blastx_gbnr_files/CShisMan2_386_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CShisMan2_386
        (721 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A sp|P16463|F801_SCHMA FEMALE SPECIFIC 800 PROTEIN (FS80... +2   153  5.7e-09   1
A pir||S27819          vitelline B1 precursor - liver fl... +2   113  0.0012    1
A sp|P07915|EGGS_FASHE PUTATIVE EGGSHELL PROTEIN PRECURS... +2   109  0.0014    1
A gnl|PID|d1025413     (D32205) 34kDa eggshell precursor... +2    73  0.25      1
A gi|972904            (U17295) Opa [Haemophilus influen... +2    61  0.998     1
A gi|2317711           (AF011564) splicing factor SRp55 ... +2    59  0.99995   1



>sp|P16463|F801_SCHMA FEMALE SPECIFIC 800 PROTEIN (FS800) >gi|160990 (J03999)
            female-specific 800 protein [Schistosoma mansoni]
            Length = 238

  Plus Strand HSPs:

 Score = 153 (53.9 bits), Expect = 5.7e-09, P = 5.7e-09
 Identities = 49/178 (27%), Positives = 81/178 (45%), Frame = +2

Query:    35 TEERN*SQRWIKNSVNQVVDKTRKSKELGTWTKADLDKDGLEASKMSGXSRSQYXHKKYG 214
             T   N    +   +V+   ++   +KE       D D +  E +K S   RS+Y    +G
Sbjct:    40 TYNNNNQGNYQSKNVHSESEQNSYNKETRNNNDDDDDDENFERNKKS--IRSRY----HG 93

Query:   215 HLKAKGKFRSRGLGRHGIVSSESTYYVIEGKFDRYGRKRPTNSKFKTRGKEKKYSKKIVD 394
             +     + +SRG    G   SESTY+ +    DRYGR R   S+F+TRG+   Y + +  
Sbjct:    94 YTYRNDQIQSRGNSAKGGSYSESTYFTLHSGTDRYGR-RNDYSRFQTRGRSNGYRENMFL 152

Query:   395 NQFDIQGGLIEERKYKRTGDYQANGTHAYIQVGAEHHASLNTRANNSESKHSQKNKQF 568
             N FD+ G +   R  ++    + NG   YI+   +H  + ++  N +E     K+  F
Sbjct:   153 NVFDVVGNIKTTRNKRKITKSEKNGR--YIK--KDHMNNRDSNTNINEKPEYSKSPVF 206


>pir||S27819 vitelline B1 precursor - liver fluke >pir||A48436 vitelline
            protein B1 - liver fluke >gi|159066 (M93024) vitelline protein B1
            [Fasciola hepatica]
            Length = 272

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.0012, P = 0.0012
 Identities = 28/100 (28%), Positives = 51/100 (51%), Frame = +2

Query:   170 MSGXSRSQYXHKKYGHLKAKGKFRSRGLGRHGIVSSESTYYVIEGKFDRYGRKRPTNSKF 349
             ++G S     +  YG++ AKG F++ G    G    E T +   G +D YG+K+  +  +
Sbjct:    88 LAGKSAHDGKYGMYGNMYAKGDFKAYGNEDEGAKFEEVTTFRRGGGYDSYGKKKSYDD-Y 146

Query:   350 KTRGKEKKYSKKIVDNQFDIQGGLIEERKYKRTGDYQANG 469
              T+G  KK++ K   ++FD+ G +  + +    G+  A G
Sbjct:   147 DTKGHLKKFANKGRQSKFDMYGNVKADGQAISNGNMNAYG 186


>sp|P07915|EGGS_FASHE PUTATIVE EGGSHELL PROTEIN PRECURSOR >gi|159054 (M15871)
            female genital complex protein precursor [Fasciola hepatica]
            Length = 197

  Plus Strand HSPs:

 Score = 109 (38.4 bits), Expect = 0.0014, P = 0.0014
 Identities = 27/98 (27%), Positives = 50/98 (51%), Frame = +2

Query:   170 MSGXSRSQYXHKKYGHLKAKGKFRSRGLGRHGIVSSESTYYVIEGKFDRYGRKRPTNSKF 349
             ++G S     +  YG++ AKG F++ G    G    E T +   G +D YG+K+  +  +
Sbjct:    86 LAGKSAHDGKYGMYGNMYAKGDFKAYGNEDEGAKFEEVTTFRRGGGYDSYGKKKSYDD-Y 144

Query:   350 KTRGKEKKYSKKIVDNQFDIQGGLIEERKYKRTGDYQA 463
              T+G  KK++ K   ++FD+ G +  + +    G+  A
Sbjct:   145 DTKGHLKKFANKGRQSKFDMYGNVKADGQAISNGNMNA 182


>gnl|PID|d1025413 (D32205) 34kDa eggshell precursor protein [Schistosoma
            japonicum]
            Length = 76

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.29, P = 0.25
 Identities = 20/71 (28%), Positives = 35/71 (49%), Frame = +2

Query:   248 GLGR--HGIVSSESTYYVIEGKFDRYGRKRPTNSKFKTRGKEKKYSKKIVDNQFDIQGGL 421
             G+G   +G+     T +   G +D YG+KR     + T+G  KKY  + +  +F++ G L
Sbjct:     1 GVGHQDYGVNYLSLTKFRKGGGYDIYGKKRQFLD-YDTQGHVKKYGNQHMRTKFEVVGNL 59

Query:   422 IEERKYKRTGDY 457
                  YK+   +
Sbjct:    60 NGYSTYKQKSSF 71


>gi|972904 (U17295) Opa [Haemophilus influenzae]
           Length = 83

  Plus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 6.0, P = 1.0
 Identities = 22/80 (27%), Positives = 37/80 (46%), Frame = +2

Query:   305 KFDRYGRKRPTNSKFK-TRGKEKKYSKKIVDNQFDIQGGLIEERKYKRTGDYQANGTHAY 481
             K   Y   R   ++FK T   E+K+      +   +  G++   KYK  G++ ANG   Y
Sbjct:     3 KVQPYVGARVATNQFKYTNRAEQKFKSS---SDIKLGYGVVAGAKYKLDGNWYANGGVEY 59

Query:   482 IQVGAEHHASLNTRANNSESK 544
              ++G       +T+ NN  +K
Sbjct:    60 NRLGNFD----STKVNNYGAK 76


>gi|2317711 (AF011564) splicing factor SRp55 homolog [Oryctolagus cuniculus]
            Length = 81

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 10., P = 1.0
 Identities = 22/74 (29%), Positives = 33/74 (44%), Frame = +2

Query:   164 SKMSGXSRSQYXHKKYGHLKA--KGKFRSRGLGRHGIVSSESTYYVIEGKFDRYGRKRPT 337
             S+ S  SRS+   K     ++  KG+ RSR  GR     S+S      G   R  R R  
Sbjct:     6 SRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSRSR-SRSRSK 64

Query:   338 NSKFKTRGKEKKYSK 382
             +   K+R + +  S+
Sbjct:    65 DEYEKSRSRSRSRSR 79


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.95
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.358   0.162   0.495  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.323   0.138   0.404  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.385   0.167   0.727  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.374   0.170   0.581  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.359   0.163   0.561  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.367   0.168   0.632  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      239       233       10.  75 3 1000 22  0.11    35
                                                     32  0.098   39
   +2      0      240       235       10.  75 3 1000 22  0.11    35
                                                     32  0.099   39
   +1      0      240       234       10.  75 3 1000 22  0.11    35
                                                     32  0.099   39
   -1      0      240       233       10.  75 3 1000 22  0.11    35
                                                     32  0.098   39
   -2      0      240       236       10.  75 3 1000 22  0.11    35
                                                     32  0.10    39
   -3      0      239       233       10.  75 3 1000 22  0.11    35
                                                     32  0.098   39


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  6
  No. of states in DFA:  405 (40 KB)
  Total size of DFA:  56 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  43.65u 1.18s 44.83t  Elapsed: 00:00:13
  Total cpu time:  43.70u 1.63s 45.33t  Elapsed: 00:00:13
  Start:  Fri Sep 25 23:29:38 1998   End:  Fri Sep 25 23:29:51 1998

Date: 17:10:32 on Mon 18 Dec 117.