYIKES+ F  +GLT+ 
Sbjct:    60 NVLFPKNKKINEIMNTSKHVIIGFSIENSHDRIMKTVKQHRLKNYIKESLKFFKTGLTQK 119

Query:   240 NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH 61
              +LG++ D++ L D  N+M+YG+A++GDN+Q F FI DTGSANLWVPS +C T GC TK+
Sbjct:   120 PHLGNAGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKN 179

Query:    60 LYDSSKSRTYEKDGTKVEMN 1
             LYDS+KS+TYEKDGTKVEMN
Sbjct:   180 LYDSNKSKTYEKDGTKVEMN 199


>pdb|1SME|A Plasmodium falciparum >pdb|1SME|B Plasmodium falciparum
            Length = 329

  Minus Strand HSPs:

 Score = 406 (142.9 bits), Expect = 3.0e-37, P = 3.0e-37
 Identities = 76/76 (100%), Positives = 76/76 (100%), Frame = -3

Query:   228 SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDS 49
             SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDS
Sbjct:     1 SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDS 60

Query:    48 SKSRTYEKDGTKVEMN 1
             SKSRTYEKDGTKVEMN
Sbjct:    61 SKSRTYEKDGTKVEMN 76


>gnl|PID|e280545 (Y09123) aspartic proteinase [Centaurea calcitrapa]
            Length = 509

  Minus Strand HSPs:

 Score = 177 (62.3 bits), Expect = 1.0e-10, P = 1.0e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Frame = -3

Query:   228 SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTKHLYD 52
             S +D IEL ++ +  +YG+  +G   Q FT I DTGS+NLWVPS KC  +  CL    Y 
Sbjct:    70 SDSDIIELKNYMDAQYYGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYK 129

Query:    51 SSKSRTYEKDGT 16
             SS S TY+K+GT
Sbjct:   130 SSHSSTYKKNGT 141


>pdb|1LYA|A Homo sapiens >pdb|1LYA|C Homo sapiens >pdb|1LYB|A Homo sapiens
            >pdb|1LYB|C Homo sapiens
            Length = 97

  Minus Strand HSPs:

 Score = 157 (55.3 bits), Expect = 1.1e-10, P = 1.1e-10
 Identities = 29/71 (40%), Positives = 43/71 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKSRT 34
             L ++ +  +YG+  +G   Q FT + DTGS+NLWVPS+ C      C   H Y+S KS T
Sbjct:     7 LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSST 66

Query:    33 YEKDGTKVEMN 1
             Y K+GT  +++
Sbjct:    67 YVKNGTSFDIH 77


>gi|1858020 (U90321) cathepsin D [Oncorhynchus mykiss]
            Length = 398

  Minus Strand HSPs:

 Score = 173 (60.9 bits), Expect = 2.0e-10, P = 2.0e-10
 Identities = 40/85 (47%), Positives = 50/85 (58%), Frame = -3

Query:   249 TKTNYLG---SSNDNIE--LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKC- 88
             TK N LG   SSN      L +F +  +YG+  +G   Q FT + DTGS+NLWVPSV C 
Sbjct:    51 TKYNNLGFPSSSNGPTPETLKNFMDAQYYGEIGLGTPVQTFTVVFDTGSSNLWVPSVHCS 110

Query:    87 -TTAGCLTKHLYDSSKSRTYEKDGT 16
              T   CL  H Y+ +KS TY K+GT
Sbjct:   111 FTDIACLLHHKYNGAKSSTYVKNGT 135


>sp|Q01294|CARP_NEUCR VACUOLAR PROTEASE A PRECURSOR >gi|1039445 (U36471)
            vacuolar protease A [Neurospora crassa]
            Length = 396

  Minus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 3.7e-10, P = 3.7e-10
 Identities = 31/76 (40%), Positives = 48/76 (63%), Frame = -3

Query:   228 SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDS 49
             S N  + + +F N  ++ +  +G   Q F  +LDTGS+NLWVPS +C +  C   + Y+S
Sbjct:    70 SGNHPVPITNFMNAQYFSEITIGTPPQTFKVVLDTGSSNLWVPSSQCGSIACYLHNKYES 129

Query:    48 SKSRTYEKDGT--KVE 7
             S+S TY+K+GT  K+E
Sbjct:   130 SESSTYKKNGTSFKIE 145


>gi|510880 (X80067) putative aspartic protease [Brassica oleracea]
           Length = 255

  Minus Strand HSPs:

 Score = 165 (58.1 bits), Expect = 3.8e-10, P = 3.8e-10
 Identities = 34/75 (45%), Positives = 46/75 (61%), Frame = -3

Query:   234 LGSSNDN--IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTK 64
             LG S D   + L ++ +  +YG+  +G   Q FT + DTGS+NLWVPS KC  +  CL  
Sbjct:    63 LGDSGDADIVTLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFH 122

Query:    63 HLYDSSKSRTYEKDG 19
               Y SS+S TYEK+G
Sbjct:   123 SKYKSSRSSTYEKNG 137


>pir||S49349 cyprosin - cardoon >gi|556819 (X81984) cyprosin [Cynara
            cardunculus]
            Length = 509

  Minus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 6.3e-10, P = 6.3e-10
 Identities = 34/72 (47%), Positives = 45/72 (62%), Frame = -3

Query:   228 SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTKHLYD 52
             S +D I L ++ +  +YG+  +G   Q FT I DTGS+NLWVPS KC  +  CL    Y 
Sbjct:    70 SGSDIIALKNYMDAQYYGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYK 129

Query:    51 SSKSRTYEKDGT 16
             SS S TY+K+GT
Sbjct:   130 SSHSSTYKKNGT 141


>sp|P52115|RENI_SHEEP RENIN PRECURSOR, RENAL (ANGIOTENSINOGENASE) >pir||I47099
            renin (EC 3.4.23.15) - sheep >gi|896318 (L43524) renin [Ovis aries]
            Length = 400

  Minus Strand HSPs:

 Score = 169 (59.5 bits), Expect = 6.7e-10, P = 6.7e-10
 Identities = 35/84 (41%), Positives = 49/84 (58%), Frame = -3

Query:   258 SGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT- 82
             S LTKT   G+    + L ++ +  +YG+  +G   Q F  I DTGSANLWVPS KC+  
Sbjct:    55 SQLTKTLSFGNRTSPVVLTNYLDTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSPL 114

Query:    81 -AGCLTKHLYDSSKSRTYEKDGTK 13
                C    LYDS +S +Y ++GT+
Sbjct:   115 YTACEIHSLYDSLESSSYVENGTE 138


>gi|944988 (Z50755) R12H7.2 [Caenorhabditis elegans]
           Length = 444

  Minus Strand HSPs:

 Score = 168 (59.1 bits), Expect = 1.1e-09, P = 1.1e-09
 Identities = 35/98 (35%), Positives = 52/98 (53%), Frame = -3

Query:   303 HKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDT 124
             H  K Y+K + N         N  G  ++ +   ++ +  ++G   +G   Q FT I DT
Sbjct:    56 HGYKKYLKTNGNHHFDKYQALNVEGEIDELLR--NYMDAQYFGTISIGTPAQNFTVIFDT 113

Query:   123 GSANLWVPSVKCT--TAGCLTKHLYDSSKSRTYEKDGTKV 10
             GS+NLW+PS KC      C+  H YDS  S TY++DG K+
Sbjct:   114 GSSNLWIPSKKCPFYDIACMLHHRYDSKSSSTYKEDGRKM 153


>gi|1354272 (U51036) aspartic proteinase [Arabidopsis thaliana]
            Length = 486

  Minus Strand HSPs:

 Score = 168 (59.1 bits), Expect = 1.4e-09, P = 1.4e-09
 Identities = 40/103 (38%), Positives = 55/103 (53%), Frame = -3

Query:   321 LKTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDN--IELVDFQNIMFYGDAEVGDNQQ 148
             LK +K    KN +   V        +   LG S D   + L ++ +  +YG+  +G   Q
Sbjct:    15 LKKLKLDS-KNRLAARVESKQEKPLRAYRLGDSGDADVVVLKNYLDAQYYGEIAIGTPPQ 73

Query:   147 PFTFILDTGSANLWVPSVKCT-TAGCLTKHLYDSSKSRTYEKDG 19
              FT + DTGS+NLWVPS KC  +  CL    Y SS+S TYEK+G
Sbjct:    74 KFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSSTYEKNG 117


>sp|P42211|ASPR_ORYSA ASPARTIC PROTEINASE PRECURSOR >pir||JS0732 aspartic
            proteinase (EC 3.4.23.-) - rice >gnl|PID|d1002737 (D12777) aspartic
            proteinase [Oryza sativa]
            Length = 496

  Minus Strand HSPs:

 Score = 168 (59.1 bits), Expect = 1.4e-09, P = 1.4e-09
 Identities = 36/78 (46%), Positives = 46/78 (58%), Frame = -3

Query:   252 LTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAG 76
             L KT    S +D + LVD+ N  +YG   +G   Q FT I DTGS+NLWVPS KC  +  
Sbjct:    56 LLKTG--SSDSDPVPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKCYFSIA 113

Query:    75 CLTKHLYDSSKSRTYEKDG 19
             C     Y+S KS +Y+ DG
Sbjct:   114 CYLHSRYNSKKSSSYKADG 132


>sp|Q05744|CATD_CHICK CATHEPSIN D PRECURSOR >pir||I51185 prepro-cathepsin D -
            chicken >bbs|118574 (S49650) prepro-cathepsin D, prepro-CD
            [chickens, follicles, Peptide, 398 aa] [Gallus gallus]
            Length = 398

  Minus Strand HSPs:

 Score = 166 (58.4 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 31/67 (46%), Positives = 43/67 (64%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKC--TTAGCLTKHLYDSSKSRT 34
             L ++ +  +YG+  +G   Q FT + DTGS+NLWVPSV C      CL  H YD+SKS T
Sbjct:    70 LKNYMDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVPSVHCHLLDIACLLHHKYDASKSST 129

Query:    33 YEKDGTK 13
             Y ++GT+
Sbjct:   130 YVENGTE 136


>pir||JC5077 aspartic proteinase (EC 3.4.23.-) - dog hookworm (Ancylostoma
            caninum) (fragment) >gi|1507725 (U34888) aspartic protease
            [Ancylostoma caninum]
            Length = 442

  Minus Strand HSPs:

 Score = 165 (58.1 bits), Expect = 2.7e-09, P = 2.7e-09
 Identities = 34/82 (41%), Positives = 50/82 (60%), Frame = -3

Query:   246 KTNYLGSSNDNIELV-DFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT--TAG 76
             K   L S+N+  EL+ ++ +  ++G  ++G   Q FT I DTGS+NLWVPS K       
Sbjct:    66 KATKLQSTNEIDELLRNYMDAQYFGTIQIGTPAQNFTVIFDTGSSNLWVPSEKMPFHDIA 125

Query:    75 CLTKHLYDSSKSRTYEKDGTKV 10
             C+ +H YDS  S TY++DG K+
Sbjct:   126 CMLRHRYDSGASSTYKEDGRKM 147


>gi|1326165 (U55032) aspartic protease [Brassica napus]
            Length = 506

  Minus Strand HSPs:

 Score = 165 (58.1 bits), Expect = 3.5e-09, P = 3.5e-09
 Identities = 34/75 (45%), Positives = 46/75 (61%), Frame = -3

Query:   234 LGSSNDN--IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTK 64
             LG S D   + L ++ +  +YG+  +G   Q FT + DTGS+NLWVPS KC  +  CL  
Sbjct:    63 LGDSGDADIVTLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFH 122

Query:    63 HLYDSSKSRTYEKDG 19
               Y SS+S TYEK+G
Sbjct:   123 SKYKSSRSSTYEKNG 137


>sp|Q42456|APR1_ORYSA ASPARTIC PROTEINASE ORYZASIN 1 PRECURSOR >pir||S66516
            aspartic proteinase 1 precursor - rice >gnl|PID|d1007451 (D32165)
            aspartic protease [Oryza sativa] >gnl|PID|d1007450 (D32144)
            aspartic protease [Oryza sativa]
            Length = 509

  Minus Strand HSPs:

 Score = 163 (57.4 bits), Expect = 6.2e-09, P = 6.2e-09
 Identities = 35/83 (42%), Positives = 46/83 (55%), Frame = -3

Query:   255 GLTKTNYLGSSN---DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT 85
             GL   N LG      D + L ++ N  ++G+  VG   Q FT I DTGS+NLWVPS KC 
Sbjct:    58 GLRGANSLGGGGGEGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCY 117

Query:    84 -TAGCLTKHLYDSSKSRTYEKDG 19
              +  C     Y S +S TY+K+G
Sbjct:   118 FSIACFFHSRYKSGQSSTYQKNG 140


>gi|2351395 (U67173) proteinase A [Pichia angusta]
            Length = 413

  Minus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 7.2e-09, P = 7.2e-09
 Identities = 30/71 (42%), Positives = 43/71 (60%), Frame = -3

Query:   228 SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDS 49
             SS  N  L ++ N  ++ + ++G   Q F  ILDTGS+NLWVPS  CT+  C     YD 
Sbjct:    84 SSGHNTPLTNYLNAQYFTEIQLGTPGQSFKVILDTGSSNLWVPSSDCTSLACYLHTKYDH 143

Query:    48 SKSRTYEKDGT 16
              +S TY+K+G+
Sbjct:   144 DESSTYQKNGS 154


>gi|2160151 (AC000375) Strong similarity to Brassica aspartic protease
            (gb|X77260). [Arabidopsis thaliana]
            Length = 433

  Minus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 7.9e-09, P = 7.9e-09
 Identities = 36/93 (38%), Positives = 52/93 (55%), Frame = -3

Query:   264 LNSGLTK-TNYLGSSNDNIELVDFQNIM---FYGDAEVGDNQQPFTFILDTGSANLWVPS 97
             L S L    N LG  + + ++V  +N +   +YG+  +G   Q FT I DTGS+NLWVPS
Sbjct:    58 LRSSLRSYNNNLGGDSGDADIVPLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPS 117

Query:    96 VKCT-TAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
              KC  +  C     Y SS+S TY+K G +  ++
Sbjct:   118 GKCFFSLSCYFHAKYKSSRSSTYKKSGKRAAIH 150


>sp|P18242|CATD_MOUSE CATHEPSIN D PRECURSOR >pir||KHMSD cathepsin D (EC
            3.4.23.5) precursor - mouse >gi|50299 (X52886) cathepsin D [Mus
            musculus] >gi|50301 (X53337) cathepsin D (AA 1-410) [Mus musculus]
            >gi|817945 (X68378) cathepsin d [Mus musculus]
            Length = 410

  Minus Strand HSPs:

 Score = 160 (56.3 bits), Expect = 9.5e-09, P = 9.5e-09
 Identities = 30/71 (42%), Positives = 43/71 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKSRT 34
             L ++ +  +YGD  +G   Q FT + DTGS+NLWVPS+ C      C   H Y+S KS T
Sbjct:    71 LKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSST 130

Query:    33 YEKDGTKVEMN 1
             Y K+GT  +++
Sbjct:   131 YVKNGTSFDIH 141


>pdb|1RNE|  Renin (Activated, Glycosylated, Inhibited) (E.C.3.4.23.15) Complex
            With Cgp 38'560 >pdb|2REN|  Renin (E.C.3.4.23.15) >pdb|1BBS|  Renin
            (E.C.3.4.23.15)
            Length = 340

  Minus Strand HSPs:

 Score = 157 (55.3 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 27/79 (34%), Positives = 50/79 (63%), Frame = -3

Query:   234 LGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT--AGCLTKH 61
             LG++  ++ L ++ +  +YG+  +G   Q F  + DTGS+N+WVPS KC+     C+   
Sbjct:     3 LGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHK 62

Query:    60 LYDSSKSRTYEKDGTKVEM 4
             L+D+S S +Y+ +GT++ +
Sbjct:    63 LFDASDSSSYKHNGTELTL 81


>bbs|130434 cathepsin D {EC 3.4.23.5} [cattle, Peptide Partial, 346 aa]
            Length = 346

  Minus Strand HSPs:

 Score = 157 (55.3 bits), Expect = 1.5e-08, P = 1.5e-08
 Identities = 30/71 (42%), Positives = 43/71 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKSRT 34
             L ++ +  +YG+  +G   Q FT + DTGSANLWVPS+ C      C T   Y+S KS T
Sbjct:     7 LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSST 66

Query:    33 YEKDGTKVEMN 1
             Y K+GT  +++
Sbjct:    67 YVKNGTTFDIH 77


>gi|337347 (M26901) renin [Homo sapiens]
           Length = 403

  Minus Strand HSPs:

 Score = 157 (55.3 bits), Expect = 2.1e-08, P = 2.1e-08
 Identities = 27/79 (34%), Positives = 50/79 (63%), Frame = -3

Query:   234 LGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT--AGCLTKH 61
             LG++  ++ L ++ +  +YG+  +G   Q F  + DTGS+N+WVPS KC+     C+   
Sbjct:    69 LGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHK 128

Query:    60 LYDSSKSRTYEKDGTKVEM 4
             L+D+S S +Y+ +GT++ +
Sbjct:   129 LFDASDSSSYKHNGTELTL 147


>gi|162845 (M19699) aspartyl protease NM1 [Bos taurus]
           Length = 131

  Minus Strand HSPs:

 Score = 137 (48.2 bits), Expect = 2.3e-08, P = 2.3e-08
 Identities = 22/63 (34%), Positives = 38/63 (60%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             N  L ++ ++ ++G  ++G   Q FT + DTGS++LWVPS+ C    C     +D +KS 
Sbjct:    42 NEALTNYLDVQYFGKIQIGTPPQEFTVVFDTGSSDLWVPSIYCKNKACKIHRRFDPTKSS 101

Query:    36 TYE 28
             T++
Sbjct:   102 TFQ 104


>gi|2510 (X13669) pre-aspartyl proteinase [Candida albicans]
         Length = 380

  Minus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 2.4e-08, P = 2.4e-08
 Identities = 28/65 (43%), Positives = 40/65 (61%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ N  ++ + E+G   QPF  ILDTGS+NLWVPS  CT+  C     YD   S TY+
Sbjct:    58 LTNYLNAQYFTEIEIGTPGQPFKVILDTGSSNLWVPSQDCTSLACFLHAKYDHDASSTYK 117

Query:    27 KDGTK 13
              +G++
Sbjct:   118 ANGSE 122


>pir||S03433 candidapepsin (EC 3.4.23.24) precursor - yeast (Candida albicans)
            Length = 380

  Minus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 2.4e-08, P = 2.4e-08
 Identities = 28/65 (43%), Positives = 40/65 (61%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ N  ++ + E+G   QPF  ILDTGS+NLWVPS  CT+  C     YD   S TY+
Sbjct:    58 LTNYLNAQYFTEIEIGTPGQPFKVILDTGSSNLWVPSQDCTSLACFLHAKYDHDASSTYK 117

Query:    27 KDGTK 13
              +G++
Sbjct:   118 ANGSE 122


>gi|206611 (M37278) renin [Rattus norvegicus]
           Length = 352

  Minus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 2.7e-08, P = 2.7e-08
 Identities = 30/69 (43%), Positives = 43/69 (62%), Frame = -3

Query:   213 IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT--AGCLTKHLYDSSKS 40
             + L ++ +  +YG+  +G   Q F  I DTGSANLWVPS KC      C   +LYDSS+S
Sbjct:    74 VVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYTACEIHNLYDSSES 133

Query:    39 RTYEKDGTK 13
              +Y ++GT+
Sbjct:   134 SSYMENGTE 142


>sp|P24268|CATD_RAT CATHEPSIN D PRECURSOR >pir||KHRTD cathepsin D (EC 3.4.23.5)
            precursor - rat >gi|55882 (X54467) preprocathepsin D [Rattus
            norvegicus]
            Length = 407

  Minus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 2.8e-08, P = 2.8e-08
 Identities = 29/71 (40%), Positives = 43/71 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKSRT 34
             L ++ +  +YG+  +G   Q FT + DTGS+NLWVPS+ C      C   H Y+S KS T
Sbjct:    71 LKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVHHKYNSDKSST 130

Query:    33 YEKDGTKVEMN 1
             Y K+GT  +++
Sbjct:   131 YVKNGTSFDIH 141


>gi|1420936 (U61396) Vigna unguiculata aspartic proteinase mRNA, complete cds.
            [Vigna unguiculata]
            Length = 513

  Minus Strand HSPs:

 Score = 157 (55.3 bits), Expect = 3.3e-08, P = 3.3e-08
 Identities = 30/79 (37%), Positives = 47/79 (59%), Frame = -3

Query:   246 KTNYLGSSN-DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGC 73
             + N+ G+   D + L ++ +  +YG+  +G + Q FT I DT S+NLWVPS +CT +  C
Sbjct:    67 QNNFAGTGETDIVALKNYLDAQYYGEISIGTSPQKFTVIFDTASSNLWVPSSRCTFSLAC 126

Query:    72 LTKHLYDSSKSRTYEKDGT 16
                  Y S +S TY ++GT
Sbjct:   127 YFHAKYRSGRSSTYRRNGT 145


>pir||KHPGD cathepsin D (EC 3.4.23.5) - pig
            Length = 344

  Minus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 3.4e-08, P = 3.4e-08
 Identities = 29/66 (43%), Positives = 40/66 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKSRT 34
             L ++ +  +YG+  +G   Q FT + DTGS+NLWVPS+ C      C   H Y+S KS T
Sbjct:     7 LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSST 66

Query:    33 YEKDGT 16
             Y K+GT
Sbjct:    67 YVKNGT 72


>sp|P00795|CATD_PIG CATHEPSIN D
            Length = 345

  Minus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 3.4e-08, P = 3.4e-08
 Identities = 29/66 (43%), Positives = 40/66 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKSRT 34
             L ++ +  +YG+  +G   Q FT + DTGS+NLWVPS+ C      C   H Y+S KS T
Sbjct:     7 LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSST 66

Query:    33 YEKDGT 16
             Y K+GT
Sbjct:    67 YVKNGT 72


>gi|206609 (J02941) preprorenin (EC 3.4.99.19) [Rattus norvegicus]
           Length = 402

  Minus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 3.6e-08, P = 3.6e-08
 Identities = 30/69 (43%), Positives = 43/69 (62%), Frame = -3

Query:   213 IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT--AGCLTKHLYDSSKS 40
             + L ++ +  +YG+  +G   Q F  I DTGSANLWVPS KC      C   +LYDSS+S
Sbjct:    74 VVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYTACEIHNLYDSSES 133

Query:    39 RTYEKDGTK 13
              +Y ++GT+
Sbjct:   134 SSYMENGTE 142


>gi|57046 (X07033) renin (AA 1-702) [Rattus norvegicus]
          Length = 402

  Minus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 3.6e-08, P = 3.6e-08
 Identities = 30/69 (43%), Positives = 43/69 (62%), Frame = -3

Query:   213 IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT--AGCLTKHLYDSSKS 40
             + L ++ +  +YG+  +G   Q F  I DTGSANLWVPS KC      C   +LYDSS+S
Sbjct:    74 VVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYTACEIHNLYDSSES 133

Query:    39 RTYEKDGTK 13
              +Y ++GT+
Sbjct:   134 SSYMENGTE 142


>sp|P08424|RENI_RAT RENIN PRECURSOR, RENAL (ANGIOTENSINOGENASE) >pir||RERTK
            renin (EC 3.4.23.15) precursor - rat
            Length = 402

  Minus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 3.6e-08, P = 3.6e-08
 Identities = 30/69 (43%), Positives = 43/69 (62%), Frame = -3

Query:   213 IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT--AGCLTKHLYDSSKS 40
             + L ++ +  +YG+  +G   Q F  I DTGSANLWVPS KC      C   +LYDSS+S
Sbjct:    74 VVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYTACEIHNLYDSSES 133

Query:    39 RTYEKDGTK 13
              +Y ++GT+
Sbjct:   134 SSYMENGTE 142


>sp|P40782|CYP1_CYNCA CYPROSIN PRECURSOR >prf||2124255A cyprosin [Cynara
            cardunculus flavescens]
            Length = 473

  Minus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 31/75 (41%), Positives = 45/75 (60%), Frame = -3

Query:   240 NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTK 64
             N+  S  + I L ++ +  ++G+  +G   Q FT I DTGS+NLWVPS KC  +  CL  
Sbjct:    32 NFRDSDGELIALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFH 91

Query:    63 HLYDSSKSRTYEKDG 19
               Y S+ S TY+K+G
Sbjct:    92 SKYRSTDSTTYKKNG 106


>gi|509163 (X69193) cyprosin [Cynara cardunculus]
           Length = 474

  Minus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 3.8e-08, P = 3.8e-08
 Identities = 31/75 (41%), Positives = 45/75 (60%), Frame = -3

Query:   240 NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTK 64
             N+  S  + I L ++ +  ++G+  +G   Q FT I DTGS+NLWVPS KC  +  CL  
Sbjct:    32 NFRDSDGELIALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFH 91

Query:    63 HLYDSSKSRTYEKDG 19
               Y S+ S TY+K+G
Sbjct:    92 SKYRSTDSTTYKKNG 106


>sp|Q28057|PAG2_BOVIN PREGNANCY-ASSOCIATED GLYCOPROTEIN 2 PRECURSOR (PAG 2)
            >pir||I45856 aspartic proteinase - bovine >gi|797279 (L06151)
            aspartic proteinase [Bos taurus]
            Length = 376

  Minus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 4.2e-08, P = 4.2e-08
 Identities = 36/105 (34%), Positives = 59/105 (56%), Frame = -3

Query:   321 LKTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDN-IELVDFQNIM---FYGDAEVGDN 154
             LK +KT  L+  ++E  N LN+ L +  Y  S ND+ I +   +N +   + G+  +G  
Sbjct:    21 LKKMKT--LRETLREK-NLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTP 77

Query:   153 QQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKV 10
              Q F  + DTGSANLWVP + CT+  C T   ++   S ++ + G+ +
Sbjct:    78 PQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPI 125


>pdb|1HRN|A Homo sapiens >pdb|1HRN|B Homo sapiens >pdb|1BIM|A Homo sapiens
            >pdb|1BIM|B Homo sapiens >pdb|1BIL|A Homo sapiens >pdb|1BIL|B Homo
            sapiens
            Length = 337

  Minus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 4.2e-08, P = 4.2e-08
 Identities = 26/78 (33%), Positives = 49/78 (62%), Frame = -3

Query:   231 GSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT--AGCLTKHL 58
             G++  ++ L ++ +  +YG+  +G   Q F  + DTGS+N+WVPS KC+     C+   L
Sbjct:     1 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKL 60

Query:    57 YDSSKSRTYEKDGTKVEM 4
             +D+S S +Y+ +GT++ +
Sbjct:    61 FDASDSSSYKHNGTELTL 78


>sp|P16476|PEPE_CHICK EMBRYONIC PEPSINOGEN PRECURSOR >pir||A41443 pepsin (EC
            3.4.23.-) precursor, embryonic - chicken >gnl|PID|d1000599 (D00215)
            pepsinogen [Gallus gallus]
            Length = 383

  Minus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 4.3e-08, P = 4.3e-08
 Identities = 26/69 (37%), Positives = 44/69 (63%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L++  ++ +YG   +G   Q FT + DTGS+NLWVPSV CT+  C +  +++ S+S TY+
Sbjct:    68 LLNTLDMEYYGTISIGTPPQDFTVVFDTGSSNLWVPSVSCTSPACQSHQMFNPSQSSTYK 127

Query:    27 KDGTKVEMN 1
               G  + ++
Sbjct:   128 STGQNLSIH 136


>prf||1403354A pepsinogen [Gallus gallus]
            Length = 383

  Minus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 4.3e-08, P = 4.3e-08
 Identities = 26/69 (37%), Positives = 44/69 (63%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L++  ++ +YG   +G   Q FT + DTGS+NLWVPSV CT+  C +  +++ S+S TY+
Sbjct:    68 LLNTLDMEYYGTISIGTPPQDFTVVFDTGSSNLWVPSVSCTSPACQSHQMFNPSQSSTYK 127

Query:    27 KDGTKVEMN 1
               G  + ++
Sbjct:   128 STGQNLSIH 136


>sp|P00792|PEPA_BOVIN PEPSINOGEN A >pir||PEBO pepsin A (EC 3.4.23.1) precursor
            - bovine (fragment)
            Length = 110

  Minus Strand HSPs:

 Score = 134 (47.2 bits), Expect = 4.9e-08, P = 4.9e-08
 Identities = 32/102 (31%), Positives = 54/102 (52%), Frame = -3

Query:   333 HGRILKTIKTHKLK---NYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEV 163
             +G++ + ++THK      YI+E+   ++    + NYL +              ++G   +
Sbjct:    20 NGKLKEFMRTHKYNLGSKYIREAATLVSEQPLQ-NYLDTE-------------YFGTIGI 65

Query:   162 GDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             G   Q FT I DTGS+NLWVPS+ C++  C   + ++   S TYE
Sbjct:    66 GTPAQDFTVIFDTGSSNLWVPSIYCSSEACTNHNRFNPQDSSTYE 110


>sp|P00793|PEPA_CHICK PEPSINOGEN A >pir||PECH pepsin A (EC 3.4.23.1) precursor
            - chicken
            Length = 367

  Minus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 5.2e-08, P = 5.2e-08
 Identities = 35/100 (35%), Positives = 61/100 (61%), Frame = -3

Query:   330 GRIL-KTIKTHKL-KNYIKESVNFLNSGLTKTNYLGSSNDNIE-LVDFQNIMFYGDAEVG 160
             G+ L K +K H L ++++K+     N   +K + + ++ ++ E + ++ +  +YG   +G
Sbjct:    10 GKSLRKQLKDHGLLEDFLKKHP--YNPA-SKYHPVLTATESYEPMTNYMDASYYGTISIG 66

Query:   159 DNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
               QQ F+ I DTGS+NLWVPS+ C ++ C     +D SKS TY
Sbjct:    67 TPQQDFSVIFDTGSSNLWVPSIYCKSSACSNHKRFDPSKSSTY 109


>gi|1778026 (U60995) aspartic proteinase [Schistosoma mansoni]
            Length = 427

  Minus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 5.4e-08, P = 5.4e-08
 Identities = 41/111 (36%), Positives = 59/111 (53%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNS-GLTKTNYLG--SSND-NIE-LVDFQNIMFYGDAEVGDNQQ 148
             I  H LK+  +  + F  S  + K  +L   S  D   E L ++ +  +YGD  +G   Q
Sbjct:    17 IPLHPLKSAQRTLIEFETSLEIVKKVWLSRVSGVDPQPEYLKNYLDAQYYGDITIGTPPQ 76

Query:   147 PFTFILDTGSANLWVPSVKCT--TAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
              F+ + DTGS+NLWVPS  C+     CL    YDSSKS TY  +GT+  ++
Sbjct:    77 TFSVVFDTGSSNLWVPSKYCSYFDIACLLHRKYDSSKSSTYIPNGTEFSVH 127


>sp|P25796|CATE_CAVPO CATHEPSIN E PRECURSOR >pir||A43356 cathepsin E (EC
            3.4.23.34) precursor - guinea pig >gi|191295 (M88653) procathepsin
            E [Cavia porcellus] >bbs|174345 (S80547) procathepsin E [guinea
            pigs, gastric mucosa, Peptide, 391 aa] [Cavia]
            Length = 391

  Minus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 5.9e-08, P = 5.9e-08
 Identities = 30/81 (37%), Positives = 49/81 (60%), Frame = -3

Query:   261 NSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT 82
             N  + + + + S+N+   L+++ ++ ++G   +G   Q FT I DTGS+NLWVPSV CT+
Sbjct:    50 NLNMDQCSTIQSANE--PLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTS 107

Query:    81 AGCLTKHLYDSSKSRTYEKDG 19
               C T  ++  S S TY + G
Sbjct:   108 PACQTHPVFHPSLSSTYREVG 128


>gi|2102722 (U90750) aspartic protease precursor [Schistosoma japonicum]
            Length = 428

  Minus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 7.1e-08, P = 7.1e-08
 Identities = 30/66 (45%), Positives = 40/66 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT--TAGCLTKHLYDSSKSRT 34
             L ++ +  +YGD  +G   Q F+ + DTGS+NLWVPS  C+     CL    YDSSKS T
Sbjct:    57 LKNYLDAQYYGDITIGTPPQTFSVVFDTGSSNLWVPSKHCSYFDIACLLHRKYDSSKSTT 116

Query:    33 YEKDGT 16
             Y  +GT
Sbjct:   117 YVPNGT 122


>gi|2347147 (L41346) aspartic proteinase precursor [Schistosoma japonicum]
            Length = 429

  Minus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 7.2e-08, P = 7.2e-08
 Identities = 30/66 (45%), Positives = 40/66 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT--TAGCLTKHLYDSSKSRT 34
             L ++ +  +YGD  +G   Q F+ + DTGS+NLWVPS  C+     CL    YDSSKS T
Sbjct:    58 LKNYLDAQYYGDITIGTPPQTFSVVFDTGSSNLWVPSKHCSYFDIACLLHRKYDSSKSTT 117

Query:    33 YEKDGT 16
             Y  +GT
Sbjct:   118 YVPNGT 123


>sp|P10977|CARV_CANAL VACUOLAR ASPARTIC PROTEASE PRECURSOR (ASPARTATE PROTEASE)
            (ACP) >gi|1039462 (U36754) vacuolar aspartic proteinase precursor
            [Candida albicans]
            Length = 419

  Minus Strand HSPs:

 Score = 152 (53.5 bits), Expect = 8.9e-08, P = 8.9e-08
 Identities = 27/65 (41%), Positives = 40/65 (61%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ N  ++ + ++G   QPF  ILDTGS+NLWVPS  CT+  C     YD   S TY+
Sbjct:    96 LTNYLNAQYFTEIQIGTPGQPFKVILDTGSSNLWVPSQDCTSLACFLHAKYDHDASSTYK 155

Query:    27 KDGTK 13
              +G++
Sbjct:   156 VNGSE 160


>gi|951449 (L46681) aspartic protease precursor [Lycopersicon esculentum]
           Length = 506

  Minus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 9.7e-08, P = 9.7e-08
 Identities = 40/111 (36%), Positives = 62/111 (55%), Frame = -3

Query:   351 FKVGNAHGRI----LKTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSND--NIELVDFQN 190
             F++G    R+    +K  +  KL++   + VN    G+ K +   S +D   + L ++ +
Sbjct:    28 FRIGLKKHRLDVDSIKAARVAKLQDRYGKHVN----GIEKKS---SDSDIYKVPLKNYLD 80

Query:   189 IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTKHLYDSSKSRTYEKDG 19
               +YG+  +G   Q F  I DTGS+NLWVPS KC  +  C     Y +SKS TY +DG
Sbjct:    81 AQYYGEIGIGSPPQKFKVIFDTGSSNLWVPSSKCYFSIACWIHSKYQASKSSTYTRDG 138


>gi|871442 (X00810) renin [Mus musculus]
           Length = 387

  Minus Strand HSPs:

 Score = 151 (53.2 bits), Expect = 1.0e-07, P = 1.0e-07
 Identities = 32/80 (40%), Positives = 45/80 (56%), Frame = -3

Query:   249 TKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--G 76
             TK   L +    + L ++ N  +YG+  +G   Q F  I DTGSANLWVPS KC+     
Sbjct:    44 TKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLA 103

Query:    75 CLTKHLYDSSKSRTYEKDGT 16
             C    LY+SS S +Y ++G+
Sbjct:   104 CGIHSLYESSDSSSYMENGS 123


>sp|P06281|RENI_MOUSE RENIN PRECURSOR, RENAL (ANGIOTENSINOGENASE) >pir||REMSK
            renin (EC 3.4.23.15) precursor, renal - mouse >gi|53931 (X16642)
            preprorenin (AA -21 to 402) [Mus musculus]
            Length = 402

  Minus Strand HSPs:

 Score = 151 (53.2 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 32/80 (40%), Positives = 45/80 (56%), Frame = -3

Query:   249 TKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--G 76
             TK   L +    + L ++ N  +YG+  +G   Q F  I DTGSANLWVPS KC+     
Sbjct:    62 TKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLA 121

Query:    75 CLTKHLYDSSKSRTYEKDGT 16
             C    LY+SS S +Y ++G+
Sbjct:   122 CGIHSLYESSDSSSYMENGS 141


>sp|P16228|CATE_RAT CATHEPSIN E PRECURSOR >pir||S66466 cathepsin E (EC
            3.4.23.34) precusor (clone pTN1) - rat >gnl|PID|d1007863 (D38104)
            cathepsin E precursor [Rattus norvegicus]
            Length = 365

  Minus Strand HSPs:

 Score = 150 (52.8 bits), Expect = 1.2e-07, P = 1.2e-07
 Identities = 27/66 (40%), Positives = 42/66 (63%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             N  L+++ ++ ++G   +G   Q FT I DTGS+NLWVPSV CT++ C    ++  S+S 
Sbjct:    69 NEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSSACKAHPVFHPSQSS 128

Query:    36 TYEKDG 19
             TY + G
Sbjct:   129 TYMEVG 134


>pir||I46617 pregnancy-associated glycoprotein - pig >gi|1066345 (L34361)
            pregnancy-associated glycoprotein [Sus scrofa]
            Length = 387

  Minus Strand HSPs:

 Score = 149 (52.5 bits), Expect = 1.8e-07, P = 1.8e-07
 Identities = 29/99 (29%), Positives = 56/99 (56%), Frame = -3

Query:   297 LKNYIKES-VNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             LKN++KE   N + + L+K +          L ++ ++++ G+  +G   Q F+ + DTG
Sbjct:    37 LKNFLKEHPYNMIQNLLSKNSSHVQKFSYQPLRNYLDMVYVGNISIGTPPQQFSVVFDTG 96

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEM 4
             S++LWVPS+ C +  C+T   ++ S S T+   G  +++
Sbjct:    97 SSDLWVPSIYCKSKACVTHRSFNPSHSSTFHDRGKSIKL 135


>gi|200688 (M32352) renin (Ren-1-d) [Mus musculus]
           Length = 402

  Minus Strand HSPs:

 Score = 149 (52.5 bits), Expect = 1.9e-07, P = 1.9e-07
 Identities = 32/80 (40%), Positives = 45/80 (56%), Frame = -3

Query:   249 TKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--G 76
             TK   L +    + L ++ N  +YG+  +G   Q F  I DTGSANLWVPS KC+     
Sbjct:    62 TKRPSLINLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLA 121

Query:    75 CLTKHLYDSSKSRTYEKDGT 16
             C    LY+SS S +Y ++G+
Sbjct:   122 CGIHSLYESSDSSSYMENGS 141


>sp|Q29079|PAG2_PIG PREGNANCY-ASSOCIATED GLYCOPROTEIN 2 PRECURSOR (PAG 2)
            >gi|1223879 (U39763) pregnancy-associated glycoprotein [Sus scrofa]
            Length = 420

  Minus Strand HSPs:

 Score = 149 (52.5 bits), Expect = 2.1e-07, P = 2.1e-07
 Identities = 29/99 (29%), Positives = 56/99 (56%), Frame = -3

Query:   297 LKNYIKES-VNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             LKN++KE   N + + L+K +          L ++ ++++ G+  +G   Q F+ + DTG
Sbjct:    37 LKNFLKEHPYNMIQNLLSKNSSHVQKFSYQPLRNYLDMVYVGNISIGTPPQQFSVVFDTG 96

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEM 4
             S++LWVPS+ C +  C+T   ++ S S T+   G  +++
Sbjct:    97 SSDLWVPSIYCKSKACVTHRSFNPSHSSTFHDRGKSIKL 135


>sp|P42210|ASPR_HORVU ASPARTIC PROTEINASE PRECURSOR >pir||S19697 aspartic
            proteinase (EC 3.4.23.-) precursor - barley >gi|18904 (X56136)
            aspartic proteinase [Hordeum vulgare]
            Length = 508

  Minus Strand HSPs:

 Score = 150 (52.8 bits), Expect = 2.2e-07, P = 2.2e-07
 Identities = 33/81 (40%), Positives = 45/81 (55%), Frame = -3

Query:   252 LTKTNYLGSSN--DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-T 82
             L+  N L S    D + L ++ N  ++G+  VG   Q FT I DTGS+NLWVPS KC  +
Sbjct:    59 LSGANPLRSEEEGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFS 118

Query:    81 AGCLTKHLYDSSKSRTYEKDG 19
               C     Y +  S TY+K+G
Sbjct:   119 IACYLHSRYKAGASSTYKKNG 139


>sp|Q03168|ASPP_AEDAE LYSOSOMAL ASPARTIC PROTEASE PRECURSOR >pir||A45117
            aspartic proteinase (EC 3.4.23.-), lysosomal - yellow fever
            mosquito >gi|293230 (M95187) aspartic protease [Aedes aegypti]
            Length = 387

  Minus Strand HSPs:

 Score = 148 (52.1 bits), Expect = 2.3e-07, P = 2.3e-07
 Identities = 28/66 (42%), Positives = 41/66 (62%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKC--TTAGCLTKHLYDSSKSRT 34
             L ++ +  +YG   +G   Q F  + DTGS+NLWVPS +C  T   CL  + Y++ KS T
Sbjct:    60 LSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSST 119

Query:    33 YEKDGT 16
             +EK+GT
Sbjct:   120 FEKNGT 125


>pir||S03266 aspartic proteinase (EC 3.4.23.-) (clone NM1) - bovine (fragment)
            >gnl|PID|e26383 (X12357) aspartyl protease NM1 [Bos taurus]
            Length = 79

  Minus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 2.3e-07, P = 2.3e-07
 Identities = 20/54 (37%), Positives = 33/54 (61%), Frame = -3

Query:   189 IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             + ++G  ++G   Q FT + DTGS++LWVPS+ C    C     +D +KS T++
Sbjct:     1 VQYFGKIQIGTPPQEFTVVFDTGSSDLWVPSIYCKNKACKIHRRFDPTKSSTFQ 54


>pir||S66465 cathepsin E (EC 3.4.23.34) precursor (clone pTN05) - rat
            >gnl|PID|d1008719 (D45187) cathepsin E precursor [Rattus rattus]
            Length = 398

  Minus Strand HSPs:

 Score = 148 (52.1 bits), Expect = 2.4e-07, P = 2.4e-07
 Identities = 27/66 (40%), Positives = 41/66 (62%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             N  L+++ ++ ++G   +G   Q FT I DTGS+NLWVPSV CT+  C    ++  S+S 
Sbjct:    69 NEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSS 128

Query:    36 TYEKDG 19
             TY + G
Sbjct:   129 TYMEVG 134


>sp|P00796|RENS_MOUSE RENIN PRECURSOR, SUBMANDIBULAR GLAND (ANGIOTENSINOGENASE)
            >pir||REMSS renin (EC 3.4.23.15) precursor, submandibular - mouse
            Length = 401

  Minus Strand HSPs:

 Score = 148 (52.1 bits), Expect = 2.5e-07, P = 2.5e-07
 Identities = 32/79 (40%), Positives = 44/79 (55%), Frame = -3

Query:   249 TKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--G 76
             TK + L      + L ++ N  +YG+  +G   Q F  I DTGSANLWVPS KC+     
Sbjct:    61 TKRSSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLA 120

Query:    75 CLTKHLYDSSKSRTYEKDG 19
             C    LY+SS S +Y ++G
Sbjct:   121 CGIHSLYESSDSSSYMENG 139


>prf||0807285A renin precursor [Mus musculus]
            Length = 401

  Minus Strand HSPs:

 Score = 148 (52.1 bits), Expect = 2.5e-07, P = 2.5e-07
 Identities = 32/79 (40%), Positives = 44/79 (55%), Frame = -3

Query:   249 TKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--G 76
             TK + L      + L ++ N  +YG+  +G   Q F  I DTGSANLWVPS KC+     
Sbjct:    61 TKRSSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLA 120

Query:    75 CLTKHLYDSSKSRTYEKDG 19
             C    LY+SS S +Y ++G
Sbjct:   121 CGIHSLYESSDSSSYMENG 139


>prf||1301217A proteinase A,Asp [Saccharomyces cerevisiae]
            Length = 329

  Minus Strand HSPs:

 Score = 146 (51.4 bits), Expect = 2.8e-07, P = 2.8e-07
 Identities = 27/68 (39%), Positives = 40/68 (58%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             ++ L ++ N  +Y D  +G   Q F  ILDTGS+NLWVPS +C +  C     YD   S 
Sbjct:     4 DVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASS 63

Query:    36 TYEKDGTK 13
             +Y+ +GT+
Sbjct:    64 SYKANGTE 71


>pdb|1JXR|A Structure Of Yeast Proteinase A Complex (HydrolaseINHIBITOR),
            HYDROLASE, ASPARTYL PROTEASE, Glycoprotein, Zymogen, Signal Mol_id:
            1; Molecule: Yeast Proteinase A; Chain: A; Synonym: Saccharopepsin,
            Yeast Endopeptidase A; Ec: 3.4.2...
            Length = 329

  Minus Strand HSPs:

 Score = 146 (51.4 bits), Expect = 2.8e-07, P = 2.8e-07
 Identities = 27/68 (39%), Positives = 40/68 (58%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             ++ L ++ N  +Y D  +G   Q F  ILDTGS+NLWVPS +C +  C     YD   S 
Sbjct:     4 DVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASS 63

Query:    36 TYEKDGTK 13
             +Y+ +GT+
Sbjct:    64 SYKANGTE 71


>prf||2124395A Asp protease [Schistosoma japonicum]
            Length = 380

  Minus Strand HSPs:

 Score = 147 (51.7 bits), Expect = 2.9e-07, P = 2.9e-07
 Identities = 29/66 (43%), Positives = 40/66 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT--TAGCLTKHLYDSSKSRT 34
             L ++ +  ++GD  +G   Q F+ + DTGS+NLWVPS  C+     CL    YDSSKS T
Sbjct:    58 LKNYLDAQYHGDITIGTPPQTFSAVFDTGSSNLWVPSKHCSYFDIACLLHRKYDSSKSTT 117

Query:    33 YEKDGT 16
             Y  +GT
Sbjct:   118 YVPNGT 123


>sp|P70269|CATE_MOUSE CATHEPSIN E PRECURSOR >gnl|PID|e242796 (X97399)
            procathepsin E [Mus musculus]
            Length = 397

  Minus Strand HSPs:

 Score = 147 (51.7 bits), Expect = 3.2e-07, P = 3.2e-07
 Identities = 28/69 (40%), Positives = 43/69 (62%), Frame = -3

Query:   225 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSS 46
             S+ N  L+++ ++ ++G   +G   Q FT I DTGS+NLWVPSV CT+  C    ++  S
Sbjct:    65 SSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPS 124

Query:    45 KSRTYEKDG 19
             +S TY + G
Sbjct:   125 QSDTYTEVG 133


>gnl|PID|e312266 (Y10928) cathepsin E [Mus musculus]
            Length = 397

  Minus Strand HSPs:

 Score = 147 (51.7 bits), Expect = 3.2e-07, P = 3.2e-07
 Identities = 28/69 (40%), Positives = 43/69 (62%), Frame = -3

Query:   225 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSS 46
             S+ N  L+++ ++ ++G   +G   Q FT I DTGS+NLWVPSV CT+  C    ++  S
Sbjct:    65 SSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPS 124

Query:    45 KSRTYEKDG 19
             +S TY + G
Sbjct:   125 QSDTYTEVG 133


>pdb|1SMR|A Mus musculus
            Length = 335

  Minus Strand HSPs:

 Score = 145 (51.0 bits), Expect = 3.8e-07, P = 3.8e-07
 Identities = 29/67 (43%), Positives = 40/67 (59%), Frame = -3

Query:   213 IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKS 40
             + L ++ N  +YG+  +G   Q F  I DTGSANLWVPS KC+     C    LY+SS S
Sbjct:     7 VVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDS 66

Query:    39 RTYEKDG 19
              +Y ++G
Sbjct:    67 SSYMENG 73


>prf||1004236A renin [Mus musculus]
            Length = 336

  Minus Strand HSPs:

 Score = 145 (51.0 bits), Expect = 3.8e-07, P = 3.8e-07
 Identities = 29/67 (43%), Positives = 40/67 (59%), Frame = -3

Query:   213 IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--GCLTKHLYDSSKS 40
             + L ++ N  +YG+  +G   Q F  I DTGSANLWVPS KC+     C    LY+SS S
Sbjct:    10 VVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDS 69

Query:    39 RTYEKDG 19
              +Y ++G
Sbjct:    70 SSYMENG 76


>sp|P07267|CARP_YEAST SACCHAROPEPSIN PRECURSOR (ASPARTATE PROTEASE) (PROTEINASE
            A) (PROTEINASE YSCA) >pir||A25379 saccharopepsin (EC 3.4.23.25) -
            yeast (Saccharomyces cerevisiae) >gi|172122 (M13358) vacuolar
            proteinase A precursor [Saccharomyces cerevisiae] >gnl|PID|e246893
            (Z73510) ORF YPL154c [Saccharomyces cerevisiae] >gnl|PID|e239130
            (X96770) P2585 protein [Saccharomyces cerevisiae]
            Length = 405

  Minus Strand HSPs:

 Score = 146 (51.4 bits), Expect = 4.4e-07, P = 4.4e-07
 Identities = 27/68 (39%), Positives = 40/68 (58%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             ++ L ++ N  +Y D  +G   Q F  ILDTGS+NLWVPS +C +  C     YD   S 
Sbjct:    80 DVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASS 139

Query:    36 TYEKDGTK 13
             +Y+ +GT+
Sbjct:   140 SYKANGTE 147


>gi|53952 (V00845) renin [Mus musculus] >gi|200702 (J00621) renin [Mus
          musculus]
          Length = 401

  Minus Strand HSPs:

 Score = 145 (51.0 bits), Expect = 5.6e-07, P = 5.6e-07
 Identities = 31/79 (39%), Positives = 44/79 (55%), Frame = -3

Query:   249 TKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA--G 76
             TK + L      + L ++ N  +YG+  +G   Q F  + DTGSANLWVPS KC+     
Sbjct:    61 TKRSSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVMFDTGSANLWVPSTKCSRLYLA 120

Query:    75 CLTKHLYDSSKSRTYEKDG 19
             C    LY+SS S +Y ++G
Sbjct:   121 CGIHSLYESSDSSSYMENG 139


>gi|1938411 (U97000) similar to eukaryotic aspartyl proteases [Caenorhabditis
            elegans]
            Length = 395

  Minus Strand HSPs:

 Score = 144 (50.7 bits), Expect = 7.1e-07, P = 7.1e-07
 Identities = 30/70 (42%), Positives = 42/70 (60%), Frame = -3

Query:   228 SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDS 49
             S+  N+   DF ++ + G+  +G   Q F  +LDTGSANLWVP   C    C  K  +DS
Sbjct:    60 SAPQNVN--DFGDVEYLGNITIGTPPQQFIVVLDTGSANLWVPGSNCDGT-CKGKSEFDS 116

Query:    48 SKSRTYEKDG 19
             SKS T++K+G
Sbjct:   117 SKSTTFKKNG 126


>gi|1938413 (U97000) similar to eukaryotic aspartyl proteases [Caenorhabditis
            elegans]
            Length = 389

  Minus Strand HSPs:

 Score = 143 (50.3 bits), Expect = 9.1e-07, P = 9.1e-07
 Identities = 34/98 (34%), Positives = 52/98 (53%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFI 133
             I+T +   Y++   N L +     N L +   N+   DF +  + G+  +G   Q F  +
Sbjct:    33 IRTGQYPAYLEYQRN-LRA--VSPNVLANLPQNVN--DFGDFEYLGNITIGTPDQGFIVV 87

Query:   132 LDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDG 19
             LDTGS+NLW+P   C T  C TK  +DS+ S T+ K+G
Sbjct:    88 LDTGSSNLWIPGPTCKT-NCKTKSKFDSTASSTFVKNG 124


>pir||S35971 aspartic proteinase - Eimeria acervulina >gi|396454 (Z24676)
            aspartyl protease [Eimeria acervulina]
            Length = 468

  Minus Strand HSPs:

 Score = 144 (50.7 bits), Expect = 9.7e-07, P = 9.7e-07
 Identities = 39/131 (29%), Positives = 65/131 (49%), Frame = -3

Query:   405 RDNEMNEILKNSEHLTIGFKVGNAHGRILKTIK-THKLKNYIK-----ESVNFLNSGLTK 244
             R   ++E L+  E + +  K  + H  +L+    T KL N  K     E V+ L    T 
Sbjct:    22 RHRFLSETLEEPEDVML--KTADLHTNLLREPPMTIKLDNRYKFTGLGELVSQLIDHHTT 79

Query:   243 TNYLGSSNDNI--ELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCL 70
                +GSS      +L+++ N  ++G+ ++G   + F  + DTGS+NLWVP+ +C   GC 
Sbjct:    80 MGSVGSSGTMARQKLLNYHNSQYFGEIKIGTPGRRFVVVFDTGSSNLWVPAAECEKGGCA 139

Query:    69 TKHLYDSSKSRTY 31
                 +D   S T+
Sbjct:   140 PHEKFDPKYSSTF 152


>bbs|174324 pepsinogen A [turtles, Peptide, 361 aa]
            Length = 361

  Minus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 1.0e-06, P = 1.0e-06
 Identities = 30/99 (30%), Positives = 52/99 (52%), Frame = -3

Query:   318 KTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIE---LVDFQNIMFYGDAEVGDNQQ 148
             K+++ +  ++ + E  N  +     + Y  S  D      L ++ +  ++G   +G   Q
Sbjct:    11 KSLRQNLKEHGLLEDFNKKHPYNPASRYFPSLGDEFATEPLTNYMDAEYFGTISIGTPAQ 70

Query:   147 PFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
              FT + DTGS+NLWVPSV C++A C   + ++ S S TY
Sbjct:    71 DFTVVFDTGSSNLWVPSVTCSSAACTQHNRFNPSDSSTY 109


>gnl|PID|d1019747 (D88899) kidney-derived aspartic protease-like protein [Mus
            musculus]
            Length = 419

  Minus Strand HSPs:

 Score = 143 (50.3 bits), Expect = 1.1e-06, P = 1.1e-06
 Identities = 28/82 (34%), Positives = 45/82 (54%), Frame = -3

Query:   252 LTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT--TA 79
             L++T+  G +   + L  F N  ++G   +G   Q FT + DTGS+NLWVPS +C   + 
Sbjct:    50 LSRTSTSGGNPSFVPLSKFMNTQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSL 109

Query:    78 GCLTKHLYDSSKSRTYEKDGTK 13
              C   H ++   S ++  +GTK
Sbjct:   110 ACWFHHRFNPKASSSFRPNGTK 131


>sp|P27822|PEP3_RABIT PEPSINOGEN III PRECURSOR (PEPSINOGEN A) >pir||E38302
            pepsin (EC 3.4.23.-) IIIs precursor - rabbit >gi|165598 (M59237)
            pepsinogen [Oryctolagus cuniculus]
            Length = 387

  Minus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 30/90 (33%), Positives = 50/90 (55%), Frame = -3

Query:   297 LKNYIK-ESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             LK+Y+K  + N     L K  +     + +E  ++ +  ++G   +G   Q FT I DTG
Sbjct:    38 LKDYLKTHTPNLATKYLPKAAFDSVPTETLE--NYLDTEYFGTIGIGTPAQDFTVIFDTG 95

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             S+NLWVPSV C++A C   + ++   S T++
Sbjct:    96 SSNLWVPSVYCSSAACSVHNQFNPEDSSTFQ 126


>sp|P11489|PEPA_MACMU PEPSINOGEN A PRECURSOR >pir||PEMQAR pepsin A (EC
            3.4.23.1) precursor - rhesus macaque >gi|342275 (M20788) pepsinogen
            A precursor (EC 3.4.23.1) [Macaca mulatta]
            Length = 388

  Minus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 27/69 (39%), Positives = 41/69 (59%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT I DTGS+NLWVPSV C++  C   +L++   S
Sbjct:    64 DEQPLENYLDVEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACTNHNLFNPQDS 123

Query:    39 RTYEK-DGT 16
              TY+   GT
Sbjct:   124 STYQSTSGT 132


>sp|P03954|PEP1_MACFU PEPSINOGEN A-1 PRECURSOR (PEPSINOGEN III-3) >pir||PEMQAJ
            pepsin A (EC 3.4.23.1) isozyme 1 precursor - Japanese macaque
            >gi|38075 (X59752) prepropepsinogen A1 [Macaca fuscata]
            Length = 388

  Minus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 27/69 (39%), Positives = 41/69 (59%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT I DTGS+NLWVPSV C++  C   +L++   S
Sbjct:    64 DEQPLENYLDVEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACTNHNLFNPQDS 123

Query:    39 RTYEK-DGT 16
              TY+   GT
Sbjct:   124 STYQSTSGT 132


>pir||JC4870 pepsinogen precursor - soft-shelled turtle (fragment)
            Length = 334

  Minus Strand HSPs:

 Score = 140 (49.3 bits), Expect = 1.5e-06, P = 1.5e-06
 Identities = 26/68 (38%), Positives = 39/68 (57%), Frame = -3

Query:   234 LGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLY 55
             LG       L ++ +  ++G   +G   Q FT + DTGS+NLWVPSV C++A C   + +
Sbjct:    15 LGDEFATEPLTNYMDAEYFGTISIGTPAQDFTVVFDTGSSNLWVPSVYCSSAACTQHNRF 74

Query:    54 DSSKSRTY 31
             + S S TY
Sbjct:    75 NPSDSSTY 82


>sp|P43159|CATE_RABIT CATHEPSIN E PRECURSOR >pir||S36865 cathepsin E (EC
            3.4.23.34) precursor - rabbit >gi|402729 (L08418) procathepsin E
            [Oryctolagus cuniculus]
            Length = 396

  Minus Strand HSPs:

 Score = 140 (49.3 bits), Expect = 2.1e-06, P = 2.1e-06
 Identities = 27/67 (40%), Positives = 40/67 (59%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             N  L+++ ++ ++G   +G   Q FT I DT S+NLWVPSV CT+  C     +  S+S 
Sbjct:    67 NEPLINYLDMEYFGTISIGSPPQNFTVIFDTVSSNLWVPSVYCTSPACQMHPQFRPSQSN 126

Query:    36 TYEKDGT 16
             TY + GT
Sbjct:   127 TYSEVGT 133


>pir||S47096 cynarase - cardoon
            Length = 428

  Minus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 4.1e-06, P = 4.1e-06
 Identities = 27/56 (48%), Positives = 36/56 (64%), Frame = -3

Query:   183 FYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT-TAGCLTKHLYDSSKSRTYEKDG 19
             ++G+  +G   Q FT I DTGS+NLWVPS KC  +  CL    Y S+ S TY+K+G
Sbjct:     5 YFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSKYRSTDSTTYKKNG 60


>gi|1938408 (U97000) similar to eukaryotic aspartyl proteases [Caenorhabditis
            elegans]
            Length = 393

  Minus Strand HSPs:

 Score = 137 (48.2 bits), Expect = 4.7e-06, P = 4.7e-06
 Identities = 26/61 (42%), Positives = 36/61 (59%), Frame = -3

Query:   201 DFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKD 22
             DF +  + G+  +G   QPF  +LDTGS+NLWVP   C    C  K  Y S+KS T++ +
Sbjct:    67 DFGDFEYLGNITIGTPPQPFLVVLDTGSSNLWVPGPSCD-GSCKGKREYQSTKSSTFKAN 125

Query:    21 G 19
             G
Sbjct:   126 G 126


>sp|P03955|PEPC_MACFU PROGASTRICSIN PRECURSOR (PEPSINOGEN C) >pir||PEMQCJ
            gastricsin (EC 3.4.23.3) precursor - Japanese macaque (fragment)
            >gi|38073 (X59754) pepsinogen C [Macaca fuscata]
            Length = 377

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 5.6e-06, P = 5.6e-06
 Identities = 24/73 (32%), Positives = 42/73 (57%), Frame = -3

Query:   237 YLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHL 58
             + G  + + E + + +  ++G+  +G   Q F  + DTGS+NLWVPSV C +  C +   
Sbjct:    44 HFGDLSVSYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSR 103

Query:    57 YDSSKSRTYEKDG 19
             ++ S+S TY  +G
Sbjct:   104 FNPSESSTYSTNG 116


>sp|P28712|PEP1_RABIT PEPSINOGEN II-1 PRECURSOR (PEPSINOGEN A) >pir||B38302
            pepsin (EC 3.4.23.-) II-1 precursor - rabbit
            Length = 387

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 5.9e-06, P = 5.9e-06
 Identities = 27/90 (30%), Positives = 48/90 (53%), Frame = -3

Query:   297 LKNYIK-ESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             L++Y+K  + N       K  +   S +++E  ++ +  ++G   +G   Q FT I DTG
Sbjct:    38 LQDYLKTHTPNLATKYFPKETFASVSTESLE--NYLDAEYFGTISIGTPPQEFTVIFDTG 95

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             S+NLWVPS  C++  C     ++   S T++
Sbjct:    96 SSNLWVPSTYCSSLACFLHKRFNPDDSSTFQ 126


>sp|P27678|PEP4_MACFU PEPSINOGEN A-4 PRECURSOR (PEPSINOGEN I OR II)
            >pir||S19682 pepsin A (EC 3.4.23.1) isozyme 4 precursor - Japanese
            macaque >gi|38071 (X59753) prepropepsinogen A-4 [Macaca fuscata]
            Length = 388

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 5.9e-06, P = 5.9e-06
 Identities = 25/72 (34%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C +  C+  +L++   S
Sbjct:    64 DEQPLENYLDVEYFGTIGIGTPAQNFTVVFDTGSSNLWVPSVYCYSLACMDHNLFNPQDS 123

Query:    39 RTYEKDGTKVEM 4
              TY      V +
Sbjct:   124 STYRATSKTVSI 135


>gi|162856 (M14077) chymosin [Bos taurus]
           Length = 381

  Minus Strand HSPs:

 Score = 135 (47.5 bits), Expect = 7.6e-06, P = 7.6e-06
 Identities = 31/110 (28%), Positives = 59/110 (53%), Frame = -3

Query:   330 GRIL-KTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSN-DNIELVDFQNIMFYGDAEVGD 157
             G+ L K +K H L   +++ +     G++ + Y G     ++ L ++ +  ++G   +G 
Sbjct:    27 GKSLRKALKEHGL---LEDFLQKQQYGIS-SKYSGFGEVASVPLTNYLDSQYFGKIYLGT 82

Query:   156 NQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
               Q FT + DTGS++ WVPS+ C + GC     +D  KS T++  G  + ++
Sbjct:    83 PPQEFTVLFDTGSSDFWVPSIYCKSNGCKNHQRFDPRKSSTFQNLGKPLSIH 134


>pdb|1PSN|  Pepsin 3a (E.C.3.4.23.1) >pdb|1PSO|E Homo sapiens
            Length = 326

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 9.2e-06, P = 9.2e-06
 Identities = 24/72 (33%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C++  C   + ++   S
Sbjct:     2 DEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDS 61

Query:    39 RTYEKDGTKVEM 4
              TY+     V +
Sbjct:    62 STYQSTSETVSI 73


>prf||2124254A pepsin:ISOTYPE=3a [Homo sapiens] >prf||2124254B
            pepsin:ISOTYPE=3b [Homo sapiens]
            Length = 326

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 9.2e-06, P = 9.2e-06
 Identities = 24/72 (33%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C++  C   + ++   S
Sbjct:     2 DEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDS 61

Query:    39 RTYEKDGTKVEM 4
              TY+     V +
Sbjct:    62 STYQSTSETVSI 73


>prf||2124254C pepsin:ISOTYPE=3c [Homo sapiens]
            Length = 326

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 9.2e-06, P = 9.2e-06
 Identities = 24/72 (33%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C++  C   + ++   S
Sbjct:     2 DEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDS 61

Query:    39 RTYEKDGTKVEM 4
              TY+     V +
Sbjct:    62 STYQSTSETVSI 73


>gnl|PID|d1020384 (AB002695) aspartic endopeptidase [Cucurbita pepo]
            Length = 513

  Minus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 9.6e-06, P = 9.6e-06
 Identities = 29/79 (36%), Positives = 44/79 (55%), Frame = -3

Query:   234 LGSSNDN--IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH 61
             LG S+D   + L ++ +  +YG+  +G   Q FT I DTGS+NLWV      +  C    
Sbjct:    71 LGESSDTDIVALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVLCECLFSVACHFHA 130

Query:    60 LYDSSKSRTYEKDGTKVEM 4
              Y SS+S +Y+K+GT   +
Sbjct:   131 RYKSSRSSSYKKNGTSASI 149


>pir||I47176 preprochymosin - pig (fragment) >gi|540097 (U14406) preprochymosin
            [Sus scrofa]
            Length = 380

  Minus Strand HSPs:

 Score = 134 (47.2 bits), Expect = 9.8e-06, P = 9.8e-06
 Identities = 23/60 (38%), Positives = 36/60 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ +  ++G   +G   Q FT + DTGS+ LWVPSV C +  C   H ++ SKS T++
Sbjct:    65 LTNYLDTQYFGKIYIGTPPQEFTVVFDTGSSELWVPSVYCKSDACQNHHRFNPSKSSTFQ 124


>sp|P27677|PEP2_MACFU PEPSINOGEN A-2 OR A-3 PRECURSOR (PEPSINOGEN III-2 OR
            III-1) >pir||S19684 pepsin A (EC 3.4.23.1) isozyme 2/3 precursor -
            Japanese macaque >gi|38069 (X59755) prepropepsinogen A-2/3 [Macaca
            fuscata]
            Length = 388

  Minus Strand HSPs:

 Score = 134 (47.2 bits), Expect = 1.0e-05, P = 1.0e-05
 Identities = 26/69 (37%), Positives = 40/69 (57%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT I DTGS+NLWVPSV C++  C   + ++   S
Sbjct:    64 DEQPLENYLDMEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACTNHNRFNPQDS 123

Query:    39 RTYEK-DGT 16
              TY+   GT
Sbjct:   124 STYQSTSGT 132


>pdb|1HTR|B Homo sapiens
            Length = 329

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.2e-05, P = 1.2e-05
 Identities = 23/64 (35%), Positives = 38/64 (59%), Frame = -3

Query:   210 ELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
             E + + +  ++G+  +G   Q F  + DTGS+NLWVPSV C +  C +   ++ S+S TY
Sbjct:     5 EPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTY 64

Query:    30 EKDG 19
               +G
Sbjct:    65 STNG 68


>gi|387014 (M18667) pepsinogen [Homo sapiens]
           Length = 385

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 24/71 (33%), Positives = 40/71 (56%), Frame = -3

Query:   231 GSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYD 52
             G  +   E + + +  ++G+  +G   Q F  + DTGS+NLWVPSV C +  C +   ++
Sbjct:    54 GDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFN 113

Query:    51 SSKSRTYEKDG 19
              S+S TY  +G
Sbjct:   114 PSESSTYSTNG 124


>sp|P28713|PEP4_RABIT PEPSINOGEN II-4 PRECURSOR (PEPSINOGEN A) >pir||D38302
            pepsin (EC 3.4.23.-) II-4 precursor - rabbit
            Length = 387

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 28/90 (31%), Positives = 48/90 (53%), Frame = -3

Query:   297 LKNYIK-ESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             L++Y+K  + N       K  +   S +++E  ++ +  ++G   +G   Q FT I DTG
Sbjct:    38 LQDYLKTHTPNPATKYFPKETFATVSTESLE--NYLDAEYFGTISIGTPPQDFTVIFDTG 95

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             S+NLWVPS  C++  C     ++   S TY+
Sbjct:    96 SSNLWVPSTYCSSLACALHKRFNPEDSSTYQ 126


>sp|P20142|PEPC_HUMAN PROGASTRICSIN PRECURSOR (PEPSINOGEN C) >pir||A29937
            gastricsin (EC 3.4.23.3) precursor - human >gi|387015 (M23077)
            pepsinogen C [Homo sapiens] >gi|551176 (J04443) pepsinogen [Homo
            sapiens] >gi|1658286 (U75272) gastricsin [Homo sapiens]
            Length = 388

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 24/71 (33%), Positives = 40/71 (56%), Frame = -3

Query:   231 GSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYD 52
             G  +   E + + +  ++G+  +G   Q F  + DTGS+NLWVPSV C +  C +   ++
Sbjct:    57 GDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFN 116

Query:    51 SSKSRTYEKDG 19
              S+S TY  +G
Sbjct:   117 PSESSTYSTNG 127


>sp|P00790|PEPA_HUMAN PEPSINOGEN A PRECURSOR >pir||PEHU pepsin A (EC 3.4.23.1)
            3 precursor - human >gi|387012 (J00287) pepsinogen [Homo sapiens]
            Length = 388

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 24/72 (33%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C++  C   + ++   S
Sbjct:    64 DEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDS 123

Query:    39 RTYEKDGTKVEM 4
              TY+     V +
Sbjct:   124 STYQSTSETVSI 135


>gi|499671 (L33856) rhizopuspepsin I [Rhizopus chinensis]
           Length = 340

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 31/93 (33%), Positives = 48/93 (51%), Frame = -3

Query:   297 LKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTG 121
             +  Y K  +N    G+     +G+    + + D+ N I +YG   +G   + F    DTG
Sbjct:    49 IAKYNKHKINTSTGGIVPDAGVGT----VPMTDYGNDIEYYGQVTIGTPGKKFNLDFDTG 104

Query:   120 SANLWVPSVKCTTAGCL-TKHLYDSSKSRTYEKDG 19
             S++LW+ S  CT  G   TK  YD ++S TY+ DG
Sbjct:   105 SSDLWIASTLCTNCGSRQTK--YDPNQSSTYQADG 137


>sp|P04073|PEPC_RAT PROGASTRICSIN PRECURSOR (PEPSINOGEN C) >pir||A24608
            gastricsin (EC 3.4.23.3) precursor - rat >gi|56881 (X04644)
            precursor polypeptide (AA -16 to 376) [Rattus norvegicus]
            >gi|206083 (M25993) pepsinogen [Rattus norvegicus]
            Length = 392

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.3e-05, P = 1.3e-05
 Identities = 32/107 (29%), Positives = 55/107 (51%), Frame = -3

Query:   327 RILKTIK-THKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVD---FQNIMFYGDAEVG 160
             R +K+I+ T K +  +K+ +        +  + G+  D   L +   + +  ++G+  +G
Sbjct:    24 RKMKSIRETMKEQGVLKDFLKTHKYDPGQKYHFGNFGDYSVLYEPMAYMDASYFGEISIG 83

Query:   159 DNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDG 19
                Q F  + DTGS+NLWV SV C +  C T   ++ SKS TY  +G
Sbjct:    84 TPPQNFLVLFDTGSSNLWVSSVYCQSEACTTHARFNPSKSSTYYTEG 130


>gi|915540 (U30251) pregnancy-specific antigen [Ovis aries]
           Length = 397

  Minus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 32/104 (30%), Positives = 56/104 (53%), Frame = -3

Query:   324 ILKTIKTHKLKNYIKESVNFLNSGLTK-TNYLG--SSND-NIELVDFQNIM---FYGDAE 166
             I+   KT  ++  ++E  N LN+ L +  N +   S++D  +     +N +   + G+  
Sbjct:    39 IMPLTKTKTMREILREK-NLLNNFLEEQANRMSDDSASDPKLSTHPLRNALDMAYVGNVT 97

Query:   165 VGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
             +G   + F  + DTGS++LWVPS+KC +  C T   +D  KS T+
Sbjct:    98 IGTPPKEFRVVFDTGSSDLWVPSIKCISPACYTHITFDHHKSSTF 142


>sp|P27821|PEP2_RABIT PEPSINOGEN II-2/3 PRECURSOR (PEPSINOGEN A) >gi|165600
            (M59235) pepsinogen [Oryctolagus cuniculus]
            Length = 387

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 28/90 (31%), Positives = 48/90 (53%), Frame = -3

Query:   297 LKNYIK-ESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             L++Y+K  + N       K  +   S +++E  ++ +  ++G   +G   Q FT I DTG
Sbjct:    38 LQDYLKTHTPNPATKYFPKETFATVSTESME--NYLDAEYFGTISIGTPPQDFTVIFDTG 95

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             S+NLWVPS  C++  C     ++   S TY+
Sbjct:    96 SSNLWVPSTYCSSLACALHKRFNPEDSSTYQ 126


>pir||C38302 pepsin (EC 3.4.23.-) II-2/3 precursor - rabbit
            Length = 387

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 28/90 (31%), Positives = 48/90 (53%), Frame = -3

Query:   297 LKNYIK-ESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             L++Y+K  + N       K  +   S +++E  ++ +  ++G   +G   Q FT I DTG
Sbjct:    38 LQDYLKTHTPNPATKYFPKETFATVSTESME--NYLDAEYFGTISIGTPPQDFTVIFDTG 95

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             S+NLWVPS  C++  C     ++   S TY+
Sbjct:    96 SSNLWVPSTYCSSLACALHKRFNPEDSSTYQ 126


>gi|387013 (M26032) pepsinogen A [Homo sapiens]
           Length = 388

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 24/72 (33%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C++  C   + ++   S
Sbjct:    64 DEQPLENYLDMEYFGTIGIGTPAQDFTVLFDTGSSNLWVPSVYCSSLACTNHNRFNPEDS 123

Query:    39 RTYEKDGTKVEM 4
              TY+     V +
Sbjct:   124 STYQSTSETVSI 135


>pir||A30142 pepsin A (EC 3.4.23.1) 5 precursor - human
            Length = 388

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 24/72 (33%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C++  C   + ++   S
Sbjct:    64 DEQPLENYLDMEYFGTIGIGTPAQDFTVLFDTGSSNLWVPSVYCSSLACTNHNRFNPEDS 123

Query:    39 RTYEKDGTKVEM 4
              TY+     V +
Sbjct:   124 STYQSTSETVSI 135


>pir||B30142 pepsin A (EC 3.4.23.1) 4 precursor - human
            Length = 388

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 24/72 (33%), Positives = 40/72 (55%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKS 40
             D   L ++ ++ ++G   +G   Q FT + DTGS+NLWVPSV C++  C   + ++   S
Sbjct:    64 DEQPLENYLDMEYFGTIGIGTPAQDFTVLFDTGSSNLWVPSVYCSSLACTNHNRFNPEDS 123

Query:    39 RTYEKDGTKVEM 4
              TY+     V +
Sbjct:   124 STYQSTSETVSI 135


>gi|1507727 (U34889) aspartic protease [Caenorhabditis elegans]
            Length = 388

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 26/62 (41%), Positives = 37/62 (59%), Frame = -3

Query:   204 VDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEK 25
             VD+ +  + G+  +G   QP T +LDTGS+NLWVP   C    C  K  Y S+KS T++ 
Sbjct:    61 VDYFDDFYLGNITLGTPPQPATVVLDTGSSNLWVPGPSCD-GSCKGKREYQSTKSSTFKA 119

Query:    24 DG 19
             +G
Sbjct:   120 NG 121


>pir||B43356 gastricsin (EC 3.4.23.3) precursor - guinea pig >gi|191297
            (M88652) progastricsin [Cavia porcellus]
            Length = 394

  Minus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.8e-05, P = 1.8e-05
 Identities = 30/89 (33%), Positives = 46/89 (51%), Frame = -3

Query:   297 LKNYIKESVN-FLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             LKN+  +    F  + L KT   G  +   E + + +  ++G   +G   Q F  + DTG
Sbjct:    43 LKNHKPQHARKFFRNRLAKT---GDFSVLYEPMSYMDAAYFGQISLGTPPQSFQVLFDTG 99

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
             S+NLWVPSV C++  C T   ++   S TY
Sbjct:   100 SSNLWVPSVYCSSLACTTHTRFNPRDSSTY 129


>bbs|146598 aspartic hemoglobinase II, ASP HGBASE II {N-terminal} [Plasmodium
            falciparum, clone HB-3, Peptide Partial, 23 aa]
            Length = 23

  Minus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 1.9e-05, P = 1.9e-05
 Identities = 21/21 (100%), Positives = 21/21 (100%), Frame = -3

Query:   222 NDNIELVDFQNIMFYGDAEVG 160
             NDNIELVDFQNIMFYGDAEVG
Sbjct:     3 NDNIELVDFQNIMFYGDAEVG 23


>gi|169742 (M63451) rhizopuspepsinogen [Rhizopus chinensis]
           Length = 393

  Minus Strand HSPs:

 Score = 131 (46.1 bits), Expect = 2.3e-05, P = 2.3e-05
 Identities = 31/93 (33%), Positives = 47/93 (50%), Frame = -3

Query:   297 LKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTG 121
             +  Y K  +N    G+     +G+    + + D+ N I +YG   +G   + F    DTG
Sbjct:    50 IAKYNKHKINTSTGGIVPDAGVGT----VPMTDYGNDIEYYGQVTIGTPGKKFNLDFDTG 105

Query:   120 SANLWVPSVKCTTAGCL-TKHLYDSSKSRTYEKDG 19
             S++LW+ S  CT  G   TK  YD  +S TY+ DG
Sbjct:   106 SSDLWIASTLCTNCGSRQTK--YDPKQSSTYQADG 138


>gi|169740 (J02651) rhizopuspepsin precursor (EC 3.4.23.6) [Rhizopus chinensis]
           Length = 352

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 30/93 (32%), Positives = 47/93 (50%), Frame = -3

Query:   297 LKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTG 121
             +  Y K  +N    G+     +G+    + + D+ N + +YG   +G   + F    DTG
Sbjct:     9 IAKYNKHKINTSTGGIVPDAGVGT----VPMTDYGNDVEYYGQVTIGTPGKKFNLDFDTG 64

Query:   120 SANLWVPSVKCTTAGCL-TKHLYDSSKSRTYEKDG 19
             S++LW+ S  CT  G   TK  YD  +S TY+ DG
Sbjct:    65 SSDLWIASTLCTNCGSRQTK--YDPKQSSTYQADG 97


>sp|P06026|CARP_RHICH RHIZOPUSPEPSIN PRECURSOR >gi|499674 (L33858)
            rhizopuspepsin II [Rhizopus chinensis] >gi|499676 (L33859)
            rhizopuspepsin II [Rhizopus chinensis]
            Length = 393

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 3.0e-05, P = 3.0e-05
 Identities = 30/93 (32%), Positives = 47/93 (50%), Frame = -3

Query:   297 LKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTG 121
             +  Y K  +N    G+     +G+    + + D+ N + +YG   +G   + F    DTG
Sbjct:    50 IAKYNKHKINTSTGGIVPDAGVGT----VPMTDYGNDVEYYGQVTIGTPGKKFNLDFDTG 105

Query:   120 SANLWVPSVKCTTAGCL-TKHLYDSSKSRTYEKDG 19
             S++LW+ S  CT  G   TK  YD  +S TY+ DG
Sbjct:   106 SSDLWIASTLCTNCGSRQTK--YDPKQSSTYQADG 138


>pir||A26681 rhizopuspepsin (EC 3.4.23.21) II precursor - Rhizopus chinensis
            Length = 393

  Minus Strand HSPs:

 Score = 130 (45.8 bits), Expect = 3.0e-05, P = 3.0e-05
 Identities = 30/93 (32%), Positives = 47/93 (50%), Frame = -3

Query:   297 LKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTG 121
             +  Y K  +N    G+     +G+    + + D+ N + +YG   +G   + F    DTG
Sbjct:    50 IAKYNKHKINTSTGGIVPDAGVGT----VPMTDYGNDVEYYGQVTIGTPGKKFNLDFDTG 105

Query:   120 SANLWVPSVKCTTAGCL-TKHLYDSSKSRTYEKDG 19
             S++LW+ S  CT  G   TK  YD  +S TY+ DG
Sbjct:   106 SSDLWIASTLCTNCGSRQTK--YDPKQSSTYQADG 138


>gi|162858 (J00002) preprochymosin a [Bos taurus]
           Length = 381

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 3.7e-05, P = 3.7e-05
 Identities = 30/110 (27%), Positives = 58/110 (52%), Frame = -3

Query:   330 GRIL-KTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSN-DNIELVDFQNIMFYGDAEVGD 157
             G+ L K +K H L   +++ +     G++ + Y G     ++ L ++ +  ++G   +G 
Sbjct:    27 GKSLRKALKEHGL---LEDFLQKQQYGIS-SKYSGFGEVASVPLTNYLDSQYFGKIYLGT 82

Query:   156 NQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
               Q FT + DTGS++ WVPS+ C +  C     +D  KS T++  G  + ++
Sbjct:    83 PPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIH 134


>gi|162860 (J00003) preprochymosin b [Bos taurus]
           Length = 381

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 3.7e-05, P = 3.7e-05
 Identities = 30/110 (27%), Positives = 58/110 (52%), Frame = -3

Query:   330 GRIL-KTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSN-DNIELVDFQNIMFYGDAEVGD 157
             G+ L K +K H L   +++ +     G++ + Y G     ++ L ++ +  ++G   +G 
Sbjct:    27 GKSLRKALKEHGL---LEDFLQKQQYGIS-SKYSGFGEVASVPLTNYLDSQYFGKIYLGT 82

Query:   156 NQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
               Q FT + DTGS++ WVPS+ C +  C     +D  KS T++  G  + ++
Sbjct:    83 PPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIH 134


>sp|P00794|CHYM_BOVIN PROCHYMOSIN A AND B PRECURSORS (PREPRORENNIN)
            Length = 381

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 3.7e-05, P = 3.7e-05
 Identities = 30/110 (27%), Positives = 58/110 (52%), Frame = -3

Query:   330 GRIL-KTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSN-DNIELVDFQNIMFYGDAEVGD 157
             G+ L K +K H L   +++ +     G++ + Y G     ++ L ++ +  ++G   +G 
Sbjct:    27 GKSLRKALKEHGL---LEDFLQKQQYGIS-SKYSGFGEVASVPLTNYLDSQYFGKIYLGT 82

Query:   156 NQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
               Q FT + DTGS++ WVPS+ C +  C     +D  KS T++  G  + ++
Sbjct:    83 PPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIH 134


>pir||CMBO chymosin (EC 3.4.23.4) precursor - bovine
           Length = 381

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 3.7e-05, P = 3.7e-05
 Identities = 30/110 (27%), Positives = 58/110 (52%), Frame = -3

Query:   330 GRIL-KTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSN-DNIELVDFQNIMFYGDAEVGD 157
             G+ L K +K H L   +++ +     G++ + Y G     ++ L ++ +  ++G   +G 
Sbjct:    27 GKSLRKALKEHGL---LEDFLQKQQYGIS-SKYSGFGEVASVPLTNYLDSQYFGKIYLGT 82

Query:   156 NQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
               Q FT + DTGS++ WVPS+ C +  C     +D  KS T++  G  + ++
Sbjct:    83 PPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIH 134


>pir||A34657 cathepsin E (EC 3.4.23.34) - rat (fragment)
            Length = 52

  Minus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 4.0e-05, P = 4.0e-05
 Identities = 19/41 (46%), Positives = 28/41 (68%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSV 94
             N  L+++ ++ ++G   +G   Q FT I DTGS+NLWVPSV
Sbjct:    11 NEPLINYLDMNYFGSRSIGSPSQXFTVIFDTGSSNLWVPSV 51


>gnl|PID|e274112 (Y08567) aspartic protease [Pagothenia bernachii]
            Length = 406

  Minus Strand HSPs:

 Score = 129 (45.4 bits), Expect = 4.2e-05, P = 4.2e-05
 Identities = 24/72 (33%), Positives = 42/72 (58%), Frame = -3

Query:   234 LGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLY 55
             LG S++ I   +F +  ++GD  +G   Q F+ + DTGS++LWVPS  C +  C +   +
Sbjct:    68 LGRSSEKI--YNFMDAQYFGDITLGTPGQNFSVVFDTGSSDLWVPSTYCVSQACASHKRF 125

Query:    54 DSSKSRTYEKDG 19
              + +S ++  DG
Sbjct:   126 RAFESTSFRHDG 137


>pir||A39314 gastricsin (EC 3.4.23.3) precursor - bullfrog >gi|213688 (M73750)
            pepsinogen [Rana catesbeiana]
            Length = 384

  Minus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 4.9e-05, P = 4.9e-05
 Identities = 24/75 (32%), Positives = 40/75 (53%), Frame = -3

Query:   243 TNYLGSSNDNIE-LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLT 67
             T Y  +     E L ++ ++ +YG+  +G   Q F  + DTGS+NLWVPS  C +  C  
Sbjct:    46 TKYYNNFATAFEPLANYMDMSYYGEISIGTPPQNFLVLFDTGSSNLWVPSTYCQSQACTN 105

Query:    66 KHLYDSSKSRTYEKD 22
                ++ S+S +Y  +
Sbjct:   106 HPQFNPSQSSSYSSN 120


>gi|164604 (J04601) pepsinogen A precursor [Sus scrofa]
           Length = 385

  Minus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 4.9e-05, P = 4.9e-05
 Identities = 30/95 (31%), Positives = 49/95 (51%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFI 133
             IK  KLK+++K   +  N          +   +  L ++ +  ++G   +G   Q FT I
Sbjct:    32 IKNGKLKDFLKTHKH--NPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVI 89

Query:   132 LDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
              DTGS+NLWVPSV C++  C   + ++   S T+E
Sbjct:    90 FDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFE 124


>sp|P00791|PEPA_PIG PEPSINOGEN A PRECURSOR >pir||PEPG pepsin A (EC 3.4.23.1)
            precursor - pig >gi|164602 (M20920) pepsinogen precursor [Sus
            scrofa]
            Length = 386

  Minus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 5.0e-05, P = 5.0e-05
 Identities = 30/95 (31%), Positives = 49/95 (51%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFI 133
             IK  KLK+++K   +  N          +   +  L ++ +  ++G   +G   Q FT I
Sbjct:    32 IKNGKLKDFLKTHKH--NPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVI 89

Query:   132 LDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
              DTGS+NLWVPSV C++  C   + ++   S T+E
Sbjct:    90 FDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFE 124


>sp|P10602|CAR1_RHINI RHIZOPUSPEPSIN 1 PRECURSOR (ASPARTATE PROTEASE)
            >pir||A28672 rhizopuspepsin (EC 3.4.23.21) precursor - Rhizopus
            niveus >gi|169744 (M19100) aspartic proteinase precursor [Rhizopus
            niveus]
            Length = 389

  Minus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 5.0e-05, P = 5.0e-05
 Identities = 37/123 (30%), Positives = 56/123 (45%), Frame = -3

Query:   387 EILKNSEHLTIGFKVGNAHGRILKTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIE 208
             E   N + + I     N++    K      L  Y +  V   + G+T T   GS    + 
Sbjct:    20 EAAPNGKKINIPLAKNNSYKPSAKNALNKALAKYNRRKVG--SGGIT-TEASGS----VP 72

Query:   207 LVDFQN-IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHL-YDSSKSRT 34
             +VD++N + +YG+  VG          DTGS+++W  S  C++  C   H  YD  KS T
Sbjct:    73 MVDYENDVEYYGEVTVGTPGIKLKLDFDTGSSDMWFASTLCSS--CSNSHTKYDPKKSST 130

Query:    33 YEKDG 19
             Y  DG
Sbjct:   131 YAADG 135


>pdb|2PSG|  Pepsinogen >pdb|3PSG|  Pepsinogen
            Length = 370

  Minus Strand HSPs:

 Score = 127 (44.7 bits), Expect = 6.0e-05, P = 6.0e-05
 Identities = 30/95 (31%), Positives = 49/95 (51%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFI 133
             IK  KLK+++K   +  N          +   +  L ++ +  ++G   +G   Q FT I
Sbjct:    17 IKDGKLKDFLKTHKH--NPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVI 74

Query:   132 LDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
              DTGS+NLWVPSV C++  C   + ++   S T+E
Sbjct:    75 FDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFE 109


>prf||0803215A rennin,pro [Bos taurus]
            Length = 375

  Minus Strand HSPs:

 Score = 127 (44.7 bits), Expect = 6.1e-05, P = 6.1e-05
 Identities = 30/110 (27%), Positives = 58/110 (52%), Frame = -3

Query:   330 GRIL-KTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSN-DNIELVDFQNIMFYGDAEVGD 157
             G+ L K +K H L   +++ +     G++ + Y G     ++ L ++ +  ++G   +G 
Sbjct:    21 GKSLRKALKEHGL---LEDFLQKQQYGIS-SKYSGFGEVASVPLTNYLDSQYFGKIYLGY 76

Query:   156 NQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEMN 1
               Q FT + DTGS++ WVPS+ C +  C     +D  KS T++  G  + ++
Sbjct:    77 PPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIH 128


>pdb|1PSA|A Sus scrofa >pdb|1PSA|B Sus scrofa
            Length = 326

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 7.9e-05, P = 7.9e-05
 Identities = 23/60 (38%), Positives = 36/60 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ +  ++G   +G   Q FT I DTGS+NLWVPSV C++  C   + ++   S T+E
Sbjct:     6 LENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFE 65


>pdb|3PEP|  Pepsin (E.C.3.4.23.1) >pdb|4PEP|  Pepsin (E.C.3.4.23.1)
            Length = 326

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 7.9e-05, P = 7.9e-05
 Identities = 23/60 (38%), Positives = 36/60 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ +  ++G   +G   Q FT I DTGS+NLWVPSV C++  C   + ++   S T+E
Sbjct:     6 LENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFE 65


>pdb|5PEP|  Pepsin (E.C.3.4.23.1)
            Length = 326

  Minus Strand HSPs:

 Score = 125 (44.0 bits), Expect = 7.9e-05, P = 7.9e-05
 Identities = 23/60 (38%), Positives = 36/60 (60%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ +  ++G   +G   Q FT I DTGS+NLWVPSV C++  C   + ++   S T+E
Sbjct:     6 LENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFE 65


>pdb|1CMS|  Chymosin B (Formerly Known As Rennin) (E.C.3.4.23.4) >pdb|4CMS|
            Chymosin B (Formerly Known As Rennin) (E.C.3.4.23.4) >pdb|1CZI|E
            Chymosin Complex With The Inhibitor Cp-113972 Hydrolase (Acid
            Proteinase), Inhibitor Complex, Complex (Aspartyl
            ProteaseINHIBITOR) Mol_id: 1; Molecule: Chymosin; Chain: E;
            Synonym: Rennin; Ec: 3.4.23.4; Engineered: Yes; Mol_id: 2;...
            Length = 323

  Minus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 0.00010, P = 0.00010
 Identities = 21/72 (29%), Positives = 40/72 (55%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             ++ L ++ +  ++G   +G   Q FT + DTGS++ WVPS+ C +  C     +D  KS 
Sbjct:     5 SVPLTNYLDSQYFGKIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSS 64

Query:    36 TYEKDGTKVEMN 1
             T++  G  + ++
Sbjct:    65 TFQNLGKPLSIH 76


>pdb|3CMS|  Chymosin B (Formerly Known As Rennin) (E.C.3.4.23.4) Mutant With
            Val 111 Replaced By Phe (V111F)
            Length = 323

  Minus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 0.00010, P = 0.00010
 Identities = 21/72 (29%), Positives = 40/72 (55%), Frame = -3

Query:   216 NIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR 37
             ++ L ++ +  ++G   +G   Q FT + DTGS++ WVPS+ C +  C     +D  KS 
Sbjct:     5 SVPLTNYLDSQYFGKIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSS 64

Query:    36 TYEKDGTKVEMN 1
             T++  G  + ++
Sbjct:    65 TFQNLGKPLSIH 76


>pdb|2APR|  Acid Proteinase (Rhizopuspepsin) (E.C.3.4.23.6) >pdb|3APR|E
            Rhizopus microsporus var. chinensis >pdb|4APR|E Rhizopus
            microsporus var. chinensis >pdb|5APR|E Rhizopus microsporus var.
            chinensis >pdb|6APR|E Rhizopus microsporus var. chinensis
            Length = 325

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 0.00014, P = 0.00014
 Identities = 26/65 (40%), Positives = 38/65 (58%), Frame = -3

Query:   213 IELVDFQN-IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGC-LTKHLYDSSKS 40
             + + D+ N I +YG   +G   + F    DTGS++LW+ S  CT  G   TK  YD ++S
Sbjct:     6 VPMTDYGNDIEYYGQVTIGTPGKKFNLDFDTGSSDLWIASTLCTNCGSGQTK--YDPNQS 63

Query:    39 RTYEKDG 19
              TY+ DG
Sbjct:    64 STYQADG 70


>pir||A41415 rhizopuspepsin (EC 3.4.23.21) I - Rhizopus chinensis
            >prf||1402278A hizopuspepsin I [Rhizopus chinensis]
            Length = 325

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 0.00014, P = 0.00014
 Identities = 26/65 (40%), Positives = 38/65 (58%), Frame = -3

Query:   213 IELVDFQN-IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCL-TKHLYDSSKS 40
             + + D+ N I +YG   +G   + F    DTGS++LW+ S  CT  G   TK  YD ++S
Sbjct:     6 VPMTDYGNDIEYYGQVTIGTPGKKFNLDFDTGSSDLWIASTLCTNCGSRQTK--YDPNQS 63

Query:    39 RTYEKDG 19
              TY+ DG
Sbjct:    64 STYQADG 70


>sp|P18276|CHYM_SHEEP PROCHYMOSIN PRECURSOR, B-FORM (PREPRORENNIN) >pir||CMSHB
            chymosin (EC 3.4.23.4) B precursor - sheep >gi|1374 (X53037)
            preprochymosin [Ovis aries] >prf||1817165A prepro-chymosin [Ovis
            aries]
            Length = 381

  Minus Strand HSPs:

 Score = 124 (43.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 31/103 (30%), Positives = 51/103 (49%), Frame = -3

Query:   309 KTHKLKNYIKESVNFLNSGLTKTNYLGSSND--------NIELVDFQNIMFYGDAEVGDN 154
             K   L+  +KE    L   L K  Y G S++        ++ L ++ +  ++G   +G  
Sbjct:    26 KGKPLRKALKER-GLLEDFLQKQQY-GVSSEYSGFGEVASVPLTNYLDSQYFGKIYLGTP 83

Query:   153 QQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDG 19
              Q FT + DTGS++ WVPS+ C +  C     +D  KS T++  G
Sbjct:    84 PQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLG 128


>sp|Q29078|PAG1_PIG PREGNANCY-ASSOCIATED GLYCOPROTEIN 1 PRECURSOR (PAG 1)
            >pir||I46616 pregnancy-associated glycoprotein - pig >gi|1066344
            (L34360) pregnancy-associated glycoprotein [Sus scrofa]
            Length = 389

  Minus Strand HSPs:

 Score = 123 (43.3 bits), Expect = 0.00019, P = 0.00019
 Identities = 26/99 (26%), Positives = 52/99 (52%), Frame = -3

Query:   297 LKNYIKES-VNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             L N++KE   N +     K +        + L ++ ++++ G+  +G   Q F+ I DT 
Sbjct:    37 LLNFLKEHPYNMIQKFGLKGSLCSPKISCLRLWNYLDMVYVGNITIGTPPQLFSVIFDTA 96

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDGTKVEM 4
             S++LWVPS +C +  C+T   ++ + S T++     V++
Sbjct:    97 SSDLWVPSNQCHSRACVTHRSFNPTLSSTFQSSNRTVKL 135


>prf||1402278B rhizopuspepsin II [Rhizopus chinensis]
            Length = 325

  Minus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 0.00023, P = 0.00023
 Identities = 25/65 (38%), Positives = 37/65 (56%), Frame = -3

Query:   213 IELVDFQN-IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCL-TKHLYDSSKS 40
             + + D+ N + +YG   +G   + F    DTGS++LW+ S  CT  G   TK  YD  +S
Sbjct:     6 VPMTDYGNDVEYYGQVTIGTPGKKFNLDFDTGSSDLWIASTLCTNCGSRQTK--YDPKQS 63

Query:    39 RTYEKDG 19
              TY+ DG
Sbjct:    64 STYQADG 70


>sp|Q28389|PAG_HORSE PREGNANCY-ASSOCIATED GLYCOPROTEIN PRECURSOR (PAG)
            >gi|601912 (L38511) pregnancy-associated glycoprotein [Equus
            caballus]
            Length = 388

  Minus Strand HSPs:

 Score = 122 (42.9 bits), Expect = 0.00024, P = 0.00024
 Identities = 22/66 (33%), Positives = 38/66 (57%), Frame = -3

Query:   201 DFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKD 22
             ++ +I + G   VG   Q F  I DTGSA+LWVPS+ C++  C   + ++  +S T+   
Sbjct:    68 NYLDIAYMGIISVGTPPQEFQVIFDTGSADLWVPSIYCSSPACSNHNTFNPLRSSTFVAS 127

Query:    21 GTKVEM 4
             G  +++
Sbjct:   128 GQPIKL 133


>bbs|174327 pepsinogen 2 [tuna, Peptide, 360 aa]
            Length = 360

  Minus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 0.00028, P = 0.00028
 Identities = 21/55 (38%), Positives = 33/55 (60%), Frame = -3

Query:   192 NIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             ++ +YG   +G   Q F  I DTGS+NLWVPSV C++  C     ++  +S T++
Sbjct:    50 DLSYYGVVSIGTPPQSFKVIFDTGSSNLWVPSVYCSSQACQNHKKFNPQQSSTFK 104


>pir||A61388 renin (EC 3.4.23.15) - rabbit (fragment)
            Length = 280

  Minus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 0.00037, P = 0.00037
 Identities = 23/43 (53%), Positives = 31/43 (72%), Frame = -3

Query:   135 ILDTGSANLWVPSVKCTT--AGCLTKHLYDSSKSRTYEKDGTK 13
             I DTGSANLWVPS KC+     C   +LYDS++S +Y ++GT+
Sbjct:     1 IFDTGSANLWVPSTKCSPLYTACEIHNLYDSAESSSYLENGTE 43


>gnl|PID|e4885 (X01696) renin part 3 (263 is 1st base in codon) [Homo sapiens]
            Length = 41

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.00040, P = 0.00040
 Identities = 16/33 (48%), Positives = 23/33 (69%), Frame = -3

Query:   183 FYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT 85
             +YG+  +G   Q F  + DTGS+N+WVPS KC+
Sbjct:     3 YYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCS 35


>sp|Q29432|PAG1_BOVIN PREGNANCY-ASSOCIATED GLYCOPROTEIN 1 PRECURSOR (PAG 1)
            (PREGNANCY-SPECIFIC PROTEIN B) (PSP-B) >pir||B41545
            pregnancy-specific antigen precursor - bovine >bbs|174347
            pregnancy-associated glycoprotein, PAG-1 [cattle, placenta,
            Peptide, 380 aa] >gi|971164 (M73962) pregnancy-associated
            glycoprotein 1 [Bos taurus] >gi|1119208 (L27832)
            pregnancy-associated protein 1 [Bos taurus]
            Length = 380

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00040, P = 0.00040
 Identities = 30/100 (30%), Positives = 55/100 (55%), Frame = -3

Query:   327 RILKTIKT-----HKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEV 163
             R LKT++      + L N++KE        L++ ++ GS+     L + +++++ G+  +
Sbjct:    22 RRLKTMRNVVSGKNMLNNFLKEHAY----SLSQISFRGSNLTTHPLRNIKDLVYMGNITI 77

Query:   162 GDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
             G   Q F  + DT S++LWVPS  CT+  C T   +   +S T+
Sbjct:    78 GTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTF 121


>gi|2055443 (U94794) pregnancy-associated glycoprotein 8 [Ovis aries]
            Length = 341

  Minus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 0.00056, P = 0.00056
 Identities = 32/100 (32%), Positives = 56/100 (56%), Frame = -3

Query:   327 RILKTIK-THKLKNYIKESVNFLNSG---LTKTNYLGSSNDNIELVDFQNIMFYGDAEVG 160
             R +KT+  T   KN +    NFL      L++ ++ GS+     L++  ++++ G+  +G
Sbjct:    22 RRVKTMSNTASGKNMLN---NFLKKHPYRLSQISFRGSNLTTHPLMNIWDLLYLGNITIG 78

Query:   159 DNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH-LYDSSKSRTY 31
                Q F  + D GS++LWVPS+ C ++ C  KH ++    S TY
Sbjct:    79 TPPQEFQVLFDRGSSDLWVPSLLCNSSTC-AKHVMFRHRLSSTY 121


>gi|2055445 (U94795) pregnancy-associated glycoprotein 9 [Ovis aries]
            Length = 346

  Minus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 0.00058, P = 0.00058
 Identities = 30/100 (30%), Positives = 55/100 (55%), Frame = -3

Query:   321 LKTIKTHKLKNYIKESV--NFLNSGLTKTNYLGSSNDNIE--LVDFQNIMFYGDAEVGDN 154
             L+ +KT + KN   +++  NFL     + + +     N+   L ++ ++++ G+  +G  
Sbjct:    21 LRRVKTMR-KNPSGKNMMNNFLKEHAYRLSQISFRGLNLTHPLSNYIDMLYTGNITIGTP 79

Query:   153 QQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
              Q F  I DTGS++LWVPS  CT+  C T+  +   +S T+
Sbjct:    80 PQKFQVIFDTGSSDLWVPSNFCTSPACSTQARFRYRQSSTF 120


>gi|402686 (L06153) pregnancy-specific glycoprotein [Bos taurus]
           Length = 378

  Minus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 0.00068, P = 0.00068
 Identities = 27/89 (30%), Positives = 48/89 (53%), Frame = -3

Query:   297 LKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGS 118
             L N +KE V      L++ ++ GS+     L + +++++ G+  +G   Q F  + DTGS
Sbjct:    34 LNNILKEHVY----RLSQISFRGSNLTTHPLRNIKDLIYVGNITIGTPPQEFQVVFDTGS 89

Query:   117 ANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
             ++ WVPS  CT+  C T   +   +S T+
Sbjct:    90 SDFWVPSDFCTSRACSTHVRFRHLQSSTF 118


>gi|2055433 (U94789) pregnancy-associated glycoprotein 3 [Ovis aries]
            Length = 380

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00089, P = 0.00089
 Identities = 28/100 (28%), Positives = 52/100 (52%), Frame = -3

Query:   327 RILKTI-KTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQ 151
             R LKT+ KT    N +   +      L + ++  S+   + L + ++I + G+  +G   
Sbjct:    22 RRLKTMRKTLSGNNILNNVLKEYPYRLPQISFRDSNVTILPLRNMKDIFYVGNITIGTPP 81

Query:   150 QPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
             Q F  + DT S++LWVPS+ C ++ C T+  +   +S T+
Sbjct:    82 QEFQVVFDTASSDLWVPSIFCNSSTCSTRVRFRHRQSSTF 121


>sp|P43232|CAR5_RHINI RHIZOPUSPEPSIN 5 PRECURSOR (ASPARTATE PROTEASE)
            >gnl|PID|e257851 (X56993) aspartic proteinase V [Rhizopus niveus]
            Length = 392

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.00093, P = 0.00093
 Identities = 30/93 (32%), Positives = 47/93 (50%), Frame = -3

Query:   297 LKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTG 121
             L  Y +      +S  T T+ +G     + + D+ N I ++G  +VG          DTG
Sbjct:    50 LAKYHRHRSTSSSSNSTSTDGIG----RVPVTDYYNDIEYFGQVKVGTPGVTLKLDFDTG 105

Query:   120 SANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDG 19
             S++LW  S  CT  G  ++  Y+ ++SRTY KDG
Sbjct:   106 SSDLWFASSLCTNCG-YSQTKYNPNQSRTYAKDG 138


>sp|Q03700|CAR4_RHINI RHIZOPUSPEPSIN 4 PRECURSOR (ASPARTATE PROTEASE) >gi|3281
            (X56992) aspartic proteinase IV [Rhizopus niveus]
            Length = 398

  Minus Strand HSPs:

 Score = 116 (40.8 bits), Expect = 0.0012, P = 0.0012
 Identities = 27/69 (39%), Positives = 38/69 (55%), Frame = -3

Query:   225 SNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDS 49
             S+ ++ + D  N I +YG+  VG          DTGS++LW  S  CT  G  ++  YD 
Sbjct:    75 SSGSVPVTDDGNDIEYYGEVTVGTPGIKLKLDFDTGSSDLWFASTLCTNCGS-SQTKYDP 133

Query:    48 SKSRTYEKDG 19
             S+S TY KDG
Sbjct:   134 SQSSTYAKDG 143


>gi|2055437 (U94791) pregnancy-associated glycoprotein 5 [Ovis aries]
            Length = 379

  Minus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.0015, P = 0.0015
 Identities = 29/97 (29%), Positives = 50/97 (51%), Frame = -3

Query:   291 NYIKESVN---FLNSGLTKTNYLGSSNDN-------IELVDFQNIMFYGDAEVGDNQQPF 142
             N ++E++N    LN+ L K  Y  + N         + + +F ++ + G+  +G   Q F
Sbjct:    25 NVMQETLNEKSLLNNFLKKYPYRLAQNSTRNSKMAFVPMRNFLDLAYVGNMTIGTPPQQF 84

Query:   141 TFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
               + DTGS++LWVPS  CT+  C +   +   +S TY
Sbjct:    85 RVVFDTGSSDLWVPSNFCTSPACYSHITFKYWESSTY 121


>sp|Q03699|CAR3_RHINI RHIZOPUSPEPSIN 3 PRECURSOR (ASPARTATE PROTEASE)
            >pir||JU0343 rhizopuspepsin (EC 3.4.23.21) III - Rhizopus niveus
            >gi|3279 (X56965) aspartic proteinase III [Rhizopus niveus]
            Length = 391

  Minus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.0020, P = 0.0020
 Identities = 37/107 (34%), Positives = 55/107 (51%), Frame = -3

Query:   339 NAHGRILKTI-KTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAE 166
             NA   I K I K H+ +     SV+  NS  T T+ +G     + + D+ N I +YG+  
Sbjct:    41 NAKNAIQKAIAKYHRHR-----SVSSSNS--TSTDGIGY----VPVTDYYNDIEYYGEVT 89

Query:   165 VGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDG 19
             VG          DTGS++LW  S  CT  G  ++  Y+ ++S TY +DG
Sbjct:    90 VGTPGVTLKLDFDTGSSDLWFASSLCTNCGS-SQTKYNPNESSTYARDG 137


>gi|1465799 (U64851) coded for by C. elegans cDNA cm08a9; coded for by C.
            elegans cDNA cm01h3; coded for by C. elegans cDNA yk169e3.5; coded
            for by C. elegans cDNA yk169e3.3; similar to aspartyl proteases
            [Caenorhabditis elegans]
            Length = 389

  Minus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0026, P = 0.0026
 Identities = 24/57 (42%), Positives = 31/57 (54%), Frame = -3

Query:   201 DFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
             D+    + G+  VG   Q F  +LDTGSANL +P   CTT  C  K L++   S TY
Sbjct:    66 DYVYYEYMGNITVGTPDQNFIVVLDTGSANLLIPGTNCTTY-CEKKRLFNEKASSTY 121


>sp|P27823|PEPF_RABIT PEPSINOGEN F PRECURSOR >gi|165602 (M59238) pepsinogen
            [Oryctolagus cuniculus]
            Length = 388

  Minus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.0034, P = 0.0034
 Identities = 21/68 (30%), Positives = 38/68 (55%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ ++ + G   +G   Q F  +LDTGSA+LWVPS+ C++  C   + ++   S T+ 
Sbjct:    66 LRNYLDLAYIGIISIGTPPQEFKVVLDTGSADLWVPSIYCSSPACGKHNTFNPLLSSTFL 125

Query:    27 KDGTKVEM 4
               G  + +
Sbjct:   126 VSGRPINI 133


>pir||A38302 pepsin (EC 3.4.23.-) F precursor - rabbit
            Length = 389

  Minus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.0034, P = 0.0034
 Identities = 21/68 (30%), Positives = 38/68 (55%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYE 28
             L ++ ++ + G   +G   Q F  +LDTGSA+LWVPS+ C++  C   + ++   S T+ 
Sbjct:    66 LRNYLDLAYIGIISIGTPPQEFKVVLDTGSADLWVPSIYCSSPACGKHNTFNPLLSSTFL 125

Query:    27 KDGTKVEM 4
               G  + +
Sbjct:   126 VSGRPINI 133


>sp|P43231|CAR2_RHINI RHIZOPUSPEPSIN 2 PRECURSOR (ASPARTATE PROTEASE)
            >gnl|PID|e257850 (X56964) aspartic proteinase II [Rhizopus niveus]
            Length = 391

  Minus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 0.0035, P = 0.0035
 Identities = 29/81 (35%), Positives = 41/81 (50%), Frame = -3

Query:   261 NSGLTKTNYLGSSNDNIELVDFQN-IMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCT 85
             +S  T T   GS    + + D+ N I +YG   VG          DTGS++LW  S  CT
Sbjct:    61 SSNSTSTEGTGS----VPVTDYYNDIEYYGKVTVGTPGVTLKLDFDTGSSDLWFASTLCT 116

Query:    84 TAGCLTKHLYDSSKSRTYEKDG 19
               G  ++  Y+ ++S TY KDG
Sbjct:   117 NCGS-SQTKYNPNQSSTYAKDG 137


>pir||JH0240 aspartic proteinase (EC 3.4.23.-) - mouse (fragment) >bbs|38525
            Asppcr1=aspartic protease [mice, Peptide Partial, 187 aa]
            Length = 187

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.0038, P = 0.0038
 Identities = 20/37 (54%), Positives = 25/37 (67%), Frame = -3

Query:   129 DTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTYEKDG 19
             DTGSANLWVPSV CT+  C    ++  S+S TY + G
Sbjct:     2 DTGSANLWVPSVYCTSPACKAHPVFHPSQSDTYTEVG 38


>gi|1118134 (U41746) coded for by C. elegans cDNA cm01c12; coded for by C.
            elegans cDNA cm16h12; coded for by C. elegans cDNA yk18g4.3; coded
            for by C. elegans cDNA yk36b6.3; coded for by C. elegans cDNA
            yk36b6.5;  similar to the eukaryotic aspartyl pro...
            Length = 709

  Minus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0042, Sum P(2) = 0.0042
 Identities = 18/40 (45%), Positives = 27/40 (67%), Frame = -3

Query:   201 DFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT 82
             D+++  + G+  +G  QQ F  ILDTGS+NLW+P + C T
Sbjct:   348 DYEDEAYVGNITIGTPQQQFKVILDTGSSNLWIPDITCGT 387

 Score = 93 (32.7 bits), Expect = 0.26, Sum P(2) = 0.23
 Identities = 16/40 (40%), Positives = 23/40 (57%), Frame = -3

Query:   201 DFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTT 82
             D+++  + G   VG   Q F  I+DTGS+N W+P   C T
Sbjct:    34 DYEHAGYVGKITVGSPPQEFRVIMDTGSSNFWIPDSTCDT 73

 Score = 47 (16.5 bits), Expect = 0.0042, Sum P(2) = 0.0042
 Identities = 8/22 (36%), Positives = 15/22 (68%), Frame = -3

Query:    84 TAGCLTKHLYDSSKSRTYEKDG 19
             T  C  ++ +D+SKS +Y+ +G
Sbjct:   420 TDSCFYQNKFDASKSSSYKTNG 441


>gi|2055435 (U94790) pregnancy-associated glycoprotein 4 [Ovis aries]
            Length = 380

  Minus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0043, P = 0.0043
 Identities = 34/105 (32%), Positives = 54/105 (51%), Frame = -3

Query:   327 RILKTI-KTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQ 151
             R +KT+ KT   KN + + +      L + ++ GS+     L + ++  + G+  +G   
Sbjct:    22 RRVKTMRKTLSGKNMLNDVLKEHPYRLPQISFRGSNLIIHPLRNIRDTFYVGNITIGTPP 81

Query:   150 QPFTFILDTGSANLWVPSVKCTTAGCLT----KHLYDSSKSRTYEK 25
             Q F  + DTGS+ LWVPSV C ++ C      +HL  SS  RT  K
Sbjct:    82 QEFQVLFDTGSSVLWVPSVLCNSSTCSIHVRFRHL-QSSTFRTTNK 126


>gi|2055439 (U94792) pregnancy-associated glycoprotein 6 [Ovis aries]
            Length = 380

  Minus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 0.012, P = 0.012
 Identities = 29/100 (29%), Positives = 49/100 (49%), Frame = -3

Query:   327 RILKTI-KTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQN---IMFYGDAEVG 160
             R +KT+ KT   KN +    NFL     + + +     N+ +   +N   +++ G+  +G
Sbjct:    22 RRVKTMRKTLSEKNMLN---NFLKEHAYRLSQISFRGSNLTIHPLRNTKDLVYLGNITIG 78

Query:   159 DNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
                Q F  + DTGS++LWVPS  C    C     +   +S T+
Sbjct:    79 TPPQEFQVVSDTGSSDLWVPSDFCAIEACSLHTRFRHLQSSTF 121


>gnl|PID|e250444 (Z75527) C15C8.3 [Caenorhabditis elegans]
            Length = 428

  Minus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.019, P = 0.019
 Identities = 31/97 (31%), Positives = 49/97 (50%), Frame = -3

Query:   300 KLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTG 121
             KL  Y KE    L+    K+  L SS+  +  +D++++ +     +G   Q F   +D+G
Sbjct:    38 KLAEYEKERNELLSK---KSLQLASSSSPV--IDYEDMAYMVQISLGSPAQNFVLFIDSG 92

Query:   120 SANLWVPSVKCT-----TAGCLTKHL-YDSSKSRTYEKDGTK 13
             S+NLWVP + C      T G   K   YD+  +   E+  TK
Sbjct:    93 SSNLWVPDITCAGGKDATCGSYCKSTPYDACLTFCQEECCTK 134


>gnl|PID|e308073 (Y11825) extracellular aspartic proteinase [Rhizopus
            microsporus]
            Length = 388

  Minus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.021, P = 0.021
 Identities = 25/69 (36%), Positives = 37/69 (53%), Frame = -3

Query:   225 SNDNIELVDF-QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHL-YD 52
             S  ++ +VD   ++ +YG   VG          DTGS++LW  S  C+T  C   H  Y+
Sbjct:    66 STGSVPVVDVGSDLEYYGVVTVGTPGVQLKLDFDTGSSDLWFASTLCST--CSNSHTKYN 123

Query:    51 SSKSRTYEKDG 19
              +KS TY+ DG
Sbjct:   124 PNKSSTYKADG 134


>pdb|1MPP|  Pepsin (Renin) (E.C.3.4.23.23) >prf||1410211A Asp proteinase
            [Rhizomucor pusillus]
            Length = 361

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.041, P = 0.040
 Identities = 23/68 (33%), Positives = 34/68 (50%), Frame = -3

Query:   225 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA-GCLTKHLYDS 49
             S D   L DF    +     +G   Q F  + DTGS++ WVP   C  + GC+ K  +D 
Sbjct:     6 SVDTPGLYDFDLEEYAIPVSIGTPGQDFYLLFDTGSSDTWVPHKGCDNSEGCVGKRFFDP 65

Query:    48 SKSRTYEK 25
             S S T+++
Sbjct:    66 SSSSTFKE 73


>bbs|119595 rennin [Mucor pusillus, Peptide, 427 aa]
            Length = 427

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.053, P = 0.052
 Identities = 23/68 (33%), Positives = 34/68 (50%), Frame = -3

Query:   225 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA-GCLTKHLYDS 49
             S D   L DF    +     +G   Q F  + DTGS++ WVP   C  + GC+ K  +D 
Sbjct:    72 SVDTPGLYDFDLEEYAIPVSIGTPGQDFYLLFDTGSSDTWVPHKGCDNSEGCVGKRFFDP 131

Query:    48 SKSRTYEK 25
             S S T+++
Sbjct:   132 SSSSTFKE 139


>pir||A25767 mucorpepsin (EC 3.4.23.23) - Rhizomucor pusillus >gi|2957 (X06219)
            rennin (AA 1 - 427) [Mucor pusillus]
            Length = 427

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.053, P = 0.052
 Identities = 23/68 (33%), Positives = 34/68 (50%), Frame = -3

Query:   225 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA-GCLTKHLYDS 49
             S D   L DF    +     +G   Q F  + DTGS++ WVP   C  + GC+ K  +D 
Sbjct:    72 SVDTPGLYDFDLEEYAIPVSIGTPGQDFYLLFDTGSSDTWVPHKGCDNSEGCVGKRFFDP 131

Query:    48 SKSRTYEK 25
             S S T+++
Sbjct:   132 SSSSTFKE 139


>sp|P09177|CARP_RHIPU MUCOROPEPSIN PRECURSOR (MUCOR RENNIN)
            Length = 427

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.053, P = 0.052
 Identities = 23/68 (33%), Positives = 34/68 (50%), Frame = -3

Query:   225 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA-GCLTKHLYDS 49
             S D   L DF    +     +G   Q F  + DTGS++ WVP   C  + GC+ K  +D 
Sbjct:    72 SVDTPGLYDFDLEEYAIPVSIGTPGQDFYLLFDTGSSDTWVPHKGCDNSEGCVGKRFFDP 131

Query:    48 SKSRTYEK 25
             S S T+++
Sbjct:   132 SSSSTFKE 139


>sp|Q28755|PAG1_SHEEP PREGNANCY-ASSOCIATED GLYCOPROTEIN 1 PRECURSOR (PAG 1)
            >gi|398591 (M73961) pregnancy-associated glycoprotein 1 [Ovis sp.]
            Length = 382

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.098, P = 0.094
 Identities = 29/104 (27%), Positives = 53/104 (50%), Frame = -3

Query:   321 LKTIKTHKLKNYI--KESVN-FLNSGLTKTNYLGSSNDNIELVDFQNIM---FYGDAEVG 160
             L+ +KT  ++N +  K+ +N FL     + + +     N+ +   +NIM   + G+  +G
Sbjct:    21 LRRVKT--MRNTLSGKKMLNSFLKEHAYRLSQISFRASNLTIHPLRNIMDMLYVGNITIG 78

Query:   159 DNQQPFTFILDTGSANLWVPSVKC---TTAGCLTKHLYDSSKSRTY 31
                Q F  + DTGS++L VPS+ C   T   C  +  +   +S T+
Sbjct:    79 TPPQEFQVVFDTGSSDLLVPSINCLSPTKRPCSKQDKFKHHQSSTF 124


>pir||A41545 pregnancy-specific antigen precursor - sheep
            Length = 383

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.099, P = 0.094
 Identities = 29/104 (27%), Positives = 53/104 (50%), Frame = -3

Query:   321 LKTIKTHKLKNYI--KESVN-FLNSGLTKTNYLGSSNDNIELVDFQNIM---FYGDAEVG 160
             L+ +KT  ++N +  K+ +N FL     + + +     N+ +   +NIM   + G+  +G
Sbjct:    21 LRRVKT--MRNTLSGKKMLNSFLKEHAYRLSQISFRASNLTIHPLRNIMDMLYVGNITIG 78

Query:   159 DNQQPFTFILDTGSANLWVPSVKC---TTAGCLTKHLYDSSKSRTY 31
                Q F  + DTGS++L VPS+ C   T   C  +  +   +S T+
Sbjct:    79 TPPQEFQVVFDTGSSDLLVPSINCLSPTKRPCSKQDKFKHHQSSTF 124


>gi|466338 (L12449) secreted aspartyl proteinase 1 [Candida albicans]
           >gi|466342 (L12451) secreted aspartyl proteinase 1 [Candida
           albicans]
           Length = 391

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.10, P = 0.097
 Identities = 25/69 (36%), Positives = 36/69 (52%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVP--SVKCTTA--G-----CLTKHLYDSSK 43
             +++ +  D  +G N+Q F  I+DTGS++LWVP  SV C     G     C  K +Y    
Sbjct:    60 EHVSYAADITIGSNKQKFNVIVDTGSSDLWVPDASVTCDKPRPGQSADFCKGKGIYTPKS 119

Query:    42 SRTYEKDGT 16
             S T +  GT
Sbjct:   120 STTSQNLGT 128


>gi|466340 (L12450) secreted aspartyl proteinase 1 [Candida albicans]
           Length = 391

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.10, P = 0.097
 Identities = 25/69 (36%), Positives = 36/69 (52%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVP--SVKCTTA--G-----CLTKHLYDSSK 43
             +++ +  D  +G N+Q F  I+DTGS++LWVP  SV C     G     C  K +Y    
Sbjct:    60 EHVSYAADITIGSNKQKFNVIVDTGSSDLWVPDASVTCDKPRPGQSADFCKGKGIYTPKS 119

Query:    42 SRTYEKDGT 16
             S T +  GT
Sbjct:   120 STTSQNLGT 128


>gi|466344 (L12452) secreted aspartyl proteinase 1 [Candida albicans]
           Length = 391

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.10, P = 0.097
 Identities = 25/69 (36%), Positives = 36/69 (52%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVP--SVKCTTA--G-----CLTKHLYDSSK 43
             +++ +  D  +G N+Q F  I+DTGS++LWVP  SV C     G     C  K +Y    
Sbjct:    60 EHVSYAADITIGSNKQKFNVIVDTGSSDLWVPDASVTCDKPRPGQSADFCKGKGIYTPKS 119

Query:    42 SRTYEKDGT 16
             S T +  GT
Sbjct:   120 STTSQNLGT 128


>sp|P28872|CAR1_CANAL CANDIDAPEPSIN 1 PRECURSOR (ASPARTATE PROTEASE 1) (ACP 1)
            (SECRETED ASPARTIC PROTEASE 1)
            Length = 391

  Minus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.10, P = 0.097
 Identities = 25/69 (36%), Positives = 36/69 (52%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVP--SVKCTTA--G-----CLTKHLYDSSK 43
             +++ +  D  +G N+Q F  I+DTGS++LWVP  SV C     G     C  K +Y    
Sbjct:    60 EHVSYAADITIGSNKQKFNVIVDTGSSDLWVPDASVTCDKPRPGQSADFCKGKGIYTPKS 119

Query:    42 SRTYEKDGT 16
             S T +  GT
Sbjct:   120 STTSQNLGT 128


>pdb|2ASI|  Aspartic Proteinase Hydrolase, Aspartyl Protease, Glycoprotein,
            Zymogen, Signal Mol_id: 1; Molecule: Aspartic Proteinase; Chain:
            Null; Ec: 3.4.23.23
            Length = 360

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.15, P = 0.14
 Identities = 20/55 (36%), Positives = 30/55 (54%), Frame = -3

Query:   165 VGDNQQPFTFILDTGSANLWVPSVKCTTA-GCLTKHLYDSSKSRTYEKDGTKVEMN 1
             +G   Q F  + DTGS++ WVP   CT + GC+    +D S S T++   T   +N
Sbjct:    26 IGTPGQDFLLLFDTGSSDTWVPHKGCTKSEGCVGSRFFDPSASSTFK--ATNYNLN 79


>pdb|2RMP|A Rhizomucor miehei
            Length = 361

  Minus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.15, P = 0.14
 Identities = 20/55 (36%), Positives = 30/55 (54%), Frame = -3

Query:   165 VGDNQQPFTFILDTGSANLWVPSVKCTTA-GCLTKHLYDSSKSRTYEKDGTKVEMN 1
             +G   Q F  + DTGS++ WVP   CT + GC+    +D S S T++   T   +N
Sbjct:    26 IGTPGQDFLLLFDTGSSDTWVPHKGCTKSEGCVGSRFFDPSASSTFK--ATNYNLN 79


>pdb|1ZAP|  Secreted Aspartic Protease From C. Albicans Aspartic Protease,
            Secreted, Candida Albicans Mol_id: 1; Molecule: Secreted Aspartic
            Proteinase; Chain: Null; Synonym: Sap, Candida Albicans Protease,
            Cap; Ec: 3.4.23.24
            Length = 341

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.18, P = 0.16
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR-TYEKDG 19
             + + +  D  VG N Q    I+DTGS++LWVP V        +    D  K + TY+  G
Sbjct:    10 EQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNIDCQVTYSDQTADFCKQKGTYDPSG 69

Query:    18 TKVEMN 1
             +    +
Sbjct:    70 SSASQD 75


>bbs|176780 SAP2=major secreted aspartic proteinase [Candida albicans, 10261,
            Peptide, 342 aa]
            Length = 342

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.18, P = 0.16
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR-TYEKDG 19
             + + +  D  VG N Q    I+DTGS++LWVP V        +    D  K + TY+  G
Sbjct:    10 EQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSG 69

Query:    18 TKVEMN 1
             +    +
Sbjct:    70 SSASQD 75


>pdb|1EAG|A Secreted Aspartic Proteinase (Sap2) From Candida Albicans Complexed
            With A70450 Sap2, Candida Albicans, Hydrolase (Aspartic Protease)
            Mol_id: 1; Molecule: Aspartic Proteinase (Sap2 Gene Product);
            Chain: A; Synonym: Sap2, Candidape...
            Length = 342

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.18, P = 0.16
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR-TYEKDG 19
             + + +  D  VG N Q    I+DTGS++LWVP V        +    D  K + TY+  G
Sbjct:    10 EQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSG 69

Query:    18 TKVEMN 1
             +    +
Sbjct:    70 SSASQD 75


>sp|Q12303|YL12_YEAST PUTATIVE ASPARTYL PROTEASE YLR121C PRECURSOR >pir||S64958
            probable membrane protein YLR121c - yeast (Saccharomyces
            cerevisiae) >gi|1256862 (U53877) Ylr121cp [Saccharomyces
            cerevisiae] >gnl|PID|e198752 (X89514) putative orf [Saccharomyces
            cerevisiae] >gnl|PID|e245563 (Z73293) ORF YLR121c [Saccharomyces
            cerevisiae]
            Length = 508

  Minus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.19, P = 0.18
 Identities = 35/111 (31%), Positives = 58/111 (52%), Frame = -3

Query:   360 TIGFKVGNAHGRILKTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMF 181
             T+      A GR+L   K  K+  + K+  N  N  L+K +   + ++   L + Q+  F
Sbjct:    10 TLAVLTSPAFGRVLPDGKYVKIP-FTKKK-NGDNGELSKRS---NGHEKFVLANEQS--F 62

Query:   180 YG-DAEVGDNQQPFTFILDTGSANLWVP---SVKC-TTAGCLTKHLYDSSKSRTYE 28
             Y  +  +G   Q  T +LDTGSA+LWVP   +  C +   C    ++D +KS T++
Sbjct:    63 YSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKTKSSTFK 118


>gi|578113 (X62289) aspartic proteinase [Candida albicans]
           Length = 397

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.23, P = 0.20
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR-TYEKDG 19
             + + +  D  VG N Q    I+DTGS++LWVP V        +    D  K + TY+  G
Sbjct:    66 EQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSG 125

Query:    18 TKVEMN 1
             +    +
Sbjct:   126 SSASQD 131


>prf||2005365A Asp protease [Candida albicans]
            Length = 397

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.23, P = 0.20
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR-TYEKDG 19
             + + +  D  VG N Q    I+DTGS++LWVP V        +    D  K + TY+  G
Sbjct:    66 EQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSG 125

Query:    18 TKVEMN 1
             +    +
Sbjct:   126 SSASQD 131


>sp|P28871|CAR2_CANAL CANDIDAPEPSIN 2 PRECURSOR (ASPARTATE PROTEASE 2) (ACP 2)
            (SECRETED ASPARTIC PROTEASE 2) >pir||A45280 candidapepsin (EC
            3.4.23.24) precursor - yeast (Candida albicans) >gi|170841 (M83663)
            aspartyl proteinase [Candida albicans]
            Length = 398

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.23, P = 0.20
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR-TYEKDG 19
             + + +  D  VG N Q    I+DTGS++LWVP V        +    D  K + TY+  G
Sbjct:    66 EQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSG 125

Query:    18 TKVEMN 1
             +    +
Sbjct:   126 SSASQD 131


>prf||2124256A Asp protease:ISOTYPE=prepro=1-56 [Candida albicans]
            Length = 398

  Minus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.23, P = 0.20
 Identities = 20/66 (30%), Positives = 31/66 (46%), Frame = -3

Query:   195 QNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSR-TYEKDG 19
             + + +  D  VG N Q    I+DTGS++LWVP V        +    D  K + TY+  G
Sbjct:    66 EQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSG 125

Query:    18 TKVEMN 1
             +    +
Sbjct:   126 SSASQD 131


>pir||PN0134 pepsin (EC 3.4.23.-) 2 - horse (fragment)
            Length = 44

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.29, P = 0.25
 Identities = 14/38 (36%), Positives = 20/38 (52%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSV 94
             L ++ +  ++G   +G   Q FT I DT    LWVP V
Sbjct:     6 LENYMDEEYFGTIXIGTPAQEFTVIFDTXXXXLWVPXV 43


>gi|1515341 (U39852) coded for by C. elegans cDNA cm17b9;  Similar to aspartyl
            protease. [Caenorhabditis elegans]
            Length = 410

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.31, P = 0.27
 Identities = 19/58 (32%), Positives = 32/58 (55%), Frame = -3

Query:   183 FYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAG-CLTKHLYDSSKSRTYEKDGTK 13
             F  +  +G   Q FT ++DT +A++ +P + C TA  C  K  ++ +KS +Y   G K
Sbjct:    88 FVANLTMGTPGQLFTVVIDTSTADIVIPDMSCKTANNCYNKRRFNQAKSSSYYAYGNK 145


>sp|P43092|CAR3_CANAL CANDIDAPEPSIN 3 PRECURSOR (ASPARTATE PROTEASE 3) (ACP 3)
            (SECRETED ASPARTIC PROTEASE 3) >pir||A36926 aspartyl proteinase
            SAP3 (EC 3.4.23.-) precursor - yeast (Candida albicans) >gi|408091
            (L22358) secreted aspartyl proteinase 3 [Candida albicans]
            Length = 398

  Minus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.50, P = 0.39
 Identities = 18/43 (41%), Positives = 29/43 (67%), Frame = -3

Query:   213 IELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPS--VKC 88
             ++L++ Q + +  D  VG N+Q  T ++DTGS++LWVP   V C
Sbjct:    63 VKLINEQ-VSYASDITVGSNKQKLTVVIDTGSSDLWVPDSQVSC 105


>gi|578121 (X56867) microbial aspartic proteinases [Candida albicans]
           Length = 391

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.63, P = 0.47
 Identities = 24/67 (35%), Positives = 34/67 (50%), Frame = -3

Query:   189 IMFYGDAEVGDNQQPFTFILDTGSANLWVP--SVKCTTA--G-----CLTKHLYDSSKSR 37
             + +  D  +G N+Q F  I+DTGS++LWVP  SV C     G     C  K +Y    S 
Sbjct:    62 VSYAADITIGSNKQKFNVIVDTGSSDLWVPDASVTCDKPRPGQSADFCKGKGIYTPKSST 121

Query:    36 TYEKDGT 16
             T +  G+
Sbjct:   122 TSQNLGS 128


>gi|899394 (Z50046) unknown [Saccharomyces cerevisiae]
           Length = 196

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.66, P = 0.48
 Identities = 23/71 (32%), Positives = 39/71 (54%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNI-MFYG-DAEVGDNQQPFT 139
             +K +  K Y     N L+    +T  + + +D+ ELV+  N   FY  + ++G   Q  T
Sbjct:    37 VKMNFQKKYGSSFENALDDTKGRTRLM-TRDDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query:   138 FILDTGSANLWV 103
              ++DTGS++LWV
Sbjct:    96 VLVDTGSSDLWV 107


>gi|2055441 (U94793) pregnancy-associated glycoprotein 7 [Ovis aries]
            Length = 380

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.78, P = 0.54
 Identities = 25/100 (25%), Positives = 49/100 (49%), Frame = -3

Query:   327 RILKTI-KTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQ 151
             R LKT+ KT    N +   +      L + ++  S+   + L + ++I + G+  +G   
Sbjct:    22 RRLKTMRKTLSGNNMLNNVLKEYPYRLPQISFRDSNVTILPLRNMKDIFYVGNITIGTPP 81

Query:   150 QPFTFILDTGSANLWVPSVKCTTAGCLTKHLYDSSKSRTY 31
               F  + D+ S++LWVPS+   ++ C T   +   +S T+
Sbjct:    82 PEFQVVFDSTSSDLWVPSIFWNSSTCSTLVRFKHRQSSTF 121


>sp|P43093|CAR4_CANAL CANDIDAPEPSIN 4 PRECURSOR (ASPARTATE PROTEASE 4) (ACP 4)
            (SECRETED ASPARTIC PROTEASE 4) >pir||A55524 aspartic proteinase (EC
            3.4.-.-) secreted - yeast (Candida albicans) >gi|466346 (L25388)
            secreted aspartyl proteinase 4 [Candida albicans]
            Length = 417

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 1.2, P = 0.69
 Identities = 21/62 (33%), Positives = 32/62 (51%), Frame = -3

Query:   249 TKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCL 70
             T  N +G        +D + I +  D  +G N Q  + I+DTGS++LWVP    + A C+
Sbjct:    67 TGRNDVGKRGPVAVKLDNEIITYSADITIGSNNQKLSVIVDTGSSDLWVPD---SNAVCI 123

Query:    69 TK 64
              K
Sbjct:   124 PK 125


>pir||PN0137 pepsin (EC 3.4.23.-) 5 - horse (fragment)
            Length = 44

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 1.3, P = 0.73
 Identities = 14/42 (33%), Positives = 21/42 (50%), Frame = -3

Query:   219 DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSV 94
             D   L ++ +  ++G   +G   + FT I DTG   L VP V
Sbjct:     2 DTEPLENYMDEAYFGTIYIGTPAZZFTVIFDTGXXXLXVPXV 43


>sp|P43095|CAR6_CANAL CANDIDAPEPSIN 6 PRECURSOR (ASPARTATE PROTEASE 6) (ACP 6)
            (SECRETED ASPARTIC PROTEASE 6) >pir||S42073 aspartic proteinase -
            yeast (Candida albicans) >pir||S49057 aspartic proteinase SAP6 -
            yeast (Candida albicans) >gi|456252 (Z30192) aspartyl protease
            [Candida albicans]
            Length = 418

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.5, P = 0.78
 Identities = 19/47 (40%), Positives = 28/47 (59%), Frame = -3

Query:   204 VDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTK 64
             +D + I +  D  VG N Q  + I+DTGS++LW+P  K   A C+ K
Sbjct:    83 LDNEIITYSADITVGSNNQKLSVIVDTGSSDLWIPDSK---AICIPK 126


>sp|Q57745|Y297_METJA HYPOTHETICAL PROTEIN MJ0297 >pir||B64337 hypothetical
            protein MJ0297 - Methanococcus jannaschii >gi|1591019 (U67484) M.
            jannaschii predicted coding region MJ0297 [Methanococcus
            jannaschii]
            Length = 251

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 1.9, Sum P(2) = 0.85
 Identities = 23/84 (27%), Positives = 43/84 (51%), Frame = -3

Query:   594 ITVREHDFKHGFIKSNSTFDGLNIDNSKNK--KKIQEGFQILYV---LLFCSVMCGLFYY 430
             + ++  DFK GF+    TF G  +D SK K  ++ +  F I+ V   ++   +M   F  
Sbjct:   163 VLIQSKDFKKGFV--TGTFIGGELDKSKMKIVERAKMMFGIIEVDGAVIEIPLMAMNFTG 220

Query:   429 -VYENVWLQRDNEMNEILKNSEHLTI 355
              ++    ++ +  +N+I+K  E L I
Sbjct:   221 GIFRAKGVKNEEHLNKIIKTIEDLMI 246

 Score = 59 (20.8 bits), Expect = 1.9, Sum P(2) = 0.85
 Identities = 18/52 (34%), Positives = 27/52 (51%), Frame = -3

Query:   750 YVEWKRRIWYVNFNIKYKKEI*-FFYKLI*KV-YLFLYI*FFFKFLINILNQ 601
             Y++W   I +   N++  KEI     +L+ K  YL LY  FF K   +IL +
Sbjct:    38 YLDWASLIAFAKGNLQKIKEIEKILSELVEKTDYLSLYASFFIKITNSILKK 89


>gnl|PID|e243970 (Z72490) parasite pepsinogen [Haemonchus contortus]
            Length = 428

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 2.0, P = 0.87
 Identities = 16/40 (40%), Positives = 23/40 (57%), Frame = -3

Query:   207 LVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKC 88
             + D+Q+  +     +G   Q F  +LDTGSANLW+P   C
Sbjct:    64 IYDYQDTEYLAKITIGAPGQSFHVVLDTGSANLWIPDNIC 103


>gi|1513232 (U66366) ORFveg109 [Dictyostelium discoideum]
            Length = 239

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 2.9, P = 0.95
 Identities = 24/79 (30%), Positives = 41/79 (51%), Frame = -3

Query:   426 YENVWLQRDNEMNEILKNSEHLTIGFKVGNAHGRILKTIKTHKLKNYIKESVNFLNSGLT 247
             ++N+  Q     NE LK S++     K+  ++  ++K I + KLKN  +E  N+ N    
Sbjct:    90 FKNIPKQEIQRRNEFLKESKNEINNIKIKLSNEEVIKKINSDKLKN--QEFNNY-NKSNN 146

Query:   246 KTNYLGSSNDNIELVDFQN 190
              TNY+   N+ I+  +F N
Sbjct:   147 YTNYIKHQNE-IKDTEFLN 164


>gi|35952 (X00063) renin (aa 105 to 401); pid:e [Homo sapiens]
          Length = 300

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 3.4, P = 0.97
 Identities = 15/40 (37%), Positives = 27/40 (67%), Frame = -3

Query:   117 ANLWVPSVKCTT--AGCLTKHLYDSSKSRTYEKDGTKVEM 4
             +N+WVPS KC+     C+   L+D+S S +Y+ +GT++ +
Sbjct:     1 SNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTL 40


>sp|P53379|MKC7_YEAST ASPARTIC PROTEINASE MKC7 PRECURSOR >gi|1063606 (U14733)
            prepro-aspartyl protease [Saccharomyces cerevisiae]
            Length = 596

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 4.0, P = 0.98
 Identities = 23/71 (32%), Positives = 39/71 (54%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNI-MFYG-DAEVGDNQQPFT 139
             +K +  K Y     N L+    +T  + + +D+ ELV+  N   FY  + ++G   Q  T
Sbjct:    37 VKMNFQKKYGSSFENALDDTKGRTRLM-TRDDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query:   138 FILDTGSANLWV 103
              ++DTGS++LWV
Sbjct:    96 VLVDTGSSDLWV 107


>pir||S57971 MKC7 protein - yeast (Saccharomyces cerevisiae)
            Length = 596

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 4.0, P = 0.98
 Identities = 23/71 (32%), Positives = 39/71 (54%), Frame = -3

Query:   312 IKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIELVDFQNI-MFYG-DAEVGDNQQPFT 139
             +K +  K Y     N L+    +T  + + +D+ ELV+  N   FY  + ++G   Q  T
Sbjct:    37 VKMNFQKKYGSSFENALDDTKGRTRLM-TRDDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query:   138 FILDTGSANLWV 103
              ++DTGS++LWV
Sbjct:    96 VLVDTGSSDLWV 107


>sp|P43054|YGYB_MYCHO HYPOTHETICAL 25.5 KD PROTEIN IN GYRB 5'REGION (ORF219)
            >gi|453418 (X77529) orf219 gene product [Mycoplasma hominis]
            Length = 219

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 4.2, P = 0.98
 Identities = 31/108 (28%), Positives = 47/108 (43%), Frame = -3

Query:   528 NIDNSKNKKKIQEGFQILYVLLFCSVMCGLFYYVYENVWLQRDNEMNEILKNSEHLTIGF 349
             N+DNS  KK I  G +  + +LF  +  G+FY+VY     +   + NEI +N+  L    
Sbjct:    17 NVDNSI-KKPIPTGVEKFFFILFFILTIGIFYFVYVGRKNELMRDQNEI-QNASSL---I 71

Query:   348 KVGNAHGRILKTIKTHKLKNYIKESVNFLNSGLTKTNYLGSSNDNIEL 205
             +      R +       L  Y     NF N  L+K     S   NI++
Sbjct:    72 QAAEKRRRAVLIKMMDSLIGY----KNFENETLSKITQYRSKLSNIDV 115


>gnl|PID|e288229 (Z82092) ZK384.b [Caenorhabditis elegans]
            Length = 223

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 4.3, P = 0.99
 Identities = 17/46 (36%), Positives = 26/46 (56%), Frame = -3

Query:   132 LDTGSANLWVPSVKCTTAGC------LTKHLYDSSKSRTYEKDGTK 13
             +DT SANLWV    CT+  C      + KH ++++KS ++ K   K
Sbjct:     1 MDTTSANLWVMGSACTSVNCNDPLLGIIKHKFNTTKSTSFVKSNRK 46


>pir||PT0434 aspartic hemoglobinase - Plasmodium falciparum (fragment)
            Length = 22

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 4.6, P = 0.99
 Identities = 9/22 (40%), Positives = 17/22 (77%), Frame = -3

Query:   225 SNDNIELVDFQNIMFYGDAEVG 160
             + D++ L D  N+M+YG+A++G
Sbjct:     1 AGDSVTLNDVANVMYYGEAQIG 22


>gi|600040 (X02156) URF 1 [Saccharomyces cerevisiae]
           Length = 65

  Plus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 7.7, P = 1.0
 Identities = 18/47 (38%), Positives = 27/47 (57%), Frame = +3

Query:   633 KIIYIKINKLFILIYKKII--FLFYIL--Y*NLHTKFFFSILHISVKYFL 770
             K ++I+    ++ IY K +  F  YI   Y NL+  FFF  L +S+  FL
Sbjct:     3 KFVHIRA---YLFIYLKFLRPFNVYIFNEYLNLYISFFFFFLSLSLFLFL 49


>gi|2315320 (AF016435) Similar to aspartyl protease [Caenorhabditis elegans]
            Length = 383

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 8.1, P = 1.0
 Identities = 22/73 (30%), Positives = 36/73 (49%), Frame = -3

Query:   252 LTKTNYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGC 73
             L +   L + N++I   D  +  +     +G   Q F   LDT S+NLWV  V+C +  C
Sbjct:    41 LARLQQLSTGNESI--YDHFDEYYTVSVRIGTPAQHFEVALDTTSSNLWVFGVECKSQSC 98

Query:    72 -LTKHLYDSSKSRT 34
              + K++     +RT
Sbjct:    99 QVLKYIRIREYNRT 112


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62

  ctxfactor=6.00
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401
   +3      0   BLOSUM62        0.318   0.135   0.401    0.379   0.178   0.677
               q=9  r=2        0.244  0.0300   0.180
   +2      0   BLOSUM62        0.318   0.135   0.401    0.351   0.157   0.531
               q=9  r=2        0.244  0.0300   0.180
   +1      0   BLOSUM62        0.318   0.135   0.401    0.380   0.177   0.687
               q=9  r=2        0.244  0.0300   0.180
   -1      0   BLOSUM62        0.318   0.135   0.401    0.383   0.179   0.629
               q=9  r=2        0.244  0.0300   0.180
   -2      0   BLOSUM62        0.318   0.135   0.401    0.391   0.178   0.807
               q=9  r=2        0.244  0.0300   0.180
   -3      0   BLOSUM62        0.318   0.135   0.401    0.332   0.146   0.454
               q=9  r=2        0.244  0.0300   0.180

  Query
  Frame  MatID  Length  Eff.Length   E    S W   T  X     E2  S2
   +3      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   +2      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   +1      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   -1      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   -2      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39
   -3      0      263       263      10. 63 3  12 22   0.093 36
                                                  32    0.11 39


Statistics:

  Database:  ../_tempdbs/nrdb
    Title:  ../_tempdbs/nrdb
    Release date:  unknown
    Posted date:  1:59 PM EST Feb 4, 1998
    Format:  BLAST
  # of letters in database:  79,948,537
  # of sequences in database:  267,798
  # of database sequences satisfying E:  197
  No. of states in DFA:  594 (59 KB)
  Total size of DFA:  259 KB (320 KB)
  Time to generate neighborhood:  0.04u 0.00s 0.04t  Elapsed: 00:00:01
  No. of processors used:  6
  Search cpu time:  177.01u 0.64s 177.65t  Elapsed: 00:00:49
  Total cpu time:  177.19u 0.72s 177.91t  Elapsed: 00:00:50
  Start:  Fri Feb  6 18:30:57 1998   End:  Fri Feb  6 18:31:47 1998

Date: 16:29:4 on Sun 17 Dec 117.