blastx_gbnr_files/CcruzaQ_174_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CcruzaQ_174
        (636 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|e290647      (Y10371) histone H2A [Trypanosoma... -1   570  1.5e-54   1
A gi|603042            (X83272) histone H2A [Trypanosoma... -1   567  3.2e-54   1
A sp|P35066|H2A_TRYCR  HISTONE H2A >pir||S25119 histone ... -1   565  5.2e-54   1
A gnl|PID|e324188      (Y13985) Histone H2A [Trypanosoma... -1   562  1.1e-53   1
A gi|2138317           (U87597) histone H2A [Crithidia f... -1   465  2.0e-43   1
A sp|P27892|H2A2_LEIDO HISTONE H2A.2 >pir||S22391 histon... -1   438  1.5e-40   1
A sp|P27891|H2A1_LEIDO HISTONE H2A.1 >pir||S22303 histon... -1   434  3.9e-40   1
A sp|P40279|H2A_EUGGR  HISTONE H2A >pir||S46501 histone ... -1   303  3.0e-26   1
A sp|P04912|H2A2_YEAST HISTONE H2A.2 >pir||HSBYA2 histon... -1   294  2.7e-25   1
A sp|P16865|H2A3_VOLCA HISTONE H2A-III >pir||JQ0794 hist... -1   293  3.4e-25   1
A sp|P04911|H2A1_YEAST HISTONE H2A.1 >pir||HSBYA1 histon... -1   290  7.1e-25   1
A sp|P16866|H2A4_VOLCA HISTONE H2A-IV >pir||JQ0796 histo... -1   290  7.1e-25   1
A gi|171031            (M18455) histone H2A-1 [Saccharom... -1   290  7.1e-25   1
A sp|P02277|H2A3_WHEAT HISTONE H2A.2.2                      -1   290  7.1e-25   1
A gi|2104499           (U70133) replication-dependent hi... -1   290  7.1e-25   1
A sp|P25470|H2A1_PEA   HISTONE H2A >pir||JQ1183 histone ... -1   289  9.1e-25   1
A sp|P02276|H2A2_WHEAT HISTONE H2A.2.1 >pir||HSWT2A hist... -1   288  1.2e-24   1
A sp|P50567|H2A_CHLRE  HISTONE H2A >pir||S59126 histone ... -1   287  1.5e-24   1
A pir||S59590          histone H2A (clone CH-IV) - Chlam... -1   287  1.5e-24   1
A sp|P19177|H2A_PETCR  HISTONE H2A >pir||S11498 histone ... -1   287  1.5e-24   1
A sp|P25469|H2A_LYCES  HISTONE H2A >pir||JQ1182 histone ... -1   287  1.5e-24   1
A sp|P02263|H2A4_CHICK HISTONE H2A-IV >gi|63475 (X02218)... -1   286  1.9e-24   1
A pir||HSCH2A          histone H2A - chicken                -1   286  1.9e-24   1
A gi|1458140           (U62673) histone H2a(A)-613 [Mus ... -1   286  1.9e-24   1
A gi|1493827           (U38934) histone H2A [Gallus gallus] -1   286  1.9e-24   1
A sp|P06897|H2A1_XENLA HISTONE H2A.1 >pir||HSXLA1 histon... -1   285  2.4e-24   1
A gi|1870696           (U84114) cleavage stage histone H... -1   285  2.4e-24   1
A sp|P40280|H2A_MAIZE  HISTONE H2A >gi|473603 (U08225) h... -1   284  3.1e-24   1
A sp|P13912|H2A_CAIMO  HISTONE H2A >pir||I50457 histone ... -1   283  3.9e-24   1
A pir||I50657          histone H2A - chicken >gi|63448 (... -1   283  3.9e-24   1
A sp|P20670|H2A2_MOUSE HISTONE H2A.2 >pir||S06742 histon... -1   282  5.0e-24   1
A gi|63473             (X02218) H2A (aa 1-129) [Gallus g... -1   282  5.0e-24   1
A pir||S45110          histone H2A - mouse >gi|817939 (Z... -1   282  5.0e-24   1
A gnl|PID|e1308243     (AL030978) histone H2A- like prot... -1   282  5.0e-24   1
A sp|P35062|H2A3_CHICK HISTONE H2A-III >pir||JC1523 hist... -1   281  6.4e-24   1
A sp|P40281|H2A2_PEA   HISTONE H2A >pir||S60474 histone ... -1   280  8.2e-24   1
A sp|P04910|H2A2_SCHPO HISTONE H2A-BETA (H2A.2) >pir||HS... -1   280  8.2e-24   1
A gi|1458139           (U62673) histone H2a(B)-613 [Mus ... -1   280  8.2e-24   1
A sp|P40282|H2A_PLAFA  HISTONE H2A >pir||A45564 histone ... -1   279  1.0e-23   1
A sp|Q07135|H2AO_CHITH HISTONE H2A, ORPHON >pir||S40435 ... -1   279  1.0e-23   1
A pir||S53518          histone H2A - wheat >gnl|PID|d100... -1   279  1.0e-23   1
A sp|P02261|H2A1_HUMAN HISTONE H2A.1 >pir||HSHUA1 histon... -1   279  1.0e-23   1
A sp|P02262|H2A1_RAT   HISTONE H2A.1                        -1   279  1.0e-23   1
A pir||HSBO2A          histone H2A - bovine >gnl|PID|e12... -1   279  1.0e-23   1
A gi|1161302           (L75802) histone H2A [Triticum ae... -1   279  1.0e-23   1
A gnl|PID|e1285912     (AL021807) dJ86C11.1 [Homo sapiens]  -1   279  1.0e-23   1
A gnl|PID|e1285916     (AL021807) dJ86C11.5 [Homo sapiens]  -1   279  1.0e-23   1
A sp|P35061|H2A_ACRFO  HISTONE H2A >gi|166310 (L11067) h... -1   278  1.3e-23   1
A sp|P27325|H2A_URECA  HISTONE H2A >pir||S21849 histone ... -1   278  1.3e-23   1
A pir||S53519          histone H2A type 1 (clone wcH2A-9... -1   278  1.3e-23   1
A sp|P16104|H2AX_HUMAN HISTONE H2A.X >pir||S07631 histon... -1   278  1.3e-23   1
A sp|P02275|H2A1_WHEAT HISTONE H2A.1 >pir||HSWT91 histon... -1   278  1.3e-23   1
A sp|P02264|H2A_ONCMY  HISTONE H2A, GONADAL >gi|64325 (X... -1   278  1.3e-23   1
A pir||HSTR21          histone H2A, gonadal - rainbow trout -1   278  1.3e-23   1
A gnl|PID|e268230      (Z80778) histone H2A [Homo sapien... -1   278  1.3e-23   1
A sp|P04909|H2A1_SCHPO HISTONE H2A-ALPHA (H2A.1) >gi|173... -1   277  1.7e-23   1
A pir||HSZPA2          histone H2A.1 - fission yeast (Sc... -1   277  1.7e-23   1
A gnl|PID|e1300929     (AJ006959) histone H2A [Botryotin... -1   277  1.7e-23   1
A sp|P02267|H2A_DROME  HISTONE H2A >pir||S21938 histone ... -1   276  2.2e-23   1
A sp|P16886|H2AL_STRPU LATE HISTONE H2A.L3 >gi|10237 (X0... -1   276  2.2e-23   1
A sp|P27661|H2AX_MOUSE HISTONE H2A.X >pir||I48406 histon... -1   276  2.2e-23   1
A sp|P20671|H2A3_MOUSE HISTONE H2A.3 >pir||S06754 histon... -1   276  2.2e-23   1
A gnl|PID|e1181728     (Y15320) histone H2A [Aspergillus... -1   276  2.2e-23   1
A sp|P02265|H2A3_PSAMI LATE HISTONE H2A.3, GONADAL >gi|1... -1   275  2.8e-23   1
A sp|P21896|H2A_CHITH  HISTONE H2A >pir||S18004 histone ... -1   275  2.8e-23   1
A sp|P28001|H2A2_HUMAN HISTONE H2A.2 >pir||G40335 histon... -1   275  2.8e-23   1
A sp|P08844|H2A_EMENI  HISTONE H2A >pir||A27332 histone ... -1   275  2.8e-23   1
A sp|P22752|H2A1_MOUSE HISTONE H2A.1 >pir||JH0303 histon... -1   275  2.8e-23   1
A sp|P10812|H2A4_MOUSE HISTONE H2A.291.A >gi|51304 (X058... -1   275  2.8e-23   1
A pir||HSUR9P          histone H2A, gonadal - sea urchin... -1   275  2.8e-23   1
A gnl|PID|e286628      (Z83736) histone H2A [Homo sapiens]  -1   275  2.8e-23   1
A sp|P02271|H2A_STRPU  HISTONE H2A, EMBRYONIC >pir||HSUR... -1   273  4.5e-23   1
A pir||HSRT2A          histone H2A - rat >gi|56347 (X599... -1   273  4.5e-23   1
A pir||S53520          protein H2A - wheat >gnl|PID|d100... -1   273  4.5e-23   1
A sp|P02268|H2A_SEPOF  HISTONE H2A >pir||HSOO2 histone H... -1   273  4.5e-23   1
A sp|P13630|H2A_PARLI  HISTONE H2A >pir||HSURH2 histone ... -1   272  5.8e-23   1
A sp|P07793|H2A4_PSAMI LATE HISTONE H2A.2.2 >gi|161353 (... -1   272  5.8e-23   1
A pir||S53521          histone H2A type 2 (clone wcH2A-4... -1   271  7.4e-23   1
A pir||HSXLA2          histone H2A.2 - African clawed frog  -1   271  7.4e-23   1
A sp|P02270|H2A_SIPNU  HISTONE H2A >pir||HSIN21 histone ... -1   271  7.4e-23   1
A pir||HSUR9M          histone H2A, gonadal - sea urchin... -1   271  7.4e-23   1
A gnl|PID|d1019976     (AB001052) histone H2A-like prote... -1   271  7.4e-23   1
A sp|P02269|H2A_ASTRU  HISTONE H2A >pir||HSSF2 histone H... -1   270  9.4e-23   1
A gnl|PID|e217760      (X94693) histone H2A [Triticum ae... -1   270  9.4e-23   1
A sp|P04908|H2A5_HUMAN HISTONE H2A.5 >gi|32111 (X00089) ... -1   269  1.2e-22   1
A sp|Q00728|H2AT_RAT   HISTONE H2A, TESTIS >pir||S26188 ... -1   269  1.2e-22   1
A gi|2072004           (U95113) Histone H2a [Rattus norv... -1   269  1.2e-22   1
A sp|P35063|H2A_PICAB  HISTONE H2A >pir||S30155 histone ... -1   268  1.5e-22   1
A sp|Q02874|H2AM_RAT   HISTONE MACRO-H2A.1 >pir||I80811 ... -1   268  1.5e-22   1
A gi|1711126           (U79139) histone macroH2A1.2 [Rat... -1   268  1.5e-22   1
A gi|3341992           (AF054174) histone macroH2A1.2 [H... -1   268  1.5e-22   1
A gi|3395778           (AF058444) truncated histone macr... -1   268  1.5e-22   1
A gi|3395780           (AF058445) histone macroH2A1.1 [G... -1   268  1.5e-22   1
A gi|3395782           (AF058446) histone macroH2A1.2 [G... -1   268  1.5e-22   1
A sp|P04736|H2A2_PSAMI LATE HISTONE H2A.2.1 >pir||A25077... -1   267  2.0e-22   1
A gi|161362            (M11085) histone H2A-2 [Psammechi... -1   267  2.0e-22   1
A pir||HSHUA5          histone H2A.5 - human                -1   267  2.0e-22   1
A sp|P19178|H2A_PLADU  HISTONE H2A >pir||S11314 histone ... -1   266  2.5e-22   1
A gnl|PID|e348142      (Z70750) C50F4.13 [Caenorhabditis... -1   266  2.5e-22   1
A gi|2317760           (AF013803) H2A homolog [Pinus taeda] -1   266  2.5e-22   1
A sp|P04735|H2A1_PSAMI LATE HISTONE H2A.1 >gi|161360 (M1... -1   265  3.2e-22   1
A sp|P09588|H2A_CAEEL  HISTONE H2A >pir||HSKW2A histone ... -1   265  3.2e-22   1
A sp|P09589|H2A3_LYTPI HISTONE H2A, SPERM >pir||HSURA2 h... -1   264  4.1e-22   1
A gnl|PID|e1297163     (AJ006768) histone H2A [Cicer ari... -1   263  5.2e-22   1
A sp|P02273|H2A1_TETPY HISTONE H2A.1 >pir||HSTE91 histon... -1   262  6.6e-22   1
A sp|P35064|H2A1_TETTH HISTONE H2A.1 >pir||S41471 histon... -1   261  8.4e-22   1
A gi|1922944           (AC000106) Strong similarity to P... -1   260  1.1e-21   1
A sp|P35065|H2A2_TETTH HISTONE H2A.2 >pir||S41472 histon... -1   258  1.8e-21   1
A sp|P02274|H2A2_TETPY HISTONE H2A.2 >pir||HSTE92 histon... -1   258  1.8e-21   1
A sp|P06898|H2A2_XENLA HISTONE H2A.2 >pir||I51445 histon... -1   256  2.9e-21   1
A gi|2564109           (AF007904) histone H2A [Chaetopte... -1   255  3.7e-21   1
A sp|Q12692|H2AV_YEAST PROBABLE HISTONE H2A VARIANT >pir... -1   250  1.2e-20   1
A bbs|155301           histone H2A homolog [Phaseolus vu... -1   248  2.0e-20   1
A gi|578566            (X06725) hv1 histone (AA 8-145) [... -1   247  2.6e-20   1
A sp|P08992|H2AV_TETTH HISTONE H2A VARIANT >pir||S08210 ... -1   247  2.6e-20   1
A gnl|PID|e285265      (Y09951) histone H2a [Anopheles g... -1   247  2.6e-20   1
A sp|P08991|H2AV_STRPU HISTONE H2A VARIANT >pir||S07392 ... -1   238  2.3e-19   1
A sp|P48003|H2AV_SCHPO HISTONE H2A VARIANT >pir||S52560 ... -1   234  6.1e-19   1
A gi|1397320           (U61953) Similar to histone H2A v... -1   233  7.8e-19   1
A gnl|PID|e268229      (Z80777) none [Homo sapiens]         -1   233  7.8e-19   1
A pir||S04565          histone H2A - chicken (fragment) ... -1   232  1.0e-18   1
A sp|P08985|H2AV_DROME HISTONE H2A VARIANT >pir||S08118 ... -1   229  2.1e-18   1
A sp|P02272|H2AV_CHICK HISTONE H2A VARIANT >pir||S03282 ... -1   228  2.7e-18   1
A pir||HSCH2F          histone H2A.F, embryonic - chicken   -1   228  2.7e-18   1
A gi|1228074           (X95763) histone h2a homologue [A... -1   226  4.3e-18   1
A gnl|PID|e276299      (X98536) variant histone H2A.Zl2 ... -1   226  4.3e-18   1
A gnl|PID|e332393      (Y12575) histone H2A.F/Z [Arabido... -1   226  4.3e-18   1
A sp|P17317|H2AZ_HUMAN HISTONE H2A.Z >pir||S03642 histon... -1   225  5.5e-18   1
A gi|971976            (F14542) histone H2B and H2A [Sus... -1   225  5.5e-18   1
A gi|3108211           (AF030235) histone H2A.F/Z varian... -1   219  2.4e-17   1
A pir||S19241          histone H2A (clone CH1-10) - chic... -1   218  3.0e-17   1
A sp|P09590|H2A3_STRPU HISTONE H2A-BETA, SPERM >pir||HSU... -1   215  6.3e-17   1
A gnl|PID|e214013      (Z68222) ZK1251.1 [Caenorhabditis... -1   208  3.5e-16   1
A gi|940450            (Z28692) HISTONE H2A VARIANT [Ara... -1   189  3.6e-14   1
A gi|578471            (V01144) reading frame H2A (6700 ... -1   172  2.3e-12   1
A gi|157616            (M32467) histone (H2A) homologue;... -1   164  1.6e-11   1
A gnl|PID|e280521      (Y09115) Histone H2A [Trypanosoma... -1   163  2.0e-11   1
A pir||I50651          histone H2A - chicken (fragment) ... -1   162  2.6e-11   1
A gnl|PID|e1173147     (X14215) H2A histone [Drosophila ... -1   159  5.4e-11   1
A sp|P98176|H2AL_HUMAN HYPOTHETICAL 12.7 KD HISTONE H2A ... -1   156  1.1e-10   1
A pir||I37466          histone H2A - human (fragment) >g... -1   138  9.1e-09   1
A gnl|PID|e1173152     (X14215) H2A histone [Drosophila ... -1   117  2.2e-06   1
A pir||I79341          histone H2A - human (fragment) >g... -1   112  8.6e-06   1
A gi|63445             (X13894) histone H2A.F [Gallus ga... -1   117  4.6e-05   1
A gi|2738577           (AF014643) connexin46.6 [Homo sap... +3   115  0.0010    1
A sp|P03181|YHL1_EBV   HYPOTHETICAL BHLF1 PROTEIN >pir||... +3   114  0.0024    1
A gi|1947160           (AF000298) weak similarity to col... +3   111  0.0042    1
A pir||A61183          hypothetical protein (sdsB region... +3    97  0.0051    2
A gi|3044086           (AF055904) unknown [Myxococcus xa... +3   110  0.0055    1
A gi|3386544           (AF079528) IER5 [Mus musculus] >g... +3   104  0.012     1
A gi|2854193           (AF045645) Similar to cuticular c... +3   104  0.012     1
A gnl|PID|e1188396     (Z81138) W05B2.e [Caenorhabditis ... -3   102  0.020     1
A gnl|PID|e1188397     (Z81138) W05B2.f [Caenorhabditis ... -3   102  0.020     1
A gi|2429362           (AF020261) proline rich protein [... +3   102  0.022     1
A gnl|PID|e1188395     (Z81138) W05B2.d [Caenorhabditis ... -3   102  0.022     1
A gi|2804500           (AF043706) contains similarity to... +3   106  0.025     1
A bbs|119684           histone b {internal fragment} [Tr... -1    81  0.029     1
A sp|P23246|PSF_HUMAN  PTB-ASSOCIATED SPLICING FACTOR (P... +3   105  0.030     1
A gi|2769728           (U92288) HN1 [Human herpesvirus 6]   +3    99  0.037     1
A sp|P55897|H2A_BUFBG  HISTONE H2A (CONTAINS: BUFORINS I... -1    80  0.037     1
A sp|P33479|IE18_PRVKA IMMEDIATE-EARLY PROTEIN IE180 >pi... +3   106  0.052     1
A gi|2961610           (AF051526) class A calcium channe... +3   103  0.058     1
A gnl|PID|e257866      (Z78064) F57B1.3 [Caenorhabditis ... +3    98  0.060     1
A gnl|PID|e236205      (Z70756) T06E4.6 [Caenorhabditis ... +3    97  0.068     1
A pir||D34768          ORF4 protein - Orf virus (strain ... +3    96  0.073     1
A gi|404807            (L13855) UL3.5 [Pseudorabies virus]  +3    94  0.085     1
A pir||G60110          repetitive protein antigen 69/70 ... +3    76  0.098     1
A sp|P20630|CC12_CAEEL CUTICLE COLLAGEN 12 PRECURSOR >pi... +3    96  0.10      1
A sp|P20631|CC13_CAEEL CUTICLE COLLAGEN 13 PRECURSOR >pi... +3    96  0.10      1
A gi|868024            (L41919) HIC-1 gene product [Homo... +3    99  0.10      1
A prf||2113367A        HIC-1 gene [Homo sapiens]            +3    99  0.10      1
A pir||A45195          adenylylcyclase type V-alpha - do... +3    99  0.11      1
A gnl|PID|e236201      (Z70756) T06E4.4 [Caenorhabditis ... +3    95  0.11      1
A pir||EDBEIF          immediate-early protein IE180 - s... +3   101  0.12      2
A sp|P05997|CA25_HUMAN PROCOLLAGEN ALPHA 2(V) CHAIN PREC... -3   103  0.12      1
A gnl|PID|e257912      (Z78064) F57B1.4 [Caenorhabditis ... +3    96  0.12      1
A sp|P33485|VNUA_PRVKA PROBABLE NUCLEAR ANTIGEN >pir||B4... +3   103  0.14      1
A pir||S14085          protamine - common cuttlefish        -2    49  0.14      2
A sp|P20186|YT35_STRFR HYPOTHETICAL 35.5 KD PROTEIN IN T... +3    95  0.15      1
A pir||B40505          hypothetical protein - suid herpe... +3   103  0.15      1
A gi|903938            (U28835) similar to human GATA-4 ... +3    91  0.15      1
A gnl|PID|e1297929     (Z82268) F52B11.d [Caenorhabditis... -3    94  0.16      1
A gi|3002799           (AF036343) 2-aminomuconic acid se... +3    97  0.17      1
A sp|P35311|HSP1_TACAC SPERM PROTAMINE P1 >pir||S39424 p... -2    61  0.17      2
A sp|P11675|IE18_PRVIF IMMEDIATE-EARLY PROTEIN IE180 >gi... +3   101  0.19      1
A gi|3047415           (AF058717) cysteine protease [Vol... +3    96  0.19      2
A gi|310622            (L20249) homologous to Saccharopo... +3    96  0.20      1
A sp||CA11_RAT_1       [Segment 1 of 2] COLLAGEN ALPHA 1... +3    92  0.23      2
A sp|P30803|CYA5_CANFA ADENYLATE CYCLASE, TYPE V (ATP PY... +3    99  0.24      1
A sp|P52949|HXA5_RAT   HOMEOBOX PROTEIN HOX-A5 (HOX-1.3)... +3    90  0.27      1
A gnl|PID|e256050      (X98534) vasodilator-stimulated p... +3    93  0.27      1
A gi|1304439           (U27488) glycoprotein gX [Suid he... +3    74  0.29      1
A gi|18992             (X56260) lichenase [Hordeum vulgare] -3    92  0.29      1
A sp|P10569|MYSC_ACACA MYOSIN IC HEAVY CHAIN >pir||MWAXI... +3    98  0.30      1
A gi|2961227           (AF051353) myosin IC heavy chain ... +3    98  0.30      1
A gnl|PID|e214000      (Z68219) T05A1.2 [Caenorhabditis ... +3    91  0.31      1
A pir||CGRT1S          collagen alpha 1(I) chain - rat (... +3    92  0.33      2
A sp|P26645|MACS_MOUSE MYRISTOYLATED ALANINE-RICH C-KINA... -3    91  0.33      1
A prf||2113331A        ORF 1 [Streptomyces lavendulae]      +3    85  0.33      1
A gi|1814029           (U84501) cuticle collagen [Caenor... +3    91  0.33      1
A sp|P09021|HXA5_MOUSE HOMEOBOX PROTEIN HOX-A5 (HOX-1.3)... +3    90  0.34      1
A bbs|132270           (S61739) omb biD4=optomotor-blind... +3    91  0.35      1
A pir||S55392          msh potein - fruit fly (Drosophil... +3    86  0.35      2
A pir||S08491          hypothetical protein - golden ham... +3    90  0.36      1
A pir||S50754          hypothetical protein WP6 - Chlamy... +3    91  0.38      1
A gi|552357            (L17501) [Mirounga leonina histon... -1    70  0.39      1
A gi|2822172           (AC004080) HXA5_HUMAN HOMEOBOX PR... +3    89  0.41      1
A pir||D29149          proline-rich protein - mouse (fra... +3    86  0.43      1
A pir||B44984          collagen - nematode (Haemonchus c... +3    87  0.43      1
A gnl|PID|e303012      (Y08140) helix-loop-helix protein... +3    77  0.43      1
A sp|P06487|VGLI_HSV11 GLYCOPROTEIN I >pir||QQBE77 glyco... +3    91  0.43      1
A prf||0910139A        collagen alpha1(I)CN8 [Bos taurus]   +3    89  0.43      1
A bbs|132291           (S61744) omb omb3198=optomotor-bl... +3    91  0.44      1
A gi|1658503           (U75467) Atu [Drosophila melanoga... +3    94  0.44      1
A gi|3165522           (AF067607) Similar to cuticular c... +3    87  0.46      2
A gi|16864             (Z17688) histone H2A [Arabidopsis... -1    69  0.47      1
A pir||PN0081          sperm chromatin protein I2-1 - Ar... -2    44  0.48      2
A gi|2564955           (AF030001) unknown [Mus musculus]    +3    89  0.48      1
A bbs|132259           (S61732) omb=optomotor-blind gene... +3    91  0.50      1
A pir||S34827          omb protein - fruit fly (Drosophi... +3    91  0.51      1
A sp|O00268|T2D3_HUMAN TRANSCRIPTION INITIATION FACTOR T... +3    95  0.51      1
A sp|P31271|HXAD_HUMAN HOMEOTIC PROTEIN HOX-A13 (HOX-1J)... +3    90  0.52      1
A gnl|PID|e249086      (Z74037) F57B7.3 [Caenorhabditis ... +3    88  0.56      1
A gi|1103869           (U39815) surface coat glycoprotei... +3    84  0.56      1
A pir||S14086          protamine - common cuttlefish        -2    45  0.56      2
A prf||2208307A        PNG gene [Homo sapiens]              +3    85  0.57      1
A gi|30016             (X07884) preprocollagen (AA -22 t... +3    86  0.57      2
A gi|294759            (L04667) resolvase [Plasmid RP4]     -3    63  0.57      2
A pir||I57561          GATA-4 - human >gnl|PID|d1011996 ... +3    90  0.59      1
A gi|2338034           (AF005370) putative immediate ear... -3    95  0.59      1
A gi|1491961           (U60315) MC018L [Molluscum contag... +3    92  0.60      1
A gi|2145052           (AF000412) merozoite surface prot... +3    81  0.62      1
A gi|1054708           (Z67738) W03G11.1 [Caenorhabditis... +3    87  0.62      1
A gi|2559000           (AF025995) hypothetical 21 kDa pr... +3    84  0.63      1
A pir||S29309          hypothetical protein 4 (phaC2 3' ... +3    85  0.64      1
A bbs|175868           buforin II=antimicrobial peptide ... -1    67  0.65      1
A gnl|PID|e229796      (X96713) collagen [Globodera pall... -3    87  0.67      1
A gi|3425850           (U13220) forkhead protein FREAC-2... +3    89  0.69      1
A sp|P20719|HXA5_HUMAN HOMEOBOX PROTEIN HOX-A5 (HOX-1C) ... +3    86  0.70      1
A gi|2384940           (AF022985) Similar to collagen; c... +3    87  0.70      1
A gi|1020231           (U31786) putative [Human papillom... +3    84  0.71      1
A pir||CGBO1S          collagen alpha 1(I) chain - bovin... +3    89  0.71      2
A pir||S50755          hypothetical protein VSP-3 - Chla... +3    89  0.72      1
A sp|P16252|CAC2_HAECO CUTICLE COLLAGEN 2C >gi|159167 (J... +3    84  0.72      1
A sp|P11087|CA11_MOUSE PROCOLLAGEN ALPHA 1(I) CHAIN PREC... +3    94  0.72      1
A gi|938175            (X65122) alpha1 (XIV) collagen [G... +3    83  0.72      1
A gi|1698773           (U70040) ICP0D [Human herpesvirus 1] -3    66  0.74      1
A pir||JQ0405          hypothetical 119.5K protein (uvrA... +3    88  0.75      2
A pir||S41171          transrepressor protein BICP22 - b... +3    86  0.76      1
gi|725487            (U07008) merozoite surface antige... +3    83  0.76      1
gi|2183261           (AF002133) MAV264 [Mycobacterium ... +3    85  0.78      1
pir||JQ0964          hydroxyproline-rich glycoprotein ... +3    83  0.78      1
bbs|175469           (S80916) parotid "o" protein, Po=... +3    84  0.79      1
gnl|PID|e339884      (Z98980) actin associated protein... +3    89  0.80      1
gi|2708709           (AF038575) Wiskott-Aldrich Syndro... +3    89  0.80      1
gnl|PID|e1251319     (Z78279) Collagen alpha1 [Rattus ... +3    93  0.81      1
gnl|PID|d1025045     (D88440) high molecular mass nucl... +3    92  0.81      1
sp|P11910|H82_NEIGO  OUTER MEMBRANE PROTEIN H.8 PRECUR... +3    65  0.82      1
pir||S47648          nitic oxide synthase - bovine        +3    65  0.82      1
sp||CA11_RAT_2       [Segment 2 of 2] COLLAGEN ALPHA 1... +3    72  0.82      1
gi|192262            (M14423) pro-alpha-1 type I colla... +3    89  0.83      1
bbs|115631           (S46244) thyroid peroxidase, TPO ... +3    79  0.83      1
pir||S05455          histone H2A - brine shrimp (fragm... -1    65  0.83      1
gnl|PID|e1309794     (Y15918) COL1A1 and PDGFB fusion ... +3    81  0.83      1
sp|Q24432|OMB_DROME  OPTOMOTOR-BLIND PROTEIN (LETHAL(1... +3    91  0.84      1
sp||CA11_BOVIN_2     [Segment 2 of 2] COLLAGEN ALPHA 1... +3    89  0.84      1
gnl|PID|e258522      (Z78205) UL31 [Bovine herpesvirus... +3    86  0.85      1
pir||CGCH1S          collagen alpha 1(I) chain - chick... +3    91  0.86      1
gnl|PID|d1020843     (D88685) tegument protein [Equine... +3    86  0.86      2
bbs|113222           (S44199) class IV zygote specific... +3    82  0.86      1
pir||KRGT3M          keratin high-sulfur matrix protei... -2    77  0.87      1
pir||C47301          VirB6 homolog - Bordetella pertussis +3    87  0.88      1
sp|P10162|PRPL_HUMAN SALIVARY PROLINE-RICH PROTEIN PO ... +3    84  0.88      1
gi|188874            (M22405) intestinal mucin [Homo s... +3    84  0.88      1
gi|487348            (U07000) unknown [Homo sapiens]      -3    84  0.89      1
gi|487853            (L29457) dynamin [Mus musculus]      +3    83  0.89      1
sp|P29173|TAU3_BOVIN MICROTUBULE-ASSOCIATED PROTEIN TA... +3    86  0.89      1
gi|553239            (L33986) ORF; putative [Homo sapi... +3    64  0.89      1
prf||2019345A        ORF in CpG-enriched DNA [Homo sap... +3    64  0.89      1
gi|307352            (L21695) prothymosin alpha [Homo ... -3    64  0.90      1
gi|808666            (M12553) unknown protein [Human h... -3    64  0.90      1
gi|1280072           (U55366) coded for by C. elegans ... +3    79  0.90      1
sp|P18769|FRZE_MYXXA GLIDING MOTILITY REGULATORY PROTE... +3    89  0.90      1
gnl|PID|d1020637     (AB003336) Y box protein 2 [Caras... +3    84  0.91      1
gi|1492084           (U60315) MC141R [Molluscum contag... +3    85  0.92      1
pir||A32068          circumsporozoite protein - Plasmo... -3    85  0.92      1
pir||S19932          glycine-rich protein atGRP-6 - Ar... -3    82  0.92      1
pir||PIHUSD          salivary proline-rich glycoprotei... +3    84  0.92      1
gnl|PID|e1313505     (AL031155) hypothetical protein S... +3    91  0.93      1
gi|1052996           (U38544) alpha-1 type 1 collagen ... +3    66  0.93      1
gi|330915            (M76726) IR4 protein [Equine herp... +3    86  0.94      1
sp|P08393|ICP0_HSV11 TRANS-ACTING TRANSCRIPTIONAL PROT... +3    78  0.94      2
sp|P02457|CA11_CHICK PROCOLLAGEN ALPHA 1(I) CHAIN PREC... +3    91  0.94      1
gnl|PID|e1202340     (AL009204) hypothetical protein S... +3    90  0.94      2
sp|Q03381|REGB_PSEAE REGB PROTEIN >pir||S11797 regB pr... +3    63  0.94      1
pir||C38355          basic proline-rich peptide II-2 -... +3    63  0.94      1
pir||I59116          myc protein - human >gi|188975 (M... +3    80  0.95      1
gi|1575467           (U63019) beta 1,4 galactosyltrans... +3    75  0.95      1
gi|746533            (U23520) similar to cuticular col... +3    83  0.95      1
gi|451544            (U04267) proline-rich cell wall p... +3    81  0.95      1
gi|435039            (L17308) proline-rich cell wall p... +3    81  0.95      1
sp|Q06002|FILS_BOVIN FILENSIN >pir||S32103 filensin - ... -3    88  0.95      1
gnl|PID|e1218046     (X72388) filensin [Bos taurus]       -3    88  0.95      1
gi|1109782           (U27193) protein-tyrosine phospha... +3    87  0.95      1
gi|807646            (M17294) unknown protein [Human h... +3    83  0.96      1
gi|3005587           (AF048977) Ser/Arg-related nuclea... +3    88  0.96      1
sp|Q63003|5E5_RAT    5E5 ANTIGEN >pir||JC4163 DNA-bind... +3    88  0.96      1
sp|Q15651|TRI7_HUMAN THYROID RECEPTOR INTERACTING PROT... +3    74  0.96      1
pir||I49558          gene alpha-1 type I procollagen p... +3    80  0.96      1
sp|O05543|YOR3_GLUSU HYPOTHETICAL PROTEIN IN ADHS 5'RE... +3    85  0.96      1
pir||PQ0452          extensin-like protein - Persian t... +3    62  0.96      2
gnl|PID|e1312918     (AL031124) hypothetical protein S... -3    90  0.97      1
pir||I50623          collagen alpha 2(I) chain - chick... +3    85  0.97      1
gi|3378120           (AF065164) hyperpolarization-acti... +3    88  0.97      2
sp|P13290|VGLG_HSV2H GLYCOPROTEIN G >pir||C43674 US4 p... +3    87  0.97      1
gi|296594            (X68600) pZE40 gene product [Hord... +3    75  0.97      1
gnl|PID|e284772      (Z83227) F45B8.3 [Caenorhabditis ... +3    80  0.98      1
sp|P14328|SP96_DICDI SPORE COAT PROTEIN SP96 >pir||S07... +3    86  0.98      1
gnl|PID|d1007805     (D38024) ORF [Homo sapiens]          -3    89  0.98      2
gi|1732073           (U75308) TBP-associated factor [H... +3    88  0.98      1
pir||A60643          antigen 5401 - Eimeria tenella (f... -3    82  0.98      1
sp|Q12962|T2D8_HUMAN TRANSCRIPTION INITIATION FACTOR T... +3    80  0.98      1
gi|472802            (L26917) putative [Hordeum bulbosum] +3    66  0.98      1
pir||A57694          transcription factor IID 30k chai... +3    80  0.98      1
gi|1220469           (L13688) kfrA gene product [Plasm... +3    83  0.98      1
pir||A36128          regulatory protein algP - Pseudom... +3    83  0.98      1
sp|Q00650|I3MS_BRANA MICROSPORE-SPECIFIC PROTEIN I3 >p... +3    77  0.98      1
gnl|PID|e266925      (Z80233) hypothetical protein Rv0... +3    82  0.99      1
gi|1196514           (M15467) unknown protein [Mycobac... +3    76  0.99      1
sp|O19084|CDSN_PIG   CORNEODESMOSIN (S PROTEIN) >gnl|P... +3    80  0.99      1
gi|296670            (X07882) Po protein [Homo sapiens]   +3    80  0.99      1
gi|2291006           (AF006011) dishevelled 1 [Homo sa... +3    86  0.99      1
gi|8492              (X13625) put. ribosomal protein S... +3    72  0.99      1
sp|P40552|YIB1_YEAST HYPOTHETICAL 26.3 KD PROTEIN IN P... +3    81  0.99      1
pir||S23809          collagen alpha 2(I) chain homolog... +3    88  0.990     2
sp|Q09455|YQ34_CAEEL PUTATIVE CUTICLE COLLAGEN C09G5.4... +3    82  0.990     1
gi|2822166           (AC004080) transcription factor H... +3    83  0.991     1
sp|P02458|CA12_HUMAN PROCOLLAGEN ALPHA 1(II) CHAIN PRE... -3    89  0.991     1
gi|211607            (M25984) alpha-2 type I collagen ... +3    87  0.991     1
gnl|PID|e286581      (Y08913) s18 chorion protein [Cer... +3    82  0.992     1
gi|1575466           (U63019) beta 1,4 galactosyltrans... +3    75  0.992     1
pir||PQ0477          pistil extensin-like protein (clo... +3    61  0.992     1
gi|548155            (M24791) tyrosine hydroxylase [Ho... +3    61  0.992     1
gi|1401301           (U60024) BIIIA3 [Ovis aries]         -2    61  0.992     1
sp|P07645|VGLD_PRVRI GLYCOPROTEIN GP50 >pir||VGBE50 gl... +3    83  0.993     1
gi|2815888           (AF042838) MEK kinase 1 [Homo sap... +3    89  0.993     1
pir||CGHU6C          collagen alpha 1(II) chain precur... -3    89  0.993     1
gi|404805            (L13855) uracil-DNA glycosylase [... +3    82  0.993     1
gi|190247            (J04564) snRNP polypeptide B [Hom... +3    81  0.993     1
gi|2145054           (AF000413) merozoite surface prot... +3    76  0.994     1
sp|P55318|HN3G_HUMAN HEPATOCYTE NUCLEAR FACTOR 3-GAMMA... +3    82  0.994     1
gnl|PID|e1226069     (AJ001159) hypothetical protein [... +3    78  0.995     1
bbs|169646           protamine [Monodonta turbinata, g... -2    70  0.995     1
gnl|PID|e276305      (X98705) collagen type I alpha 1 ... +3    86  0.995     2
gi|2145149           (U81030) treacle [Mus musculus]      +3    88  0.996     1
gi|2736513           (AF039052) No definition line fou... +3    81  0.996     1
gi|2109459           (AF001794) Treacher Collins Syndr... +3    88  0.996     1
gnl|PID|d1010582     (D63884) intermediate chain 1 [An... -3    86  0.997     1
gi|559557            (U14009) arabinogalactan-protein ... +3    75  0.997     1
gnl|PID|e349129      (Z68104) F08B12.4 [Caenorhabditis... -3    72  0.997     1
gi|3170607           (AF059247) RNA guanylyltransferas... +3    85  0.997     1
sp|P10161|PRPM_HUMAN SALIVARY PROLINE-RICH PROTEIN PO ... +3    79  0.997     1
gi|552165            (M61208) merozoite surface antige... +3    74  0.998     1
prf||0409317A        protein,antifreeze [Pagothenia bo... +3    60  0.998     1
prf||0903209A        peptide PD,basic Pro rich [Homo s... +3    60  0.998     1
gi|1296429           (L77967) small proline-rich prote... +3    60  0.998     1
sp|Q12947|FRE2_HUMAN FORKHEAD-RELATED TRANSCRIPTION FA... +3    82  0.998     1
gi|151002            (M57551) transcription regulatory... +3    81  0.999     1
sp|P10163|PRP4_HUMAN SALIVARY PROLINE-RICH PROTEIN PO ... +3    79  0.999     1
pir||JU0451          hypothetical 21K protein (c-myc 5... +3    77  0.999     1
gi|2047346           (AF000198) Similar to cuticular c... +3    82  0.999     1
gnl|PID|e319191      (Z95972) hypothetical protein Rv0... +3    64  0.999     1
gi|2338028           (AF005370) capsid protein [Alcela... +3    79  0.999     1
gi|150987            (M32077) alginate regulatory prot... +3    81  0.9990    1
gnl|PID|e317231      (Z95584) hypothetical protein Rv1... +3    72  0.9990    1
pir||S31211          collagen alpha 1(XIV) chain precu... +3    85  0.9991    1
pir||A48099          transcription factor GATA-4, reti... +3    82  0.9992    1
gnl|PID|e229202      (Z70208) F54B11.2 [Caenorhabditis... +3    80  0.9992    1
pir||S21825          vicilin-like storage protein Glb1... +3    83  0.9993    1
pir||C45219          N-methyl-D-aspartate receptor cha... +3    87  0.9994    1
gnl|PID|d1003001     (D13213) N-methyl-D-aspartate rec... +3    87  0.9994    1
gi|2853221           (U72953) merozoite surface protei... +3    75  0.9996    1
sp|P32515|VGLZ_HSVEK GLYCOPROTEIN PRECURSOR >pir||VGBE... +3    81  0.9996    1
sp|P04258|CA13_BOVIN COLLAGEN ALPHA 1(III) CHAIN >pir|... +3    87  0.9997    2
gnl|PID|e286583      (Y08914) s19 chorion protein [Cer... +3    80  0.9997    1
gi|156529            (K01693) giant secretory protein ... +2    59  0.9997    1
gnl|PID|e1286174     (AL022374) putative ABC transport... +3    84  0.9997    1
pir||PN0464          hypothetical protein 114 - Strept... +3    72  0.9998    1
gi|2315991           (U86454) FliK [Rhodobacter sphaer... +3    79  0.9998    2
pir||I49607          procollagen type V alpha 2 - mous... -3    87  0.9998    1
prf||1412350A        DNA polymerase [Human adenovirus ... +3    74  0.9998    1
sp|P15276|ALGP_PSEAE TRANSCRIPTIONAL REGULATORY PROTEI... +3    80  0.9998    1
gi|1657601           (U66220) unknown [Nannocystis exe... +3    79  0.9998    1
bbs|56678            interstitial collagen alpha chain... +3    65  0.9998    1
pir||SKXLAG          dermal gland protein APEG precurs... +3    81  0.9998    1
gi|2290392           (U90353) IgG and IgE immunoreacti... -3    72  0.9998    1
pir||JQ0148          hypothetical 34.4K protein - Pseu... +3    80  0.9999    1
gnl|PID|e236460      (Z71178) B0024.1 [Caenorhabditis ... +3    79  0.9999    1
gi|2429435           (AF025458) Similar to cuticular c... +3    79  0.9999    1
pir||B55663          oligodendrocyte-specific proline-... +3    75  0.9999    1
sp|P08392|ICP4_HSV11 TRANS-ACTING TRANSCRIPTIONAL PROT... +3    86  0.99990   1
gi|2865394           (AF036949) basic leucine zipper p... -3    82  0.99991   1
sp|P28284|ICP0_HSV2H TRANS-ACTING TRANSCRIPTIONAL PROT... +3    84  0.99991   1
gnl|PID|e304193      (Z86099) RL2 [human herpesvirus 2]   +3    84  0.99991   1
sp|P17437|XP2_XENLA  SKIN SECRETORY PROTEIN XP2 PRECUR... +3    81  0.99992   1
dbj||D88764_1        (D88764) alpha 2 type I collagen ... +3    84  0.99992   2
sp|P02441|KRA3_SHEEP KERATIN, HIGH-SULFUR MATRIX PROTE... -2    72  0.99993   1
sp|P02442|KRA3_GOATA KERATIN, HIGH-SULFUR MATRIX PROTE... -2    72  0.99995   1



>gnl|PID|e290647 (Y10371) histone H2A [Trypanosoma cruzi]
            Length = 119

  Minus Strand HSPs:

 Score = 570 (200.7 bits), Expect = 1.5e-54, P = 1.5e-54
 Identities = 117/118 (99%), Positives = 118/118 (100%), Frame = -1

Query:   579 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK
Sbjct:     2 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 61

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
             KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA+KHKSSKKARATPSA
Sbjct:    62 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAEKHKSSKKARATPSA 119


>gi|603042 (X83272) histone H2A [Trypanosoma cruzi]
           Length = 135

  Minus Strand HSPs:

 Score = 567 (199.6 bits), Expect = 3.2e-54, P = 3.2e-54
 Identities = 117/118 (99%), Positives = 117/118 (99%), Frame = -1

Query:   579 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK
Sbjct:    18 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
             KPKRLTPRTVTLAVRHDD LGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA
Sbjct:    78 KPKRLTPRTVTLAVRHDDHLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 135


>sp|P35066|H2A_TRYCR HISTONE H2A >pir||S25119 histone H2A - Trypanosoma cruzi
            >gi|10618 (X67287) histone H2A [Trypanosoma cruzi]
            Length = 135

  Minus Strand HSPs:

 Score = 565 (198.9 bits), Expect = 5.2e-54, P = 5.2e-54
 Identities = 116/118 (98%), Positives = 117/118 (99%), Frame = -1

Query:   579 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK
Sbjct:    18 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
             KPKRLTPRTVTLAV HDDDLGMLLKDVT+SRGGVMPSLNKALAKKHKSSKKARATPSA
Sbjct:    78 KPKRLTPRTVTLAVAHDDDLGMLLKDVTVSRGGVMPSLNKALAKKHKSSKKARATPSA 135


>gnl|PID|e324188 (Y13985) Histone H2A [Trypanosoma cruzi]
            Length = 135

  Minus Strand HSPs:

 Score = 562 (197.8 bits), Expect = 1.1e-53, P = 1.1e-53
 Identities = 115/118 (97%), Positives = 118/118 (100%), Frame = -1

Query:   579 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK
Sbjct:    18 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
             KPKRLTPRTVTLAVRHDDDLGMLLK+VTLSRGGV+PSLNKA+AKKHKSSKKARATPSA
Sbjct:    78 KPKRLTPRTVTLAVRHDDDLGMLLKNVTLSRGGVIPSLNKAVAKKHKSSKKARATPSA 135


>gi|2138317 (U87597) histone H2A [Crithidia fasciculata]
            Length = 132

  Minus Strand HSPs:

 Score = 465 (163.7 bits), Expect = 2.0e-43, P = 2.0e-43
 Identities = 94/117 (80%), Positives = 109/117 (93%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             +SAKAGLIFPVGRVGS+LRRGQYARRIGA+GAVYM AV+EYLTAELLELSVKAA+Q  KK
Sbjct:    18 KSAKAGLIFPVGRVGSMLRRGQYARRIGAAGAVYMTAVVEYLTAELLELSVKAAAQSGKK 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
             P+RL+PRTVT+AVRHDD +G LLK+VT+SRGGV+PS+NKALAKK K  KK++ATPSA
Sbjct:    78 PRRLSPRTVTMAVRHDD-IGSLLKNVTMSRGGVVPSINKALAKK-KGGKKSKATPSA 132


>sp|P27892|H2A2_LEIDO HISTONE H2A.2 >pir||S22391 histone H2A - Leishmania
            donovani infantum >gi|9492 (X61936) histone H2A [Leishmania
            donovani]
            Length = 132

  Minus Strand HSPs:

 Score = 438 (154.2 bits), Expect = 1.5e-40, P = 1.5e-40
 Identities = 90/117 (76%), Positives = 101/117 (86%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             +SAK GLIFPVGRVG ++RRGQYARRIGASGAVY+AAVLEYLTAELLELSVKAA+Q  KK
Sbjct:    17 KSAKCGLIFPVGRVGGMMRRGQYARRIGASGAVYLAAVLEYLTAELLELSVKAAAQSGKK 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
               RL PRTV LA RHDDD+G LLK+VTLS  GV+PS++KA+AKK K  KK RATPSA
Sbjct:    77 RCRLNPRTVMLAARHDDDIGTLLKNVTLSHSGVVPSVSKAVAKK-KGGKKGRATPSA 132


>sp|P27891|H2A1_LEIDO HISTONE H2A.1 >pir||S22303 histone H2A - Leishmania
            donovani >gi|9498 (X60054) histone H2A [Leishmania donovani]
            Length = 132

  Minus Strand HSPs:

 Score = 434 (152.8 bits), Expect = 3.9e-40, P = 3.9e-40
 Identities = 88/117 (75%), Positives = 101/117 (86%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             +SAK GLIFPVGRVG ++RRGQYARRIGASGAVY+AAVLEYLTAELLELSVKAA+Q  KK
Sbjct:    17 KSAKCGLIFPVGRVGGMMRRGQYARRIGASGAVYLAAVLEYLTAELLELSVKAAAQSGKK 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
               RL PRTV LA RHDDD+G LLK+VTLS  GV+P+++KA+AKK K  KK +ATPSA
Sbjct:    77 RCRLNPRTVMLAARHDDDIGTLLKNVTLSHSGVVPNISKAMAKK-KGGKKGKATPSA 132


>sp|P40279|H2A_EUGGR HISTONE H2A >pir||S46501 histone H2A - Euglena gracilis
            >gi|508179 (X73147) Histone H2A [Euglena gracilis]
            Length = 136

  Minus Strand HSPs:

 Score = 303 (106.7 bits), Expect = 3.0e-26, P = 3.0e-26
 Identities = 63/105 (60%), Positives = 82/105 (78%), Frame = -1

Query:   579 GRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             G+S KAGL FPVGR GSLLR G+YA+R+G    VY+AAVLEYL+AELLEL+  A S+  K
Sbjct:    31 GQSKKAGLTFPVGRTGSLLRAGRYAKRVGKGAPVYLAAVLEYLSAELLELAGNA-SRDNK 89

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
             K KR+TPR +TLAVR+D++L  LL  VT++ GGV+P++ + L KK
Sbjct:    90 K-KRITPRFLTLAVRNDEELNKLLSGVTIASGGVLPNIQQVLLKK 133


>sp|P04912|H2A2_YEAST HISTONE H2A.2 >pir||HSBYA2 histone H2A.2 - yeast
            (Saccharomyces cerevisiae) >gi|3753 (V01305) histone H2A2
            [Saccharomyces cerevisiae] >gi|403313 (Z26494) histone H2A
            [Saccharomyces cerevisiae] >gi|535978 (Z35764) ORF YBL003c
            [Saccharomyces cerevisiae] >gi|1197050 (J01326) histone
            [Saccharomyces cerevisiae] >prf||2118405B histone H2A
            [Saccharomyces cerevisiae]
            Length = 132

  Minus Strand HSPs:

 Score = 294 (103.5 bits), Expect = 2.7e-25, P = 2.7e-25
 Identities = 63/114 (55%), Positives = 85/114 (74%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGRV  LLRRG YA+RIG+   VY+ AVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARAT 235
               R+ PR + LA+R+DD+L  LL +VT+++GGV+P++++ L  K KS+K A+A+
Sbjct:    79 --RIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK-KSAKTAKAS 129


>sp|P16865|H2A3_VOLCA HISTONE H2A-III >pir||JQ0794 histone H2A.III - Volvox
            carteri >gi|170655 (M31921) histone H2A-III [Volvox carteri]
            Length = 129

  Minus Strand HSPs:

 Score = 293 (103.1 bits), Expect = 3.4e-25, P = 3.4e-25
 Identities = 62/113 (54%), Positives = 81/113 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGR+   L++G+YA RIGA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKN 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKARA 238
               R+ PR + LA+R+D++LG LL DVT++ GGV+P+++  L  KK K  K   A
Sbjct:    77 --RIVPRHIQLAIRNDEELGKLLGDVTIASGGVLPNIHAVLLPKKSKGGKGEEA 128


>sp|P04911|H2A1_YEAST HISTONE H2A.1 >pir||HSBYA1 histone H2A.1 - yeast
            (Saccharomyces cerevisiae) >gi|3751 (V01304) histone H2A1
            [Saccharomyces cerevisiae] >gi|728681 (Z48612) H2a1p [Saccharomyces
            cerevisiae] >gi|1197049 (J01325) histone [Saccharomyces cerevisiae]
            Length = 132

  Minus Strand HSPs:

 Score = 290 (102.1 bits), Expect = 7.1e-25, P = 7.1e-25
 Identities = 62/114 (54%), Positives = 84/114 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGRV  LLRRG YA+RIG+   VY+ AVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARAT 235
               R+ PR + LA+R+DD+L  LL +VT+++GGV+P++++ L  K KS+K  +A+
Sbjct:    79 --RIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK-KSAKATKAS 129


>sp|P16866|H2A4_VOLCA HISTONE H2A-IV >pir||JQ0796 histone H2A.IV - Volvox
            carteri >gi|170658 (M31922) histone H2A-IV [Volvox carteri]
            Length = 129

  Minus Strand HSPs:

 Score = 290 (102.1 bits), Expect = 7.1e-25, P = 7.1e-25
 Identities = 61/113 (53%), Positives = 81/113 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L++G+YA RIGA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKN 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKARA 238
               R+ PR + LA+R+D++LG LL DVT++ GGV+P+++  L  KK K  K   A
Sbjct:    77 --RIVPRHIQLAIRNDEELGKLLGDVTIASGGVLPNIHAVLLPKKSKGGKGEEA 128


>gi|171031 (M18455) histone H2A-1 [Saccharomyces cerevisiae]
           Length = 118

  Minus Strand HSPs:

 Score = 290 (102.1 bits), Expect = 7.1e-25, P = 7.1e-25
 Identities = 62/114 (54%), Positives = 84/114 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGRV  LLRRG YA+RIG+   VY+ AVLEYL AE+LEL+  AA    K 
Sbjct:     5 RSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKT 64

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARAT 235
               R+ PR + LA+R+DD+L  LL +VT+++GGV+P++++ L  K KS+K  +A+
Sbjct:    65 --RIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK-KSAKATKAS 115


>sp|P02277|H2A3_WHEAT HISTONE H2A.2.2
            Length = 151

  Minus Strand HSPs:

 Score = 290 (102.1 bits), Expect = 7.1e-25, P = 7.1e-25
 Identities = 66/144 (45%), Positives = 89/144 (61%), Frame = -1

Query:   633 KTTASAKLN*PSLKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEY 454
             K  A  K   P  K     RS KAGL FPVGR+G  L++G+YA+R+G+   VY+AAVLEY
Sbjct:     7 KKVAGKKFGGPRKKS--VTRSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEY 64

Query:   453 LTAELLELSVKAASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL 274
             L AE+LEL+  AA    K   R+ PR + LAVR+D +LG LL  VT++ GGV+P++N  L
Sbjct:    65 LAAEVLELAGNAAKDNKKS--RIVPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINPVL 122

Query:   273 AKKHKSSKKARATPSA*SGLQARR 202
               K  + K  +A   A S  +A +
Sbjct:   123 LPKKAAEKAEKAGTKAKSPKKATK 146


>gi|2104499 (U70133) replication-dependent histone H2A [Bufo bufo gagarizans]
            Length = 129

  Minus Strand HSPs:

 Score = 290 (102.1 bits), Expect = 7.1e-25, P = 7.1e-25
 Identities = 61/113 (53%), Positives = 83/113 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA+R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K +SSK A++
Sbjct:    78 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKTESSKPAKS 128


>sp|P25470|H2A1_PEA HISTONE H2A >pir||JQ1183 histone H2A - garden pea
            Length = 150

  Minus Strand HSPs:

 Score = 289 (101.7 bits), Expect = 9.1e-25, P = 9.1e-25
 Identities = 60/117 (51%), Positives = 83/117 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS +AGL FPVGRVG  L++G+YA+R+G    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    26 RSVRAGLQFPVGRVGRFLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKN 85

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
               R++PR + LAVR+D++LG LL  VT++ GGV+P++N  L  K K +  A +TP +
Sbjct:    86 --RISPRHLLLAVRNDEELGKLLAGVTIAYGGVLPNINPVLLPKRKENAAA-STPKS 139


>sp|P02276|H2A2_WHEAT HISTONE H2A.2.1 >pir||HSWT2A histone H2A.2 - wheat
            Length = 151

  Minus Strand HSPs:

 Score = 288 (101.4 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 64/136 (47%), Positives = 88/136 (64%), Frame = -1

Query:   633 KTTASAKLN*PSLKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEY 454
             K  A+ K   P  K     +S KAGL FPVGR+G  L++G+YA+R+G+   VY+AAVLEY
Sbjct:     7 KKVAAKKFGGPRKKS--VTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEY 64

Query:   453 LTAELLELSVKAASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL 274
             L AE+LEL+  AA    K   R+ PR + LA+R+D +LG LL  VT++ GGV+P++N  L
Sbjct:    65 LAAEVLELAGNAAKDNKKT--RIVPRHLLLAIRNDQELGRLLSGVTIAHGGVIPNINPVL 122

Query:   273 AKKHKSSK--KARATPSA 226
               K  + K  KA A P +
Sbjct:   123 LPKKAAEKAEKAGAAPKS 140


>sp|P50567|H2A_CHLRE HISTONE H2A >pir||S59126 histone H2A - Chlamydomonas
            reinhardtii >pir||S59584 histone H2A (clone CH-II) - Chlamydomonas
            reinhardtii >gi|571473 (U16724) histone H2A [Chlamydomonas
            reinhardtii] >gi|571478 (U16725) histone H2A [Chlamydomonas
            reinhardtii] >gi|790703 (L41841) histone H2A [Chlamydomonas
            reinhardtii]
            Length = 129

  Minus Strand HSPs:

 Score = 287 (101.0 bits), Expect = 1.5e-24, P = 1.5e-24
 Identities = 60/109 (55%), Positives = 80/109 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGR+   L++G+YA RIGA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKN 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSK 250
               R+ PR + LA+R+D++LG LL +VT++ GGV+P+++  L  KK K  K
Sbjct:    77 --RIVPRHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGK 124


>pir||S59590 histone H2A (clone CH-IV) - Chlamydomonas reinhardtii >gi|571481
            (U16726) histone H2A [Chlamydomonas reinhardtii]
            Length = 130

  Minus Strand HSPs:

 Score = 287 (101.0 bits), Expect = 1.5e-24, P = 1.5e-24
 Identities = 60/109 (55%), Positives = 80/109 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGR+   L++G+YA RIGA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKN 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSK 250
               R+ PR + LA+R+D++LG LL +VT++ GGV+P+++  L  KK K  K
Sbjct:    77 --RIVPRHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGK 124


>sp|P19177|H2A_PETCR HISTONE H2A >pir||S11498 histone H2A - parsley >gi|20448
            (X53831) H2A histone protein (AA 1 - 149) [Petroselinum crispum]
            Length = 149

  Minus Strand HSPs:

 Score = 287 (101.0 bits), Expect = 1.5e-24, P = 1.5e-24
 Identities = 60/117 (51%), Positives = 82/117 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS KAGL FPVGR+G  L++G+YA+R+G    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    25 RSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 84

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
               R+ PR + LAVR+D++LG LL  VT + GGV+P++N  L  K K+++KA   P +
Sbjct:    85 --RIIPRHLLLAVRNDEELGKLLAGVTFAHGGVLPNINPVLLPK-KTAEKAAKEPKS 138


>sp|P25469|H2A_LYCES HISTONE H2A >pir||JQ1182 histone H2A.1 - tomato
            Length = 146

  Minus Strand HSPs:

 Score = 287 (101.0 bits), Expect = 1.5e-24, P = 1.5e-24
 Identities = 60/125 (48%), Positives = 86/125 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             +S KAGL FPVGR+G  L++G+YA+R+G+   +Y+AAVLEYL AE+LEL+  AA    K 
Sbjct:    24 KSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEVLELAGNAARDNKKS 83

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA*SG 217
               R+ PR V LAVR+D++LG LL  VT++ GGV+P++N  L  K KS+     +P A +G
Sbjct:    84 --RIIPRHVLLAVRNDEELGKLLAGVTIASGGVLPNINPVLLPK-KSAVAEEKSPKAKAG 140

Query:   216 LQARR 202
                ++
Sbjct:   141 KSPKK 145


>sp|P02263|H2A4_CHICK HISTONE H2A-IV >gi|63475 (X02218) H2A (aa 1-129) [Gallus
            gallus] >gnl|PID|d1002274 (D11055) H2A histone [Gallus gallus]
            >gi|1493821 (U38931) histone H2A [Gallus gallus] >gi|1493823
            (U38932) histone H2A [Gallus gallus] >gi|1493825 (U38933) histone
            H2A [Gallus gallus]
            Length = 129

  Minus Strand HSPs:

 Score = 286 (100.7 bits), Expect = 1.9e-24, P = 1.9e-24
 Identities = 60/113 (53%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA+A
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKA 128


>pir||HSCH2A histone H2A - chicken
            Length = 128

  Minus Strand HSPs:

 Score = 286 (100.7 bits), Expect = 1.9e-24, P = 1.9e-24
 Identities = 60/113 (53%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA+A
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKA 127


>gi|1458140 (U62673) histone H2a(A)-613 [Mus musculus]
            Length = 129

  Minus Strand HSPs:

 Score = 286 (100.7 bits), Expect = 1.9e-24, P = 1.9e-24
 Identities = 60/113 (53%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA++
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKS 128


>gi|1493827 (U38934) histone H2A [Gallus gallus]
            Length = 129

  Minus Strand HSPs:

 Score = 286 (100.7 bits), Expect = 1.9e-24, P = 1.9e-24
 Identities = 60/113 (53%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA++
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKS 128


>sp|P06897|H2A1_XENLA HISTONE H2A.1 >pir||HSXLA1 histone H2A.1 - African clawed
            frog >gi|64777 (X03018) histone H2A (aa 1-130) [Xenopus laevis]
            >gi|214284 (M21287) histone H2A [Xenopus laevis]
            Length = 130

  Minus Strand HSPs:

 Score = 285 (100.3 bits), Expect = 2.4e-24, P = 2.4e-24
 Identities = 61/113 (53%), Positives = 83/113 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKARA 238
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  KK +S+K A++
Sbjct:    78 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKS 129


>gi|1870696 (U84114) cleavage stage histone H2A [Psammechinus miliaris]
            Length = 134

  Minus Strand HSPs:

 Score = 285 (100.3 bits), Expect = 2.4e-24, P = 2.4e-24
 Identities = 60/114 (52%), Positives = 81/114 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+   LR+GQYA RIG   AVY+AA+LEYL+AE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRIHRFLRKGQYASRIGGGAAVYLAAILEYLSAEILELAGNAARDNKKS 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARAT 235
               R+ PR + LAVR+D++L  LL +VT++ GGVMP++   L  K KS K ++ T
Sbjct:    78 --RIIPRHLQLAVRNDEELNKLLNNVTIASGGVMPNIQTVLLPK-KSGKSSKQT 128


>sp|P40280|H2A_MAIZE HISTONE H2A >gi|473603 (U08225) histone H2A [Zea mays]
            Length = 159

  Minus Strand HSPs:

 Score = 284 (100.0 bits), Expect = 3.1e-24, P = 3.1e-24
 Identities = 63/130 (48%), Positives = 86/130 (66%), Frame = -1

Query:   633 KTTASAKLN*PSLKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEY 454
             K  A  K+  P  K     RS KAGL FPVGR+G  L++G+YA+ +G    VY+AAVLEY
Sbjct:    14 KGAAGRKVGGPRKKS--VSRSVKAGLQFPVGRIGRYLKKGRYAQXVGTGAPVYLAAVLEY 71

Query:   453 LTAELLELSVKAASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL 274
             L AE+LEL+  AA    K   R+ PR V LA+R+D++LG LL  VT++ GGV+P++N  L
Sbjct:    72 LAAEVLELAGNAARDNKKT--RIIPRHVLLAIRNDEELGKLLGGVTIAHGGVLPNINPVL 129

Query:   273 AKKHKSSKKA 244
               K K+++KA
Sbjct:   130 LPK-KTAEKA 138


>sp|P13912|H2A_CAIMO HISTONE H2A >pir||I50457 histone H2A - muscovy duck
            >gi|62729 (X14730) histone H2A (AA 1-129) [Cairina moschata]
            Length = 129

  Minus Strand HSPs:

 Score = 283 (99.6 bits), Expect = 3.9e-24, P = 3.9e-24
 Identities = 59/113 (52%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA++
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKS 128


>pir||I50657 histone H2A - chicken >gi|63448 (V00413) reading frame H2A.
            [Gallus gallus]
            Length = 129

  Minus Strand HSPs:

 Score = 283 (99.6 bits), Expect = 3.9e-24, P = 3.9e-24
 Identities = 59/113 (52%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   +Y+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPLYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA+A
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKA 128


>sp|P20670|H2A2_MOUSE HISTONE H2A.2 >pir||S06742 histone H2A.2 - mouse
            >pir||I48091 histone H2a.2 - long-tailed hamster >pir||I49394
            histone H2a.2 protein - shrew mouse >gi|51300 (X16148) H2A protein
            (AA 1-130) [Mus musculus] >gi|306829 (L19779) histone H2A.2 [Homo
            sapiens] >gi|515004 (X80327) histone H2a.2 protein [Mus pahari]
            >gi|516303 (X80330) histone H2a.2 [Cricetulus longicaudatus]
            >gi|1458143 (U62674) histone H2a.2-615 [Mus musculus]
            Length = 130

  Minus Strand HSPs:

 Score = 282 (99.3 bits), Expect = 5.0e-24, P = 5.0e-24
 Identities = 61/112 (54%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>gi|63473 (X02218) H2A (aa 1-129) [Gallus gallus]
          Length = 127

  Minus Strand HSPs:

 Score = 282 (99.3 bits), Expect = 5.0e-24, P = 5.0e-24
 Identities = 59/112 (52%), Positives = 79/112 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAK 127


>pir||S45110 histone H2A - mouse >gi|817939 (Z30940) histone H2A [Mus musculus
            domesticus]
            Length = 137

  Minus Strand HSPs:

 Score = 282 (99.3 bits), Expect = 5.0e-24, P = 5.0e-24
 Identities = 61/112 (54%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    25 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKT 84

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    85 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 135


>gnl|PID|e1308243 (AL030978) histone H2A- like protein [Arabidopsis thaliana]
            Length = 131

  Minus Strand HSPs:

 Score = 282 (99.3 bits), Expect = 5.0e-24, P = 5.0e-24
 Identities = 61/109 (55%), Positives = 78/109 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L+ G+YA R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSL-NKALAKKHKSSK 250
               R+ PR + LAVR+D++L  LL DVT++ GGVMP++ N  L KK  SSK
Sbjct:    79 --RIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKAGSSK 126


>sp|P35062|H2A3_CHICK HISTONE H2A-III >pir||JC1523 histone H2A-III - chicken
            >gnl|PID|d1002273 (D11054) H2A histone [Gallus gallus]
            Length = 129

  Minus Strand HSPs:

 Score = 281 (98.9 bits), Expect = 6.4e-24, P = 6.4e-24
 Identities = 59/113 (52%), Positives = 79/113 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+   A    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNPARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   S KA+A
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKA 128


>sp|P40281|H2A2_PEA HISTONE H2A >pir||S60474 histone H2A - garden pea
            >gi|498896 (U10041) histone H2A homolog [Pisum sativum]
            Length = 149

  Minus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 8.2e-24, P = 8.2e-24
 Identities = 59/116 (50%), Positives = 83/116 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS +AGL FPVGR+G  L++G+YA+R+G    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    26 RSVRAGLQFPVGRIGRFLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKN 85

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKARATPS 229
               R++PR + LAVR+D +LG LL  VT++ GGV+P++N  L  K+ +S+  A  +PS
Sbjct:    86 --RISPRHLLLAVRNDVELGKLLAGVTIAYGGVLPNINPVLLPKRTESAASAPKSPS 140


>sp|P04910|H2A2_SCHPO HISTONE H2A-BETA (H2A.2) >pir||HSZPA3 histone H2A.2 -
            fission yeast (Schizosaccharomyces pombe) >gi|4961 (X05221) Histone
            H2A.2 (AA 1 - 131) [Schizosaccharomyces pombe] >gi|173402 (M11500)
            histone H2A-beta [Schizosaccharomyces pombe] >gnl|PID|e325403
            (Z97209) SPAC19G12.06c, hta2; histone h2a-beta, len:131aa,
            identical to H2A2_SCHPO, P04910, (initiation met removed), (130aa)
            [Schizosaccharomyces pombe] >prf||1202262B histone H2A.2
            [Schizosaccharomyces pombe]
            Length = 131

  Minus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 8.2e-24, P = 8.2e-24
 Identities = 59/110 (53%), Positives = 77/110 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGRV  LLR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKK 247
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++N  L  K     K
Sbjct:    79 --RIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKQSGKGK 126


>gi|1458139 (U62673) histone H2a(B)-613 [Mus musculus]
            Length = 130

  Minus Strand HSPs:

 Score = 280 (98.6 bits), Expect = 8.2e-24, P = 8.2e-24
 Identities = 60/110 (54%), Positives = 77/110 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKK 247
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K   S K
Sbjct:    78 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHK 125


>sp|P40282|H2A_PLAFA HISTONE H2A >pir||A45564 histone 2A - Plasmodium
            falciparum >gi|160319 (M86865) H2A [Plasmodium falciparum]
            Length = 132

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 59/110 (53%), Positives = 78/110 (70%), Frame = -1

Query:   573 SAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKKP 394
             SAKAGL FPVGR+G  L++G+YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K  
Sbjct:    19 SAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLCAEILELAGNAARDNKKS- 77

Query:   393 KRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
              R+TPR + LAVR+D++L   L  VT + GGV+P+++  L  K KS  KA
Sbjct:    78 -RITPRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPK-KSQLKA 125


>sp|Q07135|H2AO_CHITH HISTONE H2A, ORPHON >pir||S40435 histone H2A - midge
            (Chironomus thummi thummi) >gi|297560 (X72803) histone H2A
            [Chironomus thummi]
            Length = 125

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 58/111 (52%), Positives = 78/111 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+  LLR+G YA RIGA   VY+AAV+EYL AE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRIHRLLRKGHYAERIGAGAPVYLAAVMEYLGAEILELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   SKKA
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTESKKA 125


>pir||S53518 histone H2A - wheat >gnl|PID|d1007854 (D38087) protein H2A
            [Triticum aestivum] >prf||2108279A histone H2A:ISOTYPE=2 [Triticum
            aestivum]
            Length = 145

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 59/118 (50%), Positives = 83/118 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS KAGL FPVGR+G  L++G+YA+R+G+   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    15 RSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHK---SSKKARATPSA 226
               R+ PR + LAVR+D +LG LL  VT++ GGV+P++N  L  K     + K+A++  +A
Sbjct:    75 --RIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLPKKSPAAAEKEAKSQKAA 132


>sp|P02261|H2A1_HUMAN HISTONE H2A.1 >pir||HSHUA1 histone H2A.1 - human
            >gi|31980 (X57138) histone H2A.1 [Homo sapiens] >gi|306827 (L19778)
            histone H2A.1b [Homo sapiens] >gi|603553 (X83549) histone H2A [Homo
            sapiens] >gnl|PID|e286631 (Z83739) histone H2A [Homo sapiens]
            >gnl|PID|e286634 (Z83742) histone H2A [Homo sapiens]
            >gnl|PID|e1287734 (Z98744) histone H2A [Homo sapiens]
            >gnl|PID|e1299208 (AL009179) dJ97D16.5 (Histone H2A) [Homo sapiens]
            Length = 130

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 60/112 (53%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>sp|P02262|H2A1_RAT HISTONE H2A.1
            Length = 129

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 60/112 (53%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 127


>pir||HSBO2A histone H2A - bovine >gnl|PID|e1287737 (Z98744) histone H2A.1
            [Homo sapiens] >gnl|PID|e1287742 (Z98744) histone H2A.1 [Homo
            sapiens] >prf||1109175A homeostatic thymus hormone alpha [Bos
            taurus]
            Length = 129

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 60/112 (53%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 127


>gi|1161302 (L75802) histone H2A [Triticum aestivum] >gnl|PID|e244179 (X94973)
            histone H2A [Triticum aestivum]
            Length = 146

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 60/129 (46%), Positives = 88/129 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS KAGL FPVGR+G  L++G+YA+RIG+   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    15 RSVKAGLQFPVGRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHK--SSKKARATPSA* 223
               R+ PR + LAVR+D +LG LL  VT++ GGV+P++N  L  K    +++K   +P   
Sbjct:    75 --RIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPTINSVLLPKKSPAAAEKEAKSPKKK 132

Query:   222 SGLQARRREGA 190
             +  ++ +++ A
Sbjct:   133 TSTKSPKKKVA 143


>gnl|PID|e1285912 (AL021807) dJ86C11.1 [Homo sapiens]
            Length = 128

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 60/112 (53%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>gnl|PID|e1285916 (AL021807) dJ86C11.5 [Homo sapiens]
            Length = 129

  Minus Strand HSPs:

 Score = 279 (98.2 bits), Expect = 1.0e-23, P = 1.0e-23
 Identities = 60/112 (53%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>sp|P35061|H2A_ACRFO HISTONE H2A >gi|166310 (L11067) histone H2A [Acropora
            formosa] >bbs|140812 (S67324) histone H2A, H2A [Acropora
            formosa=coral, sperms, Peptide, 125 aa] [Acropora formosa]
            >prf||1920342C histone H2A [Acropora formosa]
            Length = 125

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 59/110 (53%), Positives = 79/110 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+  LLR+G YA R+GA   VYMAAVLEYL+AE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKK 247
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K+ KK
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK-KTEKK 123


>sp|P27325|H2A_URECA HISTONE H2A >pir||S21849 histone H2A - spoonworm (Urechis
            caupo) >pir||B56618 histone H2A - spoonworm (Urechis caupo)
            >gi|10864 (X58895) H2A histone [Urechis caupo]
            Length = 125

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 60/118 (50%), Positives = 82/118 (69%), Frame = -1

Query:   594 KG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAA 415
             KG    RS++AGL FPVGR+  LLR+G YA RIGA   VY+AAV+EYL AE+LEL+  AA
Sbjct:    11 KGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVMEYLAAEVLELAGNAA 70

Query:   414 SQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
                 K   R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K KSS+K +
Sbjct:    71 RDNKKT--RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KSSQKTK 125


>pir||S53519 histone H2A type 1 (clone wcH2A-9) - wheat >gnl|PID|d1007857
            (D38090) protein H2A [Triticum aestivum] >prf||2108279B histone
            H2A:ISOTYPE=9 [Triticum aestivum]
            Length = 146

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 59/129 (45%), Positives = 88/129 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS KAGL FPVGR+G  L++G+YA+R+G+   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    15 RSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHK--SSKKARATPSA* 223
               R+ PR + LAVR+D +LG LL  VT++ GGV+P++N  L  K    +++K   +P   
Sbjct:    75 --RIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLPKKSPAAAEKEAKSPKKK 132

Query:   222 SGLQARRREGA 190
             +  ++ +++ A
Sbjct:   133 TSTKSPKKKVA 143


>sp|P16104|H2AX_HUMAN HISTONE H2A.X >pir||S07631 histone H2A.X - human
            >gi|31973 (X14850) histone H2A.X [Homo sapiens]
            Length = 143

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 59/116 (50%), Positives = 79/116 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPS 229
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K  S+      PS
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPS 131


>sp|P02275|H2A1_WHEAT HISTONE H2A.1 >pir||HSWT91 histone H2A.1 - wheat
            Length = 145

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 59/129 (45%), Positives = 88/129 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS KAGL FPVGR+G  L++G+YA+R+G+   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    14 RSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 73

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHK--SSKKARATPSA* 223
               R+ PR + LAVR+D +LG LL  VT++ GGV+P++N  L  K    +++K   +P   
Sbjct:    74 --RIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLPKKSPAAAEKEAKSPKKK 131

Query:   222 SGLQARRREGA 190
             +  ++ +++ A
Sbjct:   132 TSTKSPKKKVA 142


>sp|P02264|H2A_ONCMY HISTONE H2A, GONADAL >gi|64325 (X01064) histone H2A
            [Oncorhynchus mykiss]
            Length = 128

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 60/113 (53%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K+ K  +A
Sbjct:    78 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK-KTEKAVKA 127


>pir||HSTR21 histone H2A, gonadal - rainbow trout
            Length = 127

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 60/113 (53%), Positives = 80/113 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K+ K  +A
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK-KTEKAVKA 126


>gnl|PID|e268230 (Z80778) histone H2A [Homo sapiens] >gi|2062704 (U90551)
            histone 2A-like protein [Homo sapiens] >gi|2088554 (U91328) histone
            2A-like protein [Homo sapiens]
            Length = 130

  Minus Strand HSPs:

 Score = 278 (97.9 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 60/112 (53%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>sp|P04909|H2A1_SCHPO HISTONE H2A-ALPHA (H2A.1) >gi|173404 (M11494) histone
            H2A-alpha [Schizosaccharomyces pombe]
            Length = 132

  Minus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.7e-23, P = 1.7e-23
 Identities = 58/104 (55%), Positives = 76/104 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGRV  LLR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++N  L  K
Sbjct:    79 --RIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPK 120


>pir||HSZPA2 histone H2A.1 - fission yeast (Schizosaccharomyces pombe) >gi|4959
            (X05220) H2A.1 histone (AA 1 - 132) [Schizosaccharomyces pombe]
            >prf||1202262A histone H2A.1 [Schizosaccharomyces pombe]
            Length = 132

  Minus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.7e-23, P = 1.7e-23
 Identities = 58/104 (55%), Positives = 76/104 (73%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAGL FPVGRV  LLR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++N  L  K
Sbjct:    79 --RIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPK 120


>gnl|PID|e1300929 (AJ006959) histone H2A [Botryotinia fuckeliana]
            Length = 137

  Minus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.7e-23, P = 1.7e-23
 Identities = 58/114 (50%), Positives = 83/114 (72%), Frame = -1

Query:   567 KAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKKPKR 388
             KAGL FPVGRV  LLR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K   R
Sbjct:    24 KAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT--R 81

Query:   387 LTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
             + PR + LA+R+D++L  LL  VT+++GGV+P+++++L  K K++K A   P++
Sbjct:    82 IIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQSLLPK-KTAKTAGGKPAS 134


>sp|P02267|H2A_DROME HISTONE H2A >pir||S21938 histone H2A - fruit fly
            (Drosophila hydei) >pir||C56612 histone H2A - Tigriopus
            californicus >pir||HSFF2 histone H2A - fruit fly (Drosophila
            melanogaster) >gi|7435 (X52576) histone H2a [Drosophila hydei]
            >gi|7441 (X17072) histone H2A [Drosophila hydei] >gi|161898
            (M84797) histone H2A [Tigriopus californicus] >bbs|118863 (S49144)
            histone H2A [Tigriopus californicus, Peptide, 124 aa]
            Length = 124

  Minus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 2.2e-23, P = 2.2e-23
 Identities = 59/118 (50%), Positives = 81/118 (68%), Frame = -1

Query:   597 LKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKA 418
             +KG    RS +AGL FPVGR+  LLR+G YA R+GA   VY+AAV+EYL AE+LEL+  A
Sbjct:    10 VKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNA 69

Query:   417 ASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
             A    K   R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K K+ KKA
Sbjct:    70 ARDNKKT--RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KTEKKA 124


>sp|P16886|H2AL_STRPU LATE HISTONE H2A.L3 >gi|10237 (X06642) histone L3 H2a
            [Strongylocentrotus purpuratus]
            Length = 126

  Minus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 2.2e-23, P = 2.2e-23
 Identities = 59/112 (52%), Positives = 80/112 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSA+AGL FPVGRV   LR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    18 RSARAGLQFPVGRVHRFLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K+SK ++
Sbjct:    78 --RIIPRHLQLAVRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KTSKASK 126


>sp|P27661|H2AX_MOUSE HISTONE H2A.X >pir||I48406 histone H2A.X - mouse
            >gi|51142 (X58069) histone H2A.X [Mus musculus] >gi|515879 (Z35401)
            histone H2A.X [Mus musculus]
            Length = 143

  Minus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 2.2e-23, P = 2.2e-23
 Identities = 58/116 (50%), Positives = 79/116 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPS 229
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K  S+      P+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPA 131


>sp|P20671|H2A3_MOUSE HISTONE H2A.3 >pir||S06754 histone H2A - mouse >gi|51325
            (X16495) histone H2A (AA 1-130) [Mus musculus] >gnl|PID|e268228
            (Z80776) histone H2A [Homo sapiens]
            Length = 130

  Minus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 2.2e-23, P = 2.2e-23
 Identities = 59/112 (52%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G Y+ R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>gnl|PID|e1181728 (Y15320) histone H2A [Aspergillus niger]
            Length = 134

  Minus Strand HSPs:

 Score = 276 (97.2 bits), Expect = 2.2e-23, P = 2.2e-23
 Identities = 59/116 (50%), Positives = 82/116 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGRV  LLR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSSKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPS 229
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++++ L  K K+ K  +   S
Sbjct:    79 --RIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPK-KTPKSGKGPGS 131


>sp|P02265|H2A3_PSAMI LATE HISTONE H2A.3, GONADAL >gi|161364 (M11083) histone
            H2A-3 [Psammechinus miliaris]
            Length = 126

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 58/118 (49%), Positives = 79/118 (66%), Frame = -1

Query:   594 KG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAA 415
             KG    RS++AGL FPVGRV   LR+G YA R+GA   VY+AAVLEYL AE+LEL+  AA
Sbjct:    11 KGKAKSRSSRAGLQFPVGRVHRFLRKGNYANRVGAGAPVYLAAVLEYLAAEILELAGNAA 70

Query:   414 SQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
                 K   R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   SK ++
Sbjct:    71 RDNKKT--RIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGSKSSK 126


>sp|P21896|H2A_CHITH HISTONE H2A >pir||S18004 histone H2A - midge (Chironomus
            thummi thummi) >pir||C56580 histone H2A - midge (Chironomus thummi
            thummi) >gi|7085 (X56335) histone H2A gene product [Chironomus
            thummi]
            Length = 125

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 56/111 (50%), Positives = 77/111 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+  LLR+G Y  R+GA   VY+AAV+EYL AE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRIHRLLRKGNYGERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   SKKA
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTESKKA 125


>sp|P28001|H2A2_HUMAN HISTONE H2A.2 >pir||G40335 histone H2A.1 - human
            >pir||A36322 histone H2A.1 - mouse >gi|184082 (M60752) histone
            H2A.1 [Homo sapiens] >gi|193854 (M37736) histone H2A.1 [Mus
            musculus] >gi|1458129 (U62669) histone H2a.1-F [Mus musculus]
            >gnl|PID|e286633 (Z83741) histone H2A [Homo sapiens]
            Length = 130

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 59/112 (52%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G Y+ R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>sp|P08844|H2A_EMENI HISTONE H2A >pir||A27332 histone H2A - Emericella nidulans
            >gi|168053 (M18258) histone H2A [Emericella nidulans]
            Length = 132

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 58/114 (50%), Positives = 82/114 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGRV  LLR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSSKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARAT 235
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++++ L  K K+ K  + +
Sbjct:    79 --RIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPK-KTPKAGKGS 129


>sp|P22752|H2A1_MOUSE HISTONE H2A.1 >pir||JH0303 histone H2A.1 - mouse
            >gi|387182 (M33988) histone H2A.1 [Mus musculus]
            Length = 130

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 59/112 (52%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G Y+ R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>sp|P10812|H2A4_MOUSE HISTONE H2A.291.A >gi|51304 (X05862) histone H2A-291A (AA
            1 - 135) [Mus musculus]
            Length = 135

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 59/112 (52%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G Y+ R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    23 RSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 82

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    83 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAK 133


>pir||HSUR9P histone H2A, gonadal - sea urchin (Parechinus angulosus)
            Length = 125

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 58/118 (49%), Positives = 79/118 (66%), Frame = -1

Query:   594 KG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAA 415
             KG    RS++AGL FPVGRV   LR+G YA R+GA   VY+AAVLEYL AE+LEL+  AA
Sbjct:    10 KGKAKSRSSRAGLQFPVGRVHRFLRKGNYANRVGAGAPVYLAAVLEYLAAEILELAGNAA 69

Query:   414 SQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
                 K   R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   SK ++
Sbjct:    70 RDNKKT--RIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGSKSSK 125


>gnl|PID|e286628 (Z83736) histone H2A [Homo sapiens]
            Length = 128

  Minus Strand HSPs:

 Score = 275 (96.8 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 59/112 (52%), Positives = 80/112 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  K +
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKTK 128


>sp|P02271|H2A_STRPU HISTONE H2A, EMBRYONIC >pir||HSUR7M histone H2A, embryonic
            - sea urchin (Strongylocentrotus purpuratus) >pir||HSURH9 histone
            H2A, embryonic (clone h19) - sea urchin (Psammechinus miliaris)
            >gi|10031 (X01346) histone H3 (aa 1-135) [Psammechinus miliaris]
            >gi|161388 (M10645) histone H2A [Psammechinus miliaris] >gi|161510
            (J01174) histone H2a [Strongylocentrotus purpuratus] >gi|809111
            (V01357) histone H2A [Strongylocentrotus purpuratus]
            Length = 124

  Minus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 4.5e-23, P = 4.5e-23
 Identities = 58/111 (52%), Positives = 79/111 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   LR+G YA+R+G    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRFLRKGNYAKRVGGGAPVYMAAVLEYLTAEILELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K++K +
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK-KTAKSS 124


>pir||HSRT2A histone H2A - rat >gi|56347 (X59961) H2A histone [Rattus
            norvegicus]
            Length = 130

  Minus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 4.5e-23, P = 4.5e-23
 Identities = 58/112 (51%), Positives = 80/112 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G Y+ R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAANAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  K +
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKPK 128


>pir||S53520 protein H2A - wheat >gnl|PID|d1007855 (D38088) protein H2A
            [Triticum aestivum]
            Length = 148

  Minus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 4.5e-23, P = 4.5e-23
 Identities = 58/116 (50%), Positives = 80/116 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS KAGL FPVGR+G  L++G+YA+ +G+   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    15 RSVKAGLQFPVGRIGRYLKKGRYAQAVGSGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKARATPS 229
               R+ PR + LAVR+D +LG LL  VT++ GGV+P++N  L  KK   + +  +T S
Sbjct:    75 --RIIPRHLLLAVRNDQELGRLLAGVTIAHGGVIPNINSVLLPKKAAGAAEKESTKS 129


>sp|P02268|H2A_SEPOF HISTONE H2A >pir||HSOO2 histone H2A - common cuttlefish
            Length = 124

  Minus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 4.5e-23, P = 4.5e-23
 Identities = 58/119 (48%), Positives = 83/119 (69%), Frame = -1

Query:   597 LKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKA 418
             +KG    RS++AGL FPVGR+  LLR+G YA+R+GA   VY+AAV+EYL AE+LEL+  A
Sbjct:     9 VKGKSKTRSSRAGLQFPVGRIHRLLRKGNYAQRVGAGAPVYLAAVMEYLAAEVLELAGNA 68

Query:   417 ASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
             A    K   R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K K+ K A+
Sbjct:    69 ARDNKKS--RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KTQKAAK 124


>sp|P13630|H2A_PARLI HISTONE H2A >pir||HSURH2 histone H2A, embryonic (clone
            h22) - sea urchin (Psammechinus miliaris) >gi|10016 (V01141)
            reading frame [Psammechinus miliaris] >gi|10022 (V01143) reading
            frame for H2A [Psammechinus miliaris] >gi|159971 (M25281) histone
            H2A [Paracentrotus lividus] >gi|161402 (J01184) histone H2A
            [Psammechinus miliaris] >gnl|PID|e276913 (Y09062) histone protein
            H2A [Paracentrotus lividus]
            Length = 124

  Minus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 5.8e-23, P = 5.8e-23
 Identities = 58/111 (52%), Positives = 78/111 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   LR+G YA+R+G    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRFLRKGNYAKRVGGGAPVYMAAVLEYLTAEILELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K+ K +
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK-KTGKSS 124


>sp|P07793|H2A4_PSAMI LATE HISTONE H2A.2.2 >gi|161353 (M14141) histone H2A-2.2
            [Psammechinus miliaris]
            Length = 120

  Minus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 5.8e-23, P = 5.8e-23
 Identities = 57/106 (53%), Positives = 75/106 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   LR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRFLRKGNYANRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHK 259
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKK 120


>pir||S53521 histone H2A type 2 (clone wcH2A-4) - wheat >gnl|PID|d1007856
            (D38089) protein H2A [Triticum aestivum] >gnl|PID|d1007858 (D38091)
            protein H2A [Triticum aestivum]
            Length = 134

  Minus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 7.4e-23, P = 7.4e-23
 Identities = 58/113 (51%), Positives = 76/113 (67%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L+ G+YA R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
               R+ PR + LAVR+D++L  LL  VT++ GGVMP+++  L  K     KA A
Sbjct:    79 --RIVPRHIQLAVRNDEELSRLLGMVTIASGGVMPNIHNLLLPKKAGGSKAVA 129


>pir||HSXLA2 histone H2A.2 - African clawed frog
            Length = 131

  Minus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 7.4e-23, P = 7.4e-23
 Identities = 60/113 (53%), Positives = 81/113 (71%), Frame = -1

Query:   576 RSAKAGLIFPVG-RVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS++AGL FPVG RV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+   A    K
Sbjct:    18 RSSRAGLQFPVGARVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNTARDNKK 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKARA 238
                R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  KK +SSK  ++
Sbjct:    78 T--RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKSTKS 130


>sp|P02270|H2A_SIPNU HISTONE H2A >pir||HSIN21 histone H2A - sipunculid
            (Sipunculus nudus)
            Length = 123

  Minus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 7.4e-23, P = 7.4e-23
 Identities = 59/115 (51%), Positives = 80/115 (69%), Frame = -1

Query:   594 KG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAA 415
             KG    RS++AGL FPVGR+  LLR+G YA RIGA   VY+AAV+EYL AE+LEL+  AA
Sbjct:    10 KGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVMEYLAAEVLELAGNAA 69

Query:   414 SQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSK 250
                 K   R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK + SK
Sbjct:    70 RDNKKT--RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTQKSK 123


>pir||HSUR9M histone H2A, gonadal - sea urchin (Psammechinus miliaris)
            Length = 125

  Minus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 7.4e-23, P = 7.4e-23
 Identities = 56/112 (50%), Positives = 77/112 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   LR+G YA R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    16 RSSRAGLQFPVGRVHRFLRKGNYANRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKT 75

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   SK ++
Sbjct:    76 --RIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGSKSSK 125


>gnl|PID|d1019976 (AB001052) histone H2A-like protein [Bombyx mori]
            Length = 124

  Minus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 7.4e-23, P = 7.4e-23
 Identities = 59/118 (50%), Positives = 80/118 (67%), Frame = -1

Query:   597 LKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKA 418
             +KG V  RS +AGL FPVGR+  LLR G YA R+GA   VY+AAV+EYL AE+LEL+  A
Sbjct:    10 VKGKVKSRSNRAGLQFPVGRIHRLLRNGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNA 69

Query:   417 ASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
             A    K   R+ PR + LA+R+D++L  L   VT+++GGV+P++   L  K K+ KKA
Sbjct:    70 ARDNKKT--RIIPRHLQLAIRNDEELNKLPSGVTIAQGGVLPNIQAVLLPK-KTEKKA 124


>sp|P02269|H2A_ASTRU HISTONE H2A >pir||HSSF2 histone H2A - starfish (Asterias
            rubens)
            Length = 124

  Minus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 9.4e-23, P = 9.4e-23
 Identities = 56/112 (50%), Positives = 79/112 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   LR+G YA R+GA   VY+AAV+EYL AE+LEL+  AA    K 
Sbjct:    16 RSSRAGLQFPVGRVHRFLRKGNYAERVGAGAPVYLAAVMEYLAAEILELAGNAARDNKKT 75

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K K++K A+
Sbjct:    76 --RINPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KTAKAAK 124


>gnl|PID|e217760 (X94693) histone H2A [Triticum aestivum]
            Length = 135

  Minus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 9.4e-23, P = 9.4e-23
 Identities = 57/110 (51%), Positives = 76/110 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L+ G+YA R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKK 247
               R+ PR + LAVR+D++L  LL   T++ GGVMP++++ L  K  SS K
Sbjct:    79 --RIVPRHIQLAVRNDEELTKLLGGATIASGGVMPNIHQHLLPKKASSSK 126


>sp|P04908|H2A5_HUMAN HISTONE H2A.5 >gi|32111 (X00089) histone H2a [Homo
            sapiens]
            Length = 130

  Minus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.2e-22, P = 1.2e-22
 Identities = 58/112 (51%), Positives = 80/112 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+  Y+ R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKAHYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAK 128


>sp|Q00728|H2AT_RAT HISTONE H2A, TESTIS >pir||S26188 histone H2A, testis - rat
            >gi|57354 (X59962) TH2A histone [Rattus norvegicus]
            Length = 130

  Minus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.2e-22, P = 1.2e-22
 Identities = 60/112 (53%), Positives = 80/112 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS +AGL FPVGRV  LLR+G YA RIGA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSFRAGLQFPVGRVHRLLRQGNYAERIGAGTPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  K++
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKSQ 128


>gi|2072004 (U95113) Histone H2a [Rattus norvegicus]
            Length = 130

  Minus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.2e-22, P = 1.2e-22
 Identities = 58/112 (51%), Positives = 81/112 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LL +G Y+ R+GAS  VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLYKGNYSERVGASAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  K++
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKSK 128


>sp|P35063|H2A_PICAB HISTONE H2A >pir||S30155 histone H2A - Norway spruce
            >gi|297871 (X67819) histone H2A [Picea abies]
            Length = 138

  Minus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 57/109 (52%), Positives = 76/109 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS KAGL FPVGR+   L+ G+YA R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    21 RSQKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKN 80

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSK 250
               R+ PR + LAVR+D++L  LL  VT++ GGV+P++++ L  K KS K
Sbjct:    81 --RIVPRHIQLAVRNDEELSKLLGAVTIANGGVLPNIHQVLLPK-KSGK 126


>sp|Q02874|H2AM_RAT HISTONE MACRO-H2A.1 >pir||I80811 histone H2A.1 - rat
            >gi|205276 (M99065) histone H2A.1 [Rattus norvegicus]
            Length = 368

  Minus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 62/116 (53%), Positives = 81/116 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAG+IFPVGR+   +++G    RIG    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    15 RSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKG 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLN-KALAKKHKSSKKARA--TP 232
               R+TPR + LAV +D++L  LLK VT++ GGV+P+++ + LAKK  S  K  A  TP
Sbjct:    75 --RVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITP 130


>gi|1711126 (U79139) histone macroH2A1.2 [Rattus norvegicus]
            Length = 371

  Minus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 62/116 (53%), Positives = 81/116 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAG+IFPVGR+   +++G    RIG    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    15 RSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKG 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLN-KALAKKHKSSKKARA--TP 232
               R+TPR + LAV +D++L  LLK VT++ GGV+P+++ + LAKK  S  K  A  TP
Sbjct:    75 --RVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITP 130


>gi|3341992 (AF054174) histone macroH2A1.2 [Homo sapiens]
            Length = 371

  Minus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 62/116 (53%), Positives = 81/116 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAG+IFPVGR+   +++G    RIG    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    15 RSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKG 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLN-KALAKKHKSSKKARA--TP 232
               R+TPR + LAV +D++L  LLK VT++ GGV+P+++ + LAKK  S  K  A  TP
Sbjct:    75 --RVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITP 130


>gi|3395778 (AF058444) truncated histone macroH2A1 [Gallus gallus]
            Length = 223

  Minus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 62/116 (53%), Positives = 81/116 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAG+IFPVGR+   +++G    RIG    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    15 RSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKG 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLN-KALAKKHKSSKKARA--TP 232
               R+TPR + LAV +D++L  LLK VT++ GGV+P+++ + LAKK  S  K  A  TP
Sbjct:    75 --RVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITP 130


>gi|3395780 (AF058445) histone macroH2A1.1 [Gallus gallus]
            Length = 369

  Minus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 62/116 (53%), Positives = 81/116 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAG+IFPVGR+   +++G    RIG    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    15 RSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKG 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLN-KALAKKHKSSKKARA--TP 232
               R+TPR + LAV +D++L  LLK VT++ GGV+P+++ + LAKK  S  K  A  TP
Sbjct:    75 --RVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITP 130


>gi|3395782 (AF058446) histone macroH2A1.2 [Gallus gallus]
            Length = 372

  Minus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 62/116 (53%), Positives = 81/116 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSAKAG+IFPVGR+   +++G    RIG    VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    15 RSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKG 74

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLN-KALAKKHKSSKKARA--TP 232
               R+TPR + LAV +D++L  LLK VT++ GGV+P+++ + LAKK  S  K  A  TP
Sbjct:    75 --RVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITP 130


>sp|P04736|H2A2_PSAMI LATE HISTONE H2A.2.1 >pir||A25077 histone H2A.2 - sea
            urchin (Psammechinus miliaris) >gi|161358 (M14140) histone H2A-2.1
            [Psammechinus miliaris]
            Length = 124

  Minus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.0e-22, P = 2.0e-22
 Identities = 57/111 (51%), Positives = 77/111 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   L++G Y  R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRFLKKGNYGNRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K+ K A
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQTVLLPK-KTGKSA 124


>gi|161362 (M11085) histone H2A-2 [Psammechinus miliaris]
           Length = 124

  Minus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.0e-22, P = 2.0e-22
 Identities = 57/111 (51%), Positives = 77/111 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   L++G Y  R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRFLKKGNYGNRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K+ K A
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK-KTGKSA 124


>pir||HSHUA5 histone H2A.5 - human
            Length = 129

  Minus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.0e-22, P = 2.0e-22
 Identities = 58/112 (51%), Positives = 80/112 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+  Y+ R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRLLRKXXYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  KK +S  KA+
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAK 127


>sp|P19178|H2A_PLADU HISTONE H2A >pir||S11314 histone H2A - polychaete
            (Platynereis dumerilii) >gi|9820 (X53330) H2A protein (AA 1 - 124)
            [Platynereis dumerilii]
            Length = 124

  Minus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.5e-22, P = 2.5e-22
 Identities = 55/109 (50%), Positives = 78/109 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+  LLR+G YA R+GA   VY+AAV+EYL AE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKT 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSK 250
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K K++K
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KTTK 122


>gnl|PID|e348142 (Z70750) C50F4.13 [Caenorhabditis elegans]
            Length = 127

  Minus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.5e-22, P = 2.5e-22
 Identities = 55/110 (50%), Positives = 77/110 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+  +LR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKK 247
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K  +  K
Sbjct:    79 --RIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTAGDK 126


>gi|2317760 (AF013803) H2A homolog [Pinus taeda]
            Length = 139

  Minus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.5e-22, P = 2.5e-22
 Identities = 56/111 (50%), Positives = 75/111 (67%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L+ G+YA R+G    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    20 RSSKAGLQFPVGRIARFLKAGKYAERVGGGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 79

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
               R+ PR + LAVR+D++L  LL  VT++ GGVMP+++  L  K  +S  A
Sbjct:    80 --RIVPRHIQLAVRNDEELSKLLGAVTIANGGVMPNIHNILLPKKTASSGA 128


>sp|P04735|H2A1_PSAMI LATE HISTONE H2A.1 >gi|161360 (M11084) histone H2A-1
            [Psammechinus miliaris]
            Length = 125

  Minus Strand HSPs:

 Score = 265 (93.3 bits), Expect = 3.2e-22, P = 3.2e-22
 Identities = 56/112 (50%), Positives = 79/112 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   L++G Y  R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRVHRFLKKGNYGSRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K K++K ++
Sbjct:    77 --RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK-KTAKASK 125


>sp|P09588|H2A_CAEEL HISTONE H2A >pir||HSKW2A histone H2A - Caenorhabditis
            elegans >gi|6754 (X15633) histone protein [Caenorhabditis elegans]
            >gi|1072158 (U40934) identical to C. elegans his-12 (SP:P09588)
            [Caenorhabditis elegans] >gnl|PID|e242355 (Z73102) B0035.7
            [Caenorhabditis elegans] >gi|1326370 (U58750) coded for by C.
            elegans cDNA yk75f11.3; coded for by C. elegans cDNA yk75f11.5;
            Similar to Histone. [Caenorhabditis elegans] >gi|1458294 (U64843)
            Similar to histone H2A. [Caenorhabditis elegans] >gi|1458297
            (U64843) Similar to histone H2A. [Caenorhabditis elegans]
            >gi|1458311 (U64845) Similar to histone H2A; coded for by C.
            elegans cDNA yk94b8.5 [Caenorhabditis elegans] >gnl|PID|e276250
            (Z81128) T23D8.6 [Caenorhabditis elegans] >gnl|PID|e1180973
            (Z83245) ZK131.6 [Caenorhabditis elegans] >gnl|PID|e1180975
            (Z83245) ZK131.10 [Caenorhabditis elegans] >gnl|PID|e330477
            (Z82271) F54E12.5 [Caenorhabditis elegans] >gnl|PID|e1247011
            (Z92789) H02I12.7 [Caenorhabditis elegans] >gnl|PID|e1188322
            (Z93388) T10C6.12 [Caenorhabditis elegans] >gi|2935371 (AF047656)
            F17E9.13 gene product [Caenorhabditis elegans]
            Length = 127

  Minus Strand HSPs:

 Score = 265 (93.3 bits), Expect = 3.2e-22, P = 3.2e-22
 Identities = 55/110 (50%), Positives = 76/110 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+  +LR+G YA+R+GA   VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    19 RSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 78

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKK 247
               R+ PR + LAVR+D++L  LL  VT+++GGV+P++   L  K     K
Sbjct:    79 --RIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTGGDK 126


>sp|P09589|H2A3_LYTPI HISTONE H2A, SPERM >pir||HSURA2 histone H2A, sperm - sea
            urchin (Lytechinus pictus) (fragment) >gi|161314 (M13637) histone
            H2a [Lytechinus pictus]
            Length = 112

  Minus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 4.1e-22, P = 4.1e-22
 Identities = 57/109 (52%), Positives = 77/109 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV   LR+G YA+R+GA   VY+AAV EYL AE+LEL+  AA    K 
Sbjct:     4 RSSRAGLQFPVGRVHRFLRKGNYAQRVGAGAPVYLAAVFEYLAAEILELAGNAAPDNKKT 63

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKH--KSSK 250
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K   KSSK
Sbjct:    64 --RIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTAKSSK 112


>gnl|PID|e1297163 (AJ006768) histone H2A [Cicer arietinum]
            Length = 139

  Minus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 5.2e-22, P = 5.2e-22
 Identities = 53/104 (50%), Positives = 74/104 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L+ G+YA R+GA   VY++AVLEYL AE+LEL+  AA     K
Sbjct:    22 RSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDN--K 79

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
               R+ PR + LAVR+D++L  LL  VT++ GGV+P++++ L  K
Sbjct:    80 NNRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLPK 123


>sp|P02273|H2A1_TETPY HISTONE H2A.1 >pir||HSTE91 histone H2A.1 - Tetrahymena
            pyriformis (SGC5) >prf||0906228A histone H2A(1) [Tetrahymena
            pyriformis]
            Length = 137

  Minus Strand HSPs:

 Score = 262 (92.2 bits), Expect = 6.6e-22, P = 6.6e-22
 Identities = 53/114 (46%), Positives = 79/114 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSA+AGL FPVGR+   L+ G+Y+ RIG    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    21 RSARAGLQFPVGRISRFLKHGRYSERIGTGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 80

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL--AKKHKSSKKARAT 235
               R+ PR + LA+R+D++L  L+ + T++ GGV+P++N  L  +K  K+  + +A+
Sbjct:    81 --RIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPMLLPSKSKKTESRGQAS 134


>sp|P35064|H2A1_TETTH HISTONE H2A.1 >pir||S41471 histone H2A.1 - Tetrahymena
            thermophila (SGC5) >gi|310870 (L18892) histone H2A.1 [Tetrahymena
            thermophila]
            Length = 138

  Minus Strand HSPs:

 Score = 261 (91.9 bits), Expect = 8.4e-22, P = 8.4e-22
 Identities = 52/114 (45%), Positives = 79/114 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSA+AGL FPVGR+   L+ G+Y+ R+G    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    22 RSARAGLQFPVGRISRFLKHGRYSERVGTGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 81

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL--AKKHKSSKKARAT 235
               R+ PR + LA+R+D++L  L+ + T++ GGV+P++N  L  +K  K+  + +A+
Sbjct:    82 --RIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPMLLPSKSKKTESRGQAS 135


>gi|1922944 (AC000106) Strong similarity to Picea histone H2A (gb|X67819). ESTs
            gb|ATTS3874,gb|T46627,gb|T14194 come from this gene. [Arabidopsis
            thaliana]
            Length = 142

  Minus Strand HSPs:

 Score = 260 (91.5 bits), Expect = 1.1e-21, P = 1.1e-21
 Identities = 52/101 (51%), Positives = 73/101 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L+ G+YA R+GA   VY++AVLEYL AE+LEL+  AA    K 
Sbjct:    25 RSSKAGLQFPVGRIARFLKSGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKT 84

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL 274
               R+ PR + LAVR+D++L  LL  VT++ GGV+P++++ L
Sbjct:    85 --RIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTL 123


>sp|P35065|H2A2_TETTH HISTONE H2A.2 >pir||S41472 histone H2A.2 - Tetrahymena
            thermophila (SGC5) >gi|310872 (L18893) histone H2A.2 [Tetrahymena
            thermophila]
            Length = 133

  Minus Strand HSPs:

 Score = 258 (90.8 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 53/109 (48%), Positives = 77/109 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSA+AGL FPVGR+   L+ G+Y+ RIG    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    22 RSARAGLQFPVGRISRFLKNGRYSERIGTGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 81

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL--AKKHKSSK 250
               R+ PR + LA+R+D++L  L+ + T++ GGV+P++N  L  +K  KS++
Sbjct:    82 --RIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPMLLPSKTKKSTE 130


>sp|P02274|H2A2_TETPY HISTONE H2A.2 >pir||HSTE92 histone H2A.2 - Tetrahymena
            pyriformis (SGC5) >prf||0906228B histone H2A(2) [Tetrahymena
            pyriformis]
            Length = 132

  Minus Strand HSPs:

 Score = 258 (90.8 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 53/109 (48%), Positives = 77/109 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RSA+AGL FPVGR+   L+ G+Y+ RIG    VY+AAVLEYL AE+LEL+  AA    K 
Sbjct:    21 RSARAGLQFPVGRISRFLKNGRYSERIGTGAPVYLAAVLEYLAAEVLELAGNAAKDNKKT 80

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL--AKKHKSSK 250
               R+ PR + LA+R+D++L  L+ + T++ GGV+P++N  L  +K  K+S+
Sbjct:    81 --RIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPMLLPSKTKKTSE 129


>sp|P06898|H2A2_XENLA HISTONE H2A.2 >pir||I51445 histone H2A - African clawed
            frog >gi|64769 (X03017) H2A (aa 1-130) [Xenopus laevis] >gi|455386
            (M21286) histone H2A [Xenopus laevis]
            Length = 130

  Minus Strand HSPs:

 Score = 256 (90.1 bits), Expect = 2.9e-21, P = 2.9e-21
 Identities = 56/113 (49%), Positives = 81/113 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+ +   +  K+
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAWERLPEITKR 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALA-KKHKSSKKARA 238
             P  L+P T   ++ +D++L  LL  VT+++GGV+P++   L  KK +SSK  ++
Sbjct:    78 PV-LSPGTCN-SLCNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKSTKS 129


>gi|2564109 (AF007904) histone H2A [Chaetopterus variopedatus]
            Length = 125

  Minus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 3.7e-21, P = 3.7e-21
 Identities = 54/112 (48%), Positives = 76/112 (67%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGR+  LLR+G YA R  A    Y+AAV+EYL AE+LEL+  AA    K 
Sbjct:    17 RSSRAGLQFPVGRIHRLLRKGNYAERARAGAPAYLAAVMEYLAAEVLELAGNAARDNKKS 76

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKAR 241
               R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K K+ K A+
Sbjct:    77 --RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KTQKPAK 125


>sp|Q12692|H2AV_YEAST PROBABLE HISTONE H2A VARIANT >pir||S66694 hypothetical
            protein YOL012c - yeast (Saccharomyces cerevisiae) >gnl|PID|e251837
            (Z74754) ORF YOL012c [Saccharomyces cerevisiae]
            Length = 134

  Minus Strand HSPs:

 Score = 250 (88.0 bits), Expect = 1.2e-20, P = 1.2e-20
 Identities = 58/109 (53%), Positives = 77/109 (70%), Frame = -1

Query:   573 SAKAGLIFPVGRVGSLLRRGQYAR-RIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             SA+AGL FPVGR+   L+R    R R+G+  A+Y+ AVLEYLTAE+LEL+  AA     K
Sbjct:    26 SARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDL--K 83

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK--HKSSKK 247
              KR+TPR + LA+R DD+L  L++  T++ GGV+P +NKAL  K   K SKK
Sbjct:    84 VKRITPRHLQLAIRGDDELDSLIR-ATIASGGVLPHINKALLLKVEKKGSKK 134


>bbs|155301 histone H2A homolog [Phaseolus vulgaris, Great Northern, immature
            embryos, Peptide Partial, 146 aa]
            Length = 146

  Minus Strand HSPs:

 Score = 248 (87.3 bits), Expect = 2.0e-20, P = 2.0e-20
 Identities = 51/109 (46%), Positives = 74/109 (67%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS+KAGL FPVGR+   L+ G+YA+R+G+   VY++AVLEYL AE+LEL+  AA    K 
Sbjct:    26 RSSKAGLQFPVGRIARYLKAGRYAQRVGSGSPVYLSAVLEYLAAEVLELAGIAARDNKKS 85

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSK 250
               R+ PR + LAVR+D++L  L+  VT++ GGV+P  +  +    K+ K
Sbjct:    86 --RIIPRHIQLAVRNDEELSKLMGSVTIASGGVLPKNSSKICCPRKTGK 132


>gi|578566 (X06725) hv1 histone (AA 8-145) [Tetrahymena thermophila]
           Length = 138

  Minus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 2.6e-20, P = 2.6e-20
 Identities = 55/113 (48%), Positives = 79/113 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS KAGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    22 RSYKAGLQFPVGRIHRFLKGRVSAKNRVGATAAVYAAAILEYLTAEVLELAGNASKDF-- 79

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
             K +R+TPR + LA+R D++L +L+K  T++ GGV+P ++KAL  KH +  ++ A
Sbjct:    80 KVRRITPRHLLLAIRGDEELDILIK-ATIAGGGVIPHIHKALLGKHSTKNRSSA 132


>sp|P08992|H2AV_TETTH HISTONE H2A VARIANT >pir||S08210 histone H2A.hv1 -
            Tetrahymena thermophila (SGC5) >gi|10823 (X15548) histone H2A
            protein [Tetrahymena thermophila]
            Length = 146

  Minus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 2.6e-20, P = 2.6e-20
 Identities = 55/113 (48%), Positives = 79/113 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS KAGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    30 RSYKAGLQFPVGRIHRFLKGRVSAKNRVGATAAVYAAAILEYLTAEVLELAGNASKDF-- 87

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
             K +R+TPR + LA+R D++L +L+K  T++ GGV+P ++KAL  KH +  ++ A
Sbjct:    88 KVRRITPRHLLLAIRGDEELDILIK-ATIAGGGVIPHIHKALLGKHSTKNRSSA 140


>gnl|PID|e285265 (Y09951) histone H2a [Anopheles gambiae]
            Length = 107

  Minus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 2.6e-20, P = 2.6e-20
 Identities = 51/104 (49%), Positives = 73/104 (70%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS +AGL FPVGR+  LLR+G YA R+G    VY+AAV+EYL AE+LEL+   A    KK
Sbjct:     2 RSNRAGLQFPVGRIHRLLRKGNYAERVGPGAPVYLAAVMEYLAAEVLELAGNRARDN-KK 60

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
              +R+ PR + LA+R+D++   LL+ VT+++GGV+P++   L  K
Sbjct:    61 ERRIIPR-LQLAIRNDEEENKLLRRVTIAQGGVLPNIQAVLLPK 103


>sp|P08991|H2AV_STRPU HISTONE H2A VARIANT >pir||S07392 histone H2A.F/Z - sea
            urchin (Strongylocentrotus purpuratus) >gi|829221 (X05547) histone
            H2 A.F/Z [Strongylocentrotus purpuratus]
            Length = 125

  Minus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 2.3e-19, P = 2.3e-19
 Identities = 56/111 (50%), Positives = 79/111 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYAR-RIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RSA+AGL FPVGR+   L+    +  R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    17 RSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL-- 74

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
             K KR+TPR + LA+R D++L  L+K  T++ GGV+P ++K+L  K K S+KA
Sbjct:    75 KVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGK-KGSQKA 124


>sp|P48003|H2AV_SCHPO HISTONE H2A VARIANT >pir||S52560 histone H2A variant Pht1
            - fission yeast (Schizosaccharomyces pombe) >bbs|158788 (S74633)
            histone H2A variant [Schizosaccharomyces pombe=fission yeast,
            Peptide, 171 aa] [Schizosaccharomyces pombe] >gnl|PID|d1022224
            (AB004534) HISTONE H2A VARIANT [Schizosaccharomyces pombe]
            Length = 171

  Minus Strand HSPs:

 Score = 234 (82.4 bits), Expect = 6.1e-19, P = 6.1e-19
 Identities = 55/105 (52%), Positives = 73/105 (69%), Frame = -1

Query:   573 SAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             SA+AGL FPVGRV   L+ + Q   R+GA  AVY AAVLEYLTAE+LEL+  AA     K
Sbjct:    59 SARAGLQFPVGRVRRFLKAKTQNNMRVGAKSAVYSAAVLEYLTAEVLELAGNAAKDL--K 116

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHK 259
              KR+TPR + LA+R D++L  L++  T++ GGV+P +NK L  + K
Sbjct:   117 VKRITPRHLQLAIRGDEELDTLIR-ATIAGGGVLPHINKQLLIRTK 161


>gi|1397320 (U61953) Similar to histone H2A variant [Caenorhabditis elegans]
            Length = 140

  Minus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 7.8e-19, P = 7.8e-19
 Identities = 54/110 (49%), Positives = 76/110 (69%), Frame = -1

Query:   594 KG*VCGRSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKA 418
             K  V  RSA+AGL FPVGR+   L+ R   + R+GA+ AVY AA+LEYLTAE+LEL+  A
Sbjct:    16 KSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNA 75

Query:   417 ASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
             +     K KR+TPR + LA+R D++L  L+K  T++ GGV+P +++ L  K
Sbjct:    76 SKDL--KVKRITPRHLHLAIRGDEELDTLIK-ATIAGGGVIPHIHRYLMNK 123


>gnl|PID|e268229 (Z80777) none [Homo sapiens]
            Length = 115

  Minus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 7.8e-19, P = 7.8e-19
 Identities = 51/100 (51%), Positives = 70/100 (70%), Frame = -1

Query:   573 SAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKKP 394
             S++AGL F VGRV  LLR+G YA+R+ A   VY+ AVLEYLTA++LEL+  AA     K 
Sbjct:    14 SSRAGLQFSVGRVHRLLRKGNYAKRVRAGAPVYLEAVLEYLTAKILELAGNAARD---KK 70

Query:   393 KRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL 274
              R+TPR + LA+ HD+ L  LL  VT+++GGV+P++   L
Sbjct:    71 TRVTPRRLQLAI-HDEKLNKLLGKVTIAQGGVLPNIQAVL 109


>pir||S04565 histone H2A - chicken (fragment) >gi|63439 (X07763) histone H2A
            [Gallus gallus]
            Length = 102

  Minus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 1.0e-18, P = 1.0e-18
 Identities = 50/87 (57%), Positives = 63/87 (72%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGMLLKDVT 316
               R+ PR + LA+R+D++L  LL  VT
Sbjct:    78 --RIIPRHLQLAIRNDEELNKLLGKVT 102


>sp|P08985|H2AV_DROME HISTONE H2A VARIANT >pir||S08118 histone H2A.vD - fruit
            fly (Drosophila melanogaster) >gi|8040 (X07485) histone H2A variant
            (AA 1-141) [Drosophila melanogaster] >gi|295749 (X15549) histone
            H2A [Drosophila melanogaster]
            Length = 141

  Minus Strand HSPs:

 Score = 229 (80.6 bits), Expect = 2.1e-18, P = 2.1e-18
 Identities = 54/107 (50%), Positives = 77/107 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RSA+AGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    20 RSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL-- 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKAL-AKKHKS 256
             K KR+TPR + LA+R D++L  L+K  T++ GGV+P ++K+L  KK ++
Sbjct:    78 KVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKEET 125


>sp|P02272|H2AV_CHICK HISTONE H2A VARIANT >pir||S03282 histone H2A.F - chicken
            >gi|63466 (V00414) histone H2A [Gallus gallus] >gi|3420799
            (AF081192) histone H2A.F/Z variant [Homo sapiens]
            Length = 128

  Minus Strand HSPs:

 Score = 228 (80.3 bits), Expect = 2.7e-18, P = 2.7e-18
 Identities = 54/111 (48%), Positives = 75/111 (67%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS +AGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    20 RSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL-- 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
             K KR+TPR + LA+R D++L  L+K  T++ GGV+P ++K+L  K    K A
Sbjct:    78 KVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKTA 128


>pir||HSCH2F histone H2A.F, embryonic - chicken
            Length = 127

  Minus Strand HSPs:

 Score = 228 (80.3 bits), Expect = 2.7e-18, P = 2.7e-18
 Identities = 54/111 (48%), Positives = 75/111 (67%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS +AGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    19 RSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL-- 76

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKA 244
             K KR+TPR + LA+R D++L  L+K  T++ GGV+P ++K+L  K    K A
Sbjct:    77 KVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQKTA 127


>gi|1228074 (X95763) histone h2a homologue [Allium cepa]
            Length = 122

  Minus Strand HSPs:

 Score = 226 (79.6 bits), Expect = 4.3e-18, P = 4.3e-18
 Identities = 47/99 (47%), Positives = 68/99 (68%), Frame = -1

Query:   525 LRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKKPKRLTPRTVTLAVRHDD 346
             L++G+YA+R+G    VY+AAVLEYL AE+LEL+  AA    K   R+ PR V LA+R+D+
Sbjct:     3 LKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAAKDNKKN--RIIPRHVLLAIRNDE 60

Query:   345 DLGMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPS 229
             +LG LL  VT++ GGV+P++N  L  K  ++K  R + S
Sbjct:    61 ELGKLLGGVTIAHGGVLPNINPVLLPKKIAAKGIRDSKS 99


>gnl|PID|e276299 (X98536) variant histone H2A.Zl2 [Xenopus laevis] >gi|1685280
            (U77893) histone H2A.Z variant [Xenopus laevis] >gnl|PID|e276297
            (X98535) variant histone H2A.Zl1 [Xenopus laevis]
            Length = 128

  Minus Strand HSPs:

 Score = 226 (79.6 bits), Expect = 4.3e-18, P = 4.3e-18
 Identities = 51/109 (46%), Positives = 75/109 (68%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYAR-RIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS++AGL FPVGR+  LL+    +  R+G + AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    20 RSSRAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDL-- 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSK 250
             K KR++PR + LA+R D++L  L+K  T++ GGV+P ++K+L  K    K
Sbjct:    78 KVKRISPRHLQLAIRGDEELDALIK-ATIAGGGVIPHIHKSLIGKKGQQK 126


>gnl|PID|e332393 (Y12575) histone H2A.F/Z [Arabidopsis thaliana]
            Length = 136

  Minus Strand HSPs:

 Score = 226 (79.6 bits), Expect = 4.3e-18, P = 4.3e-18
 Identities = 51/104 (49%), Positives = 74/104 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYAR-RIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RSA+AG+ FPVGR+   L+    A  R+GA+ AVY A++LEYLTAE+LEL+  A+     
Sbjct:    31 RSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDL-- 88

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
             K KR+TPR + LA+R D++L  L+K  T++ GGV+P ++K+L  K
Sbjct:    89 KVKRITPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINK 132


>sp|P17317|H2AZ_HUMAN HISTONE H2A.Z >pir||S03642 histone H2A.Z - bovine
            >pir||S03644 histone H2A.Z - rat >pir||A35881 histone H2A.Z - human
            >gi|410 (X52318) histone H2A.Z (AA 1-127) [Bos taurus] >gi|31975
            (X52317) histone H2A.Z (AA 1-127) [Homo sapiens] >gi|57808 (X52316)
            histone H2A.Z (AA 1-127) [Rattus sp.] >gi|163150 (M37585) histone
            (H2A.Z) [Bos taurus] >gi|184060 (M37583) histone (H2A.Z) [Homo
            sapiens] >gi|204599 (M37584) histone (H2A.Z) [Rattus norvegicus]
            >gi|1575713 (U70494) histone H2A.Z [Mus musculus]
            Length = 128

  Minus Strand HSPs:

 Score = 225 (79.2 bits), Expect = 5.5e-18, P = 5.5e-18
 Identities = 53/109 (48%), Positives = 74/109 (67%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS +AGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    20 RSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL-- 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKSSK 250
             K KR+TPR + LA+R D++L  L+K  T++ GGV+P ++K+L  K    K
Sbjct:    78 KVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQK 126


>gi|971976 (F14542) histone H2B and H2A [Sus scrofa]
           Length = 111

  Minus Strand HSPs:

 Score = 225 (79.2 bits), Expect = 5.5e-18, P = 5.5e-18
 Identities = 50/91 (54%), Positives = 65/91 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDDLGML-LKDVTLSRG 304
               R+ PR + LA+R+D++L    L  VT++ G
Sbjct:    78 --RIIPRHLQLAIRNDEELNKAYLGRVTIASG 107


>gi|3108211 (AF030235) histone H2A.F/Z variant [Oryctolagus cuniculus]
            Length = 123

  Minus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.4e-17, P = 2.4e-17
 Identities = 51/104 (49%), Positives = 72/104 (69%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS +AGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE+LEL+  A+     
Sbjct:    20 RSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL-- 77

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKK 265
             K KR+TPR + LA+R D++L  L+K  T++ GG +P ++K+L  K
Sbjct:    78 KVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGAIPHIHKSLIGK 121


>pir||S19241 histone H2A (clone CH1-10) - chicken (fragment) >gi|63433 (X07766)
            histone H2A [Gallus gallus]
            Length = 96

  Minus Strand HSPs:

 Score = 218 (76.7 bits), Expect = 3.0e-17, P = 3.0e-17
 Identities = 46/78 (58%), Positives = 58/78 (74%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKK 397
             RS++AGL FPVGRV  LLR+G YA R+GA   VYMAAVLEYLTAE+LEL+  AA    K 
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKT 77

Query:   396 PKRLTPRTVTLAVRHDDD 343
               R+ PR + LA+R+D++
Sbjct:    78 --RIIPRHLQLAIRNDEE 93


>sp|P09590|H2A3_STRPU HISTONE H2A-BETA, SPERM >pir||HSURA1 histone H2A-beta,
            sperm - sea urchin (Strongylocentrotus purpuratus) (fragment)
            >gi|161492 (M13636) histone H2a-beta [Strongylocentrotus
            purpuratus]
            Length = 88

  Minus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 6.3e-17, P = 6.3e-17
 Identities = 47/88 (53%), Positives = 60/88 (68%), Frame = -1

Query:   594 KG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAA 415
             KG    RS++AGL FPVGRV   LR+G YA R+GA   VY+AAVLEYL AE+LEL+  AA
Sbjct:     3 KGKAKRRSSRAGLQFPVGRVHRFLRKGNYANRVGAGAPVYLAAVLEYLAAEILELAGNAA 62

Query:   414 SQQAKKPKRLTPRTVTLAVRHDDDLGML 331
                 K   R+ PR + LA+R+D++L  L
Sbjct:    63 RDNKKT--RIIPRHLQLAIRNDEELNKL 88


>gnl|PID|e214013 (Z68222) ZK1251.1 [Caenorhabditis elegans]
            Length = 145

  Minus Strand HSPs:

 Score = 208 (73.2 bits), Expect = 3.5e-16, P = 3.5e-16
 Identities = 51/109 (46%), Positives = 72/109 (66%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR---RGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQ 406
             RS ++GL FPVGR+   LR   RG+  +RI A  +V+MAA LEYLT EL+E+S  AA++ 
Sbjct:    30 RSTRSGLTFPVGRIHRKLRETTRGK--QRISAGASVFMAATLEYLTTELMEMSAIAANES 87

Query:   405 AKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPS-LNKALAKKHKSSK 250
              K   R+TPR + LA+  D +   LL  VTL +GGV P  ++ +L  K K+ +
Sbjct:    88 KKS--RVTPRHLHLAIYGDQETAQLLDKVTLPQGGVTPMPIHPSLLPKKKAKE 138


>gi|940450 (Z28692) HISTONE H2A VARIANT [Arabidopsis thaliana]
           Length = 120

  Minus Strand HSPs:

 Score = 189 (66.5 bits), Expect = 3.6e-14, P = 3.6e-14
 Identities = 46/93 (49%), Positives = 62/93 (66%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYAR-RIGASGAVYMAAVLEYLTAELLELSVKAASQQAK 400
             RS++AGL FPVGRV  LL+    A  R+GA+ AVY AA+LEYLTAE+LE        +  
Sbjct:    30 RSSRAGLQFPVGRVHRLLKTRFTAHGRVGATAAVYXAAILEYLTAEVLEXX--GXXSKDL 87

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGV 298
             K KR++P    LA+R D++L  L+K  T++ GGV
Sbjct:    88 KVKRISPXHXQLAIRGDEELDXLIKG-TIAPGGV 120


>gi|578471 (V01144) reading frame H2A (6700 is 1st base in codon); pid:g578471
           [Psammechinus miliaris]
           Length = 95

  Minus Strand HSPs:

 Score = 172 (60.5 bits), Expect = 2.3e-12, P = 2.3e-12
 Identities = 37/67 (55%), Positives = 47/67 (70%), Frame = -1

Query:   540 RVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAASQQAKKPKRLTPRTVTLA 361
             RV   LR+G YA+R+G    VYMAAVLEYLTAE+LEL+  AA    K   R+ PR + LA
Sbjct:    29 RVHRFLRKGNYAKRVGGGAPVYMAAVLEYLTAEILELAGNAARDNKKS--RIIPRHLQLA 86

Query:   360 VRHDDDL 340
             VR+D++L
Sbjct:    87 VRNDEEL 93


>gi|157616 (M32467) histone (H2A) homologue; putative [Drosophila virilis]
           Length = 75

  Minus Strand HSPs:

 Score = 164 (57.7 bits), Expect = 1.6e-11, P = 1.6e-11
 Identities = 35/66 (53%), Positives = 44/66 (66%), Frame = -1

Query:   597 LKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKA 418
             +KG    RS +AGL FPVGR+    R+G YA R+GA   VY+AAV+EYL AE+LEL+  A
Sbjct:    10 VKGKAKSRSNRAGLQFPVGRIHRHQRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNA 69

Query:   417 ASQQAK 400
             A    K
Sbjct:    70 ARDNKK 75


>gnl|PID|e280521 (Y09115) Histone H2A [Trypanosoma cruzi]
            Length = 37

  Minus Strand HSPs:

 Score = 163 (57.4 bits), Expect = 2.0e-11, P = 2.0e-11
 Identities = 34/37 (91%), Positives = 35/37 (94%), Frame = -1

Query:   336 MLLKDVTLSRGGVMPSLNKALAKKHKSSKKARATPSA 226
             MLLKDVTLSRGGVMPSLNKAL KKHKSSKKA+AT SA
Sbjct:     1 MLLKDVTLSRGGVMPSLNKALEKKHKSSKKAKATSSA 37


>pir||I50651 histone H2A - chicken (fragment) >gi|63437 (X07762) histone H2A
            [Gallus gallus]
            Length = 63

  Minus Strand HSPs:

 Score = 162 (57.0 bits), Expect = 2.6e-11, P = 2.6e-11
 Identities = 32/46 (69%), Positives = 38/46 (82%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAEL 439
             RS++AGL FPVGRV  LLR+G YA R+GA   VY+AAVLEYLTAE+
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEI 63


>gnl|PID|e1173147 (X14215) H2A histone [Drosophila melanogaster]
            Length = 63

  Minus Strand HSPs:

 Score = 159 (56.0 bits), Expect = 5.4e-11, P = 5.4e-11
 Identities = 32/54 (59%), Positives = 40/54 (74%), Frame = -1

Query:   597 LKG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELL 436
             +KG    RS +AGL FPVGR+  LLR+G YA R+GA   VY+AAV+EYL AE+L
Sbjct:    10 VKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63


>sp|P98176|H2AL_HUMAN HYPOTHETICAL 12.7 KD HISTONE H2A RELATED PROTEIN
            >gi|976083 (X86012) Histone H2A related [Homo sapiens]
            Length = 115

  Minus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 1.1e-10, P = 1.1e-10
 Identities = 35/96 (36%), Positives = 55/96 (57%), Frame = -1

Query:   594 KG*VCGRSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAA 415
             +G  C R+ +A L F V +V   LR G YA+R+  +  VY+AAV+EYLTA++ EL+   A
Sbjct:    16 RGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVPELAGNEA 75

Query:   414 SQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSR 307
                 ++   +TP  + + V +D  L  L    T+S+
Sbjct:    76 QNSGER--NITPLLLDMVVHNDRLLSTLFNTTTISQ 109


>pir||I37466 histone H2A - human (fragment) >gi|510990 (X57985) histone H2A
            [Homo sapiens]
            Length = 57

  Minus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 9.1e-09, P = 9.1e-09
 Identities = 28/40 (70%), Positives = 32/40 (80%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLE 457
             RS++AGL FPVGRV  LLR+G YA R+GA   VYMAAVLE
Sbjct:    18 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLE 57


>gnl|PID|e1173152 (X14215) H2A histone [Drosophila melanogaster]
            Length = 61

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 2.2e-06, P = 2.2e-06
 Identities = 27/64 (42%), Positives = 41/64 (64%), Frame = -1

Query:   435 ELSVKAASQQAKKPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRGGVMPSLNKALAKKHKS 256
             EL+  AA    K   R+ PR + LA+R+D++L  LL  VT+++GGV+P++   L  K K+
Sbjct:     1 ELAGNAARDNKKT--RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK-KT 57

Query:   255 SKKA 244
              KKA
Sbjct:    58 EKKA 61


>pir||I79341 histone H2A - human (fragment) >gi|183758 (K01889) histone H2A
            [Homo sapiens]
            Length = 47

  Minus Strand HSPs:

 Score = 112 (39.4 bits), Expect = 8.6e-06, P = 8.6e-06
 Identities = 22/34 (64%), Positives = 26/34 (76%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQYARRIGASGAVY 475
             RS++AGL FPVGRV  LLR+G YA R+GA   VY
Sbjct:    14 RSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVY 47


>gi|63445 (X13894) histone H2A.F [Gallus gallus]
          Length = 180

  Minus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 4.6e-05, P = 4.6e-05
 Identities = 27/46 (58%), Positives = 33/46 (71%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLR-RGQYARRIGASGAVYMAAVLEYLTAE 442
             RS +AGL FPVGR+   L+ R     R+GA+ AVY AA+LEYLTAE
Sbjct:    20 RSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAE 65


>gi|2738577 (AF014643) connexin46.6 [Homo sapiens]
            Length = 436

  Plus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.0010, P = 0.0010
 Identities = 45/136 (33%), Positives = 60/136 (44%), Frame = +3

Query:   147 VAQRRRPPRCI*HVAP--PPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATAS 320
             V  RR PP      AP  PPCA+P   +     P  S    A+  A        + A  +
Sbjct:   295 VRGRRGPPASAPAPAPRPPPCAFPAAAAGLACPPDYSLVVRAAERARAHDQNLANLALQA 354

Query:   321 HPSGACRGRRRGARQASPC-GVSGASASLP-AGSPPSRT--APAARLSGTPAPPPCTQRP 488
                GA  G R   R +SPC G+  AS   P AG+P SRT  A +A   G    P   +RP
Sbjct:   355 LRDGAAAGDRD--RDSSPCVGLPAASRGPPRAGAPASRTGSATSAGTVGEQGRPGTHERP 412

Query:   489 TRRCGGHTGRGAAASPHG 542
               +    + +G+A+S  G
Sbjct:   413 GAKPRAGSEKGSASSRDG 430


>sp|P03181|YHL1_EBV HYPOTHETICAL BHLF1 PROTEIN >pir||QQBE3 BHLF1 protein -
            human herpesvirus 4 (strain B95-8)
            Length = 660

  Plus Strand HSPs:

 Score = 114 (40.1 bits), Expect = 0.0024, P = 0.0024
 Identities = 42/126 (33%), Positives = 53/126 (42%), Frame = +3

Query:   216 GRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGAS 395
             GR  R  +P+PS  S  + PA     A H H   S+P+G C   +R  R     G +   
Sbjct:    77 GRG-RPGTPAPSRQSRRTGPAE---QADHAH---SNPTGGCSDPQRSPRTRQ-AGYALGE 128

Query:   396 ASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCG---GHTGRGAAASPHGPRG-RSDR 563
              S   GS   R  PA ++  +   P C +   RR G   GH   GA   P GP G R   
Sbjct:   129 GSAGLGSRGPRPHPAFQVQWSARNPGCPRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAA 188

Query:   564 PSRNGRKLIP 593
             P   G    P
Sbjct:   189 PGAPGTPAAP 198

 Score = 94 (33.1 bits), Expect = 0.52, P = 0.40
 Identities = 51/169 (30%), Positives = 62/169 (36%), Frame = +3

Query:   150 AQR--RRPPRCI*HVAPPPC--AWPEGRSKRWASPSPSCCSCASSP---------APCSG 290
             AQR  RRPP C      P C   W      +   P P      S P         AP + 
Sbjct:   261 AQRTHRRPPGCPRSARNPGCPRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAAPGAPGTP 320

Query:   291 SASHHHATASHPSGACRGRRRGARQASPCGVS---------------GASASLPAGSPPS 425
             +A      A+ PSGA     RG+  A P   +                A+   PAG PP+
Sbjct:   321 AAPGPGGGAAVPSGATPHPERGSGPADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPT 380

Query:   426 RTAPAARLSGTPAPPPCTQRPTRRCG-GHTGR--GAAASPHGPRGRSDRPS 569
             R+  AA+ +    PP C  R  R  G   T R    A   H P G   RPS
Sbjct:   381 RSGAAAQRTHR-RPPGCP-RSARNPGCPRTWRRRSGAQRGHPPPGAGQRPS 429

 Score = 94 (33.1 bits), Expect = 0.52, P = 0.40
 Identities = 51/169 (30%), Positives = 62/169 (36%), Frame = +3

Query:   150 AQR--RRPPRCI*HVAPPPC--AWPEGRSKRWASPSPSCCSCASSP---------APCSG 290
             AQR  RRPP C      P C   W      +   P P      S P         AP + 
Sbjct:   386 AQRTHRRPPGCPRSARNPGCPRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAAPGAPGTP 445

Query:   291 SASHHHATASHPSGACRGRRRGARQASPCGVS---------------GASASLPAGSPPS 425
             +A      A+ PSGA     RG+  A P   +                A+   PAG PP+
Sbjct:   446 AAPGPGGGAAVPSGATPHPERGSGPADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPT 505

Query:   426 RTAPAARLSGTPAPPPCTQRPTRRCG-GHTGR--GAAASPHGPRGRSDRPS 569
             R+  AA+ +    PP C  R  R  G   T R    A   H P G   RPS
Sbjct:   506 RSGAAAQRTHR-RPPGCP-RSARNPGCPRTWRRRSGAQRGHPPPGAGQRPS 554

 Score = 89 (31.3 bits), Expect = 1.9, P = 0.86
 Identities = 44/135 (32%), Positives = 53/135 (39%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPS-PSCCSCASSPAPCSGSASHHHATASHP---SGAC----RGR 347
             PPP A           P+ P      ++P P  G+A    AT  HP   SG        R
Sbjct:   170 PPPGAGQRPSGPTGGRPAAPGAPGTPAAPGPGGGAAVPSGATP-HPERGSGPADPPAAAR 228

Query:   348 RRGARQASPCGVSGASAS-LPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCG-GHTGR- 518
                 RQ        A+A   PAG PP+R+  AA+ +    PP C  R  R  G   T R 
Sbjct:   229 LPPERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHR-RPPGCP-RSARNPGCPRTWRR 286

Query:   519 -GAAASPHGPRGRSDRPS 569
                A   H P G   RPS
Sbjct:   287 RSGAQRGHPPPGAGQRPS 304


>gi|1947160 (AF000298) weak similarity to collagens; glycine- and proline-rich
            [Caenorhabditis elegans]
            Length = 539

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 0.0042, P = 0.0042
 Identities = 45/142 (31%), Positives = 55/142 (38%), Frame = +3

Query:   153 QRRRPPRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSG 332
             +R+ PP      +PPP   P+G      S SP     A SP P    +     T S P  
Sbjct:   249 KRQAPPAG----SPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPP 304

Query:   333 ACRGRRRGARQASPCGVSGASASLPAGS-PPSRT--APAARLSGTPAPPPCTQRPTRRCG 503
                G     R  SP        S P GS PP +   +P    +G+P PPP  +R      
Sbjct:   305 PAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERS 364

Query:   504 GHTGRGAAASPHGPRGRSDRPSRNG 578
               TG     SP  P GR   P R G
Sbjct:   365 PPTGSPPTGSP--PTGR---PPRGG 384

 Score = 98 (34.5 bits), Expect = 0.14, P = 0.13
 Identities = 33/100 (33%), Positives = 42/100 (42%), Frame = +3

Query:   288 GSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAGSPPS----RTAPAARLSG 455
             G   +   TAS   G  +G   G +Q +  G  G   + PAGSPP     + +P    SG
Sbjct:   217 GFGGNQGVTASGFGGQQQGF--GQQQQTQNGFRGKRQAPPAGSPPPPPPPKGSPPLAGSG 274

Query:   456 TPAPPPCT-QRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNG 578
             +P PPP     P  R G        + P  P G S  P R G
Sbjct:   275 SPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAG 316

 Score = 96 (33.8 bits), Expect = 0.23, P = 0.21
 Identities = 49/156 (31%), Positives = 63/156 (40%), Frame = +3

Query:   153 QRRRPPRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHA---TASH 323
             +R+ P R     +PP  + P GR  R      S  S  S   P  G           +S 
Sbjct:   357 KRQAPERSPPTGSPPTGSPPTGRPPRGGPGKSSEESSESREGPRGGPRGGPRGGPRKSSE 416

Query:   324 PSGACRGRRRGARQASPCGV--SGAS-------ASLPAGSPPS-------RTAPAARLSG 455
              S   R   RG R++ P G   +G+         S P GSPP+       R AP  R +G
Sbjct:   417 ESSESREEPRGPRRSPPTGSPPTGSPPTGRPPRGSPPTGSPPTGLPSRQKRQAPEDRPTG 476

Query:   456 TP--APPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRP 566
             +P    PP T RP R  GG     ++ S  GPRG    P
Sbjct:   477 SPPTGSPP-TGRPHR--GGPGKSESSESREGPRGPRRSP 512

 Score = 95 (33.4 bits), Expect = 0.31, P = 0.26
 Identities = 44/137 (32%), Positives = 51/137 (37%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             PPP A       R  SP P     +  P P  GS     A +  P    RG         
Sbjct:   277 PPPPAAGSPPPPRTGSPPPPPTG-SPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPP 335

Query:   372 PCGVSGASASLPAGSPP-----SRTAPAARLSGTPAPP---PCTQRPTRRCGGHTGRGAA 527
             P    G+      GSPP      R AP  R   T +PP   P T RP R   G +   ++
Sbjct:   336 P-QAGGSPPPAGTGSPPPPPRQKRQAPE-RSPPTGSPPTGSPPTGRPPRGGPGKSSEESS 393

Query:   528 ASPHGPRGRSDRPSRNG-RK 584
              S  GPRG      R G RK
Sbjct:   394 ESREGPRGGPRGGPRGGPRK 413


>pir||A61183 hypothetical protein (sdsB region) - Pseudomonas sp
            Length = 312

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.0051, Sum P(2) = 0.0051
 Identities = 33/103 (32%), Positives = 43/103 (41%), Frame = +3

Query:   285 SGSASHHHAT--ASHPSGACRGRRRG-----ARQASPCGVSGASAS----LPAGSPPSRT 431
             +G+  H H    A  P+G C G  RG     AR+ +  G + A  +    LP G+P +  
Sbjct:   126 AGAIGHRHLVQPAPAPAGRCPGAVRGRCAGTARRPAAGGHAAAQLARGDFLPTGAPAAGP 185

Query:   432 APAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDR 563
             APA    G P   P  + P  R GG  G GA        G   R
Sbjct:   186 APAPADGGRPGSLPAGRHPGARRGG-AGPGAVGGKRPAAGHRMR 228

 Score = 46 (16.2 bits), Expect = 0.0051, Sum P(2) = 0.0051
 Identities = 18/35 (51%), Positives = 20/35 (57%), Frame = +1

Query:   145 PWLSDDGHPGAS--NMLRPLPA-PGLKAALSAGRRPR 246
             P L   G PGA+     RP PA  G + A  AGRRPR
Sbjct:    48 PGLPPAG-PGAAPGEPDRPRPAGAGTRPA-PAGRRPR 82


>gi|3044086 (AF055904) unknown [Myxococcus xanthus]
            Length = 542

  Plus Strand HSPs:

 Score = 110 (38.7 bits), Expect = 0.0055, P = 0.0055
 Identities = 49/172 (28%), Positives = 63/172 (36%), Frame = +3

Query:   165 PPRCI*HV-APPPCAWPEGRSKRWASPSPSCCS---CASSPAPCSGSASHHHATAS-HPS 329
             PPRC     AP P A     +   +S +  CC    C S+P P    A     + S  P+
Sbjct:   125 PPRCRARPSAPAPSAGRTCPTAGPSSCASGCCPTGRCGSAPGPTPHGAEPSPPSQSPSPA 184

Query:   330 GACRGRRRGARQASPCGVSGASASLPAGSPP-----------SRTAPAARLSGTPAPPPC 476
              A  G RR      P   S A A+ PA  PP           +RTAP +  +  P PP  
Sbjct:   185 PASSGGRRRTHPR-PARASAAGATAPACLPPPRCCGRPGTGCARTAPPSTSASHPPPPRS 243

Query:   477 TQRPTRRCGGHTGRGAAASPH---GPRGRSDRPSRNGRKLIPLM---KVNLTW 617
                P R  G      A  SP     P G +  P       +P +   +   TW
Sbjct:   244 PGTPPRASGSPAAAPAPPSPACRPPPPGTTPAPRNAALPALPCISPSRQRATW 296

 Score = 105 (37.0 bits), Expect = 0.021, P = 0.021
 Identities = 42/156 (26%), Positives = 62/156 (39%), Frame = +3

Query:   165 PPRCI*HVAPPPCAWPEGRSKRWASPSPSCCS--CASSPAPCSGSASHHHATASHPS--G 332
             PP C+     PP A P   ++  + P P      CA    P S      H  + H S   
Sbjct:    21 PPPCLLSERTPPGARPPP-TETASYPPPQAVPGPCAPRAPPRSPPPRRRHRGSRHRSFRP 79

Query:   333 ACRGRRRGARQASPCGVSGASASLPAG--SPPSRTAPAARLSGTPAPPPCTQRPT----- 491
              C  RR G R  +P   +  + + P+    PP ++ P    +  PAPP C  RP+     
Sbjct:    80 TC-ARRSGRRCPAPSRHARRNPAGPSRRCGPPRKSTPTRCCTPCPAPPRCRARPSAPAPS 138

Query:   492 --RRC--GGHTGRGAAASPHGPRGRSDRPSRNGRKLIP 593
               R C   G +   +   P G  G +  P+ +G +  P
Sbjct:   139 AGRTCPTAGPSSCASGCCPTGRCGSAPGPTPHGAEPSP 176

 Score = 83 (29.2 bits), Expect = 7.3, P = 1.0
 Identities = 35/112 (31%), Positives = 45/112 (40%), Frame = +3

Query:   210 PEGRSKRWASP---SPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQ-ASPC 377
             P G S+R   P   +P+ C C   PAP    A     +A  PS        G    AS C
Sbjct:   100 PAGPSRRCGPPRKSTPTRC-CTPCPAPPRCRA---RPSAPAPSAGRTCPTAGPSSCASGC 155

Query:   378 GVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGP 545
               +G   S P G  P    P+   S +P+P P +    RR      R +AA    P
Sbjct:   156 CPTGRCGSAP-GPTPHGAEPSPP-SQSPSPAPASSGGRRRTHPRPARASAAGATAP 209


>gi|3386544 (AF079528) IER5 [Mus musculus] >gi|3411233 (AF079527) IER5 [Mus
            musculus]
            Length = 308

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.012, P = 0.012
 Identities = 45/143 (31%), Positives = 59/143 (41%), Frame = +3

Query:   192 PPP---CAWPEGRSKRWASPS-PSCCSC----ASSP-APCSGSASHHHATASHPSGACRG 344
             PPP    AWPE   +    P  PS C      +S P A  +GS           + A  G
Sbjct:    87 PPPVARAAWPEPEPQPQPQPQRPSVCHTPGAGSSEPVAAVAGSGEALRGGEEDSAAAAWG 146

Query:   345 RRRGARQASPCGVSGA------SASLPAGSPPSRTAPAARLSGTPAPP-PCTQRPTRRCG 503
             R    R AS  G S A      +   P G PP+    ++   G+PAPP PC ++  R   
Sbjct:   147 RVERPRAASSGGGSDACPEGPRAVRRPCGCPPAVEERSSE-DGSPAPPAPCPRK--RGAA 203

Query:   504 GHTGRGAAASPHGPRGRSDRPSRNGRK 584
             G  G  A+ S  G      +P RN  +
Sbjct:   204 GVGGGRASCSAPGSTPLK-KPRRNSEE 229


>gi|2854193 (AF045645) Similar to cuticular collagen; coded for by C. elegans
            cDNA yk69e12.3; coded for by C. elegans cDNA yk69e12.5; coded for
            by C. elegans cDNA yk307b3.5; coded for by C. elegans cDNA
            yk307b3.3 [Caenorhabditis elegans]
            Length = 314

  Plus Strand HSPs:

 Score = 104 (36.6 bits), Expect = 0.012, P = 0.012
 Identities = 37/115 (32%), Positives = 45/115 (39%), Frame = +3

Query:   249 SCCSCASSPAPCSGSASHHHATASHPS-GACRGRRRGARQASPCGVSGASASLPAGSPPS 425
             SCCSC    A  +GS     A  +  + GA     + A+   P G        PAG P  
Sbjct:   119 SCCSCGVGSAGPAGSPGQDGAPGNDGAPGAPGNPGQDAQDNQPAGPDSFCFDCPAGPPGP 178

Query:   426 RTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLIP 593
               AP  +  SG P  P        R GG +  G    P GP G S +P  NG    P
Sbjct:   179 SGAPGQKGPSGAPGQPG-------RSGGASLPGPPG-PAGPPGPSGQPGSNGNAGAP 227

 Score = 94 (33.1 bits), Expect = 0.18, P = 0.17
 Identities = 41/122 (33%), Positives = 49/122 (40%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGACR--GRRRGARQASPCGVSGASASLP 407
             A P   C  C + P   SG+          PSGA    GR  GA    P G +G     P
Sbjct:   162 AGPDSFCFDCPAGPPGPSGAPGQ-----KGPSGAPGQPGRSGGASLPGPPGPAGPPG--P 214

Query:   408 AGSPPSRT---APAAR-----LSGTPAP--PPCTQRPTRRCG--GHTGRGAAASPHGPRG 551
             +G P S     AP A      + GTP P  PP    P    G  G  G      P GP+G
Sbjct:   215 SGQPGSNGNAGAPGAPGHVVDVPGTPGPAGPPGPAGPAGAPGQPGQAGHAQPGQP-GPQG 273

Query:   552 RSDRPSRNGR 581
              +  P   G+
Sbjct:   274 DAGAPGAPGQ 283


>gnl|PID|e1188396 (Z81138) W05B2.e [Caenorhabditis elegans]
            Length = 304

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 7.2, P = 1.0
 Identities = 31/77 (40%), Positives = 40/77 (51%), Frame = +3

Query:   369 SPCGVSGASASLPAGSP--PSRTA-P-AARLSGTPA-PP--PC---TQRPTRRCGGHTGR 518
             S C + GA+   PAG+P  P R   P AA L G P  PP  PC   T  P + C      
Sbjct:   102 SGCCLPGAAG--PAGTPGKPGRPGRPGAAGLPGNPGRPPAQPCEPITPPPCKPCPQGPA- 158

Query:   519 GAAASPHGPRGRSDRPSRNGR 581
             GA  +P GP+G +  P + G+
Sbjct:   159 GAPGAP-GPQGDAGAPGQAGQ 178

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.020, P = 0.020
 Identities = 42/129 (32%), Positives = 52/129 (40%), Frame = -3

Query:   580 RPFREGRSDLPRGPCGLAAAP-RPVCPPHRRVGRCVHG--GGAGVPDSRA-AGAVREGGE 413
             RP R G + LP  P    A P  P+ PP  +   C  G  G  G P  +  AGA  + G+
Sbjct:   121 RPGRPGAAGLPGNPGRPPAQPCEPITPPPCKP--CPQGPAGAPGAPGPQGDAGAPGQAGQ 178

Query:   412 PAGKEAEAPDTPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQQEGE-GD 236
              +G  A  P  P G A  AP    +    G        DA+ E   G   Q   +G  G 
Sbjct:   179 GSGAGAPGPAGPKG-APGAPGNPGQAGAPGQPG----SDAQSESSPGAPGQAGPQGPPGP 233

Query:   235 AQRLERPSGQAQGG 194
             A     P G  Q G
Sbjct:   234 AGSPGAPGGPGQAG 247


>gnl|PID|e1188397 (Z81138) W05B2.f [Caenorhabditis elegans]
            Length = 304

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 7.2, P = 1.0
 Identities = 31/77 (40%), Positives = 40/77 (51%), Frame = +3

Query:   369 SPCGVSGASASLPAGSP--PSRTA-P-AARLSGTPA-PP--PC---TQRPTRRCGGHTGR 518
             S C + GA+   PAG+P  P R   P AA L G P  PP  PC   T  P + C      
Sbjct:   102 SGCCLPGAAG--PAGTPGKPGRPGRPGAAGLPGNPGRPPAQPCEPITPPPCKPCPQGPA- 158

Query:   519 GAAASPHGPRGRSDRPSRNGR 581
             GA  +P GP+G +  P + G+
Sbjct:   159 GAPGAP-GPQGDAGAPGQAGQ 178

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.020, P = 0.020
 Identities = 42/129 (32%), Positives = 52/129 (40%), Frame = -3

Query:   580 RPFREGRSDLPRGPCGLAAAP-RPVCPPHRRVGRCVHG--GGAGVPDSRA-AGAVREGGE 413
             RP R G + LP  P    A P  P+ PP  +   C  G  G  G P  +  AGA  + G+
Sbjct:   121 RPGRPGAAGLPGNPGRPPAQPCEPITPPPCKP--CPQGPAGAPGAPGPQGDAGAPGQAGQ 178

Query:   412 PAGKEAEAPDTPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQQEGE-GD 236
              +G  A  P  P G A  AP    +    G        DA+ E   G   Q   +G  G 
Sbjct:   179 GSGAGAPGPAGPKG-APGAPGNPGQAGAPGQPG----SDAQSESSPGAPGQAGPQGPPGP 233

Query:   235 AQRLERPSGQAQGG 194
             A     P G  Q G
Sbjct:   234 AGSPGAPGGPGQAG 247


>gi|2429362 (AF020261) proline rich protein [Santalum album]
            Length = 326

  Plus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.022, P = 0.022
 Identities = 37/113 (32%), Positives = 48/113 (42%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPC-GVSGASASLPA 410
             ASPSPS    A++P P   S      T++ P+     R  G R  SP  G    S S  +
Sbjct:   141 ASPSPSPGPPAATPTPRPSSP-----TSTPPTDGETPRPPGPRSPSPSPGPPSCSPSPKS 195

Query:   411 GSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSR 572
              SPP+ + P +R    P PP  T  P+            ASP  P  +   PSR
Sbjct:   196 PSPPASSPPRSR----PGPPDYTTSPSPPTPRSVPPTPPASPSPPTAKPSPPSR 245

 Score = 86 (30.3 bits), Expect = 1.6, P = 0.80
 Identities = 28/96 (29%), Positives = 39/96 (40%), Frame = +3

Query:   210 PEGRSKRWASPSPSCCSCASSP-APCSGSASHHHATASHPSGACRGRRRGARQASPCGVS 386
             P     R  SPSP   SC+ SP +P   ++S   +    P           R   P   +
Sbjct:   172 PRPPGPRSPSPSPGPPSCSPSPKSPSPPASSPPRSRPGPPDYTTSPSPPTPRSVPPTPPA 231

Query:   387 GASASLPAGSPPSR-TAPAARLSGTPAPPPCTQRPT 491
               S      SPPSR ++P+   S TP P P +  P+
Sbjct:   232 SPSPPTAKPSPPSRGSSPSPPTSPTPTPRPPSYSPS 267


>gnl|PID|e1188395 (Z81138) W05B2.d [Caenorhabditis elegans]
            Length = 328

  Plus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 8.1, P = 1.0
 Identities = 31/77 (40%), Positives = 40/77 (51%), Frame = +3

Query:   369 SPCGVSGASASLPAGSP--PSRTA-P-AARLSGTPA-PP--PC---TQRPTRRCGGHTGR 518
             S C + GA+   PAG+P  P R   P AA L G P  PP  PC   T  P + C      
Sbjct:   102 SGCCLPGAAG--PAGTPGKPGRPGRPGAAGLPGNPGRPPAQPCEPITPPPCKPCPQGPA- 158

Query:   519 GAAASPHGPRGRSDRPSRNGR 581
             GA  +P GP+G +  P + G+
Sbjct:   159 GAPGAP-GPQGDAGAPGQAGQ 178

  Minus Strand HSPs:

 Score = 102 (35.9 bits), Expect = 0.023, P = 0.022
 Identities = 42/129 (32%), Positives = 52/129 (40%), Frame = -3

Query:   580 RPFREGRSDLPRGPCGLAAAP-RPVCPPHRRVGRCVHG--GGAGVPDSRA-AGAVREGGE 413
             RP R G + LP  P    A P  P+ PP  +   C  G  G  G P  +  AGA  + G+
Sbjct:   121 RPGRPGAAGLPGNPGRPPAQPCEPITPPPCKP--CPQGPAGAPGAPGPQGDAGAPGQAGQ 178

Query:   412 PAGKEAEAPDTPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQQEGE-GD 236
              +G  A  P  P G A  AP    +    G        DA+ E   G   Q   +G  G 
Sbjct:   179 GSGAGAPGPAGPKG-APGAPGNPGQAGAPGQPG----SDAQSESSPGAPGQAGPQGPPGP 233

Query:   235 AQRLERPSGQAQGG 194
             A     P G  Q G
Sbjct:   234 AGSPGAPGGPGQAG 247


>gi|2804500 (AF043706) contains similarity to granulins [Caenorhabditis
            elegans]
            Length = 768

  Plus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.026, P = 0.025
 Identities = 40/118 (33%), Positives = 47/118 (39%), Frame = +3

Query:   240 PSP-SCCSCASSPAPCSGSASHHHATASH---PSGACRGRRRGARQASPCGVSGASASLP 407
             P P +CC     P PC   A      A+    P   CRGRR    +       G    +P
Sbjct:   104 PIPLACCPPPPPPKPCCQPAFGPCCPATPNCCPKPCCRGRRPEYEEYED--EEGNPGGVP 161

Query:   408 AGSPPSRTA-----PAARLSGTPAPPPCTQRPTRRCGGHT-GRGAAAS--PHGPRGRSDR 563
             A   P RT      PAA     P PPP  + PT+ CG    GR    S  P+G  G   R
Sbjct:   162 APPNPPRTCCPPPTPAAPPPPPPPPPPAPEAPTQCCGSQPYGRTPCRSGCPNGDCG-CGR 220

Query:   564 P 566
             P
Sbjct:   221 P 221


>bbs|119684 histone b {internal fragment} [Trypanosoma brucei, ssp. brucei,
            Peptide Partial, 20 aa]
            Length = 20

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.029, P = 0.029
 Identities = 17/20 (85%), Positives = 18/20 (90%), Frame = -1

Query:   432 LSVKAASQQAKKPKRLTPRT 373
             LSVKAA+QQ KK KRLTPRT
Sbjct:     1 LSVKAAAQQTKKTKRLTPRT 20


>sp|P23246|PSF_HUMAN PTB-ASSOCIATED SPLICING FACTOR (PSF) >pir||A46302
            PTB-associated splicing factor, long form - human >gi|38458
            (X70944) PTB-associated splicing factor [Homo sapiens]
            Length = 707

  Plus Strand HSPs:

 Score = 105 (37.0 bits), Expect = 0.030, P = 0.030
 Identities = 41/123 (33%), Positives = 50/123 (40%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCS---CASSPAPCSGSASHHHATASHP------SGACRG 344
             PPP   P+   ++   P P   S    A  P P  G  S   A++S P      SGA  G
Sbjct:    87 PPP--HPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSAPPASSSAPPATPPTSGAPPG 144

Query:   345 RRRGARQASPCGVSGASASLPAGSPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRG 521
                G     P  V+ A    P  +PPS   P     +G P PPP    P    G   G G
Sbjct:   145 SGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAV-PGPGPGPKQGPG 203

Query:   522 AAASPHGPRG 551
                 P GP+G
Sbjct:   204 ----PGGPKG 209


>gi|2769728 (U92288) HN1 [Human herpesvirus 6]
            Length = 279

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.038, P = 0.037
 Identities = 39/119 (32%), Positives = 44/119 (36%), Frame = +3

Query:   198 PC---AWPEGRSKRWASPSPSCCSCASSPA--PCSGSASHHHATASHPSGACRGRRRGAR 362
             PC    W   R     S   S    A  PA  P  GSA    +      G+  G   G+ 
Sbjct:    34 PCWRLCWKPCRRPAGGSAGGSAGGSAGGPAGGPAGGSAGG--SAGGSAGGSAGGPAGGSA 91

Query:   363 QASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHG 542
              +S  G +G SA   AG   S   PA   SG PA            G  TGR A  S  G
Sbjct:    92 GSSAGGPAGGSAGSSAGG--SAGGPAGGSSGGPAGSFARDSAGSFAGSPTGRPAGGSAGG 149

Query:   543 PRG 551
             P G
Sbjct:   150 PAG 152

 Score = 80 (28.2 bits), Expect = 6.3, P = 1.0
 Identities = 27/85 (31%), Positives = 32/85 (37%), Frame = +3

Query:   324 PSGACRGRRRGARQASPCG-VSGASASLPAGSPPSRTA--PAARLSGTPAPPPCTQRPTR 494
             P+G   G   G     P G  +G SA   AG     +A  PA   +G+ A  P       
Sbjct:    46 PAGGSAGGSAGGSAGGPAGGPAGGSAGGSAGGSAGGSAGGPAGGSAGSSAGGPAGGSAGS 105

Query:   495 RCGGHTGRGAAASPHGPRGRSDRPS 569
               GG  G  A  S  GP G   R S
Sbjct:   106 SAGGSAGGPAGGSSGGPAGSFARDS 130


>sp|P55897|H2A_BUFBG HISTONE H2A (CONTAINS: BUFORINS I AND II) >bbs|175867
            buforin I=antimicrobial peptide [Bufo bufo=Asian toads,
            gargarizans, stomach, Peptide, 39 aa]
            Length = 39

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.038, P = 0.037
 Identities = 16/23 (69%), Positives = 19/23 (82%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRRGQY 508
             RS++AGL FPVGRV  LLR+G Y
Sbjct:    17 RSSRAGLQFPVGRVHRLLRKGNY 39


>sp|P33479|IE18_PRVKA IMMEDIATE-EARLY PROTEIN IE180 >pir||A45344
            immediate-early protein - suid herpesvirus 1 (strain Kaplan)
            >gi|334071 (M34651) immediate-early protein [Pseudorabies virus]
            Length = 1446

  Plus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.054, P = 0.052
 Identities = 37/120 (30%), Positives = 56/120 (46%), Frame = +3

Query:   237 SPS-PSCCSCASSPAPCSGSASHHHATASHPSGACRGRR-RGARQASPCGVSGASAS--L 404
             SPS P   + A+  +  S S+S   +++S  S +  G    G R  +P   +G   S   
Sbjct:   363 SPSAPRAPAAAARRSASSSSSSSSSSSSSSSSSSSEGEEDEGVRPGAPLARAGPPPSPPA 422

Query:   405 PAGSP-PSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGR 581
             PA +P PS ++ ++  + +PAP P   RP RR    T    +    GP      P  +G 
Sbjct:   423 PAAAPRPSASSASSSAAASPAPAPEPARPPRRKRRSTNNHLSLMADGP------PPTDGP 476

Query:   582 KLIPL 596
              L PL
Sbjct:   477 LLTPL 481


>gi|2961610 (AF051526) class A calcium channel variant riA-I [Rattus
            norvegicus]
            Length = 791

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.059, P = 0.058
 Identities = 42/120 (35%), Positives = 51/120 (42%), Frame = +3

Query:   195 PPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQA-- 368
             P       R +RW S SPS            GS+S   + A   SG    RR G RQ   
Sbjct:   608 PDTGRARAREQRW-SRSPS--EGREHATHRQGSSSVSGSPAPSTSGTSTPRR-GRRQLPQ 663

Query:   369 SPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPR 548
             +PC        L + SP  R   A R++G PAPP  + R  RR      R  A +P GPR
Sbjct:   664 TPC----TPRPLVSYSPAPRRPAARRMAGPPAPPGGSPRGCRRAP----RWPAHAPEGPR 715

Query:   549 GR 554
              R
Sbjct:   716 PR 717


>gnl|PID|e257866 (Z78064) F57B1.3 [Caenorhabditis elegans]
            Length = 313

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.062, P = 0.060
 Identities = 41/122 (33%), Positives = 51/122 (41%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGA--CRGRRRGARQASPCGVSGASASLP 407
             A P   C  C + P   SG+          PSGA    G+  GA    P G +G     P
Sbjct:   161 AGPDSFCFDCPAGPPGPSGAPGQ-----KGPSGAPGVPGQTGGASLPGPPGPAGPPG--P 213

Query:   408 AGSPPSRT---APAAR-----LSGTPAP--PPCTQRPTRRCG--GHTGRGAAASPHGPRG 551
             +G P S     AP A      + GTP P  PP    P    G  G +G G    P GP+G
Sbjct:   214 SGQPGSNGNAGAPGAPGQVVDVPGTPGPAGPPGPPGPAGAPGQPGQSGSGQPGGP-GPQG 272

Query:   552 RSDRPSRNGR 581
              +  P   G+
Sbjct:   273 DAGAPGAPGQ 282

 Score = 97 (34.1 bits), Expect = 0.080, P = 0.077
 Identities = 37/119 (31%), Positives = 46/119 (38%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHATASHPS-GACRGRRRGARQASPCGVSGASASLPAG 413
             S   SCCSC +  A  +GS     A  +  + GA     + A +    G        PAG
Sbjct:   114 SAGGSCCSCGTGAAGPAGSPGQDGAPGNDGAPGAPGNPGQDASEDQTAGPDSFCFDCPAG 173

Query:   414 SPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLI 590
              P    AP  +  SG P  P  T       GG +  G    P GP G S +P  NG    
Sbjct:   174 PPGPSGAPGQKGPSGAPGVPGQT-------GGASLPGPPG-PAGPPGPSGQPGSNGNAGA 225

Query:   591 P 593
             P
Sbjct:   226 P 226


>gnl|PID|e236205 (Z70756) T06E4.6 [Caenorhabditis elegans]
            Length = 290

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.070, P = 0.068
 Identities = 36/121 (29%), Positives = 48/121 (39%), Frame = +3

Query:   216 GRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGAS 395
             GR KR  +   + C+C +    C             P GA +G    A +A   G +G +
Sbjct:    64 GRIKRGINKRGAQCNCGAQSNGCPAGPP---GPPGQP-GA-QGEAGHAGEAGKPGANGVT 118

Query:   396 ASLPAGSPPSRTAPAARLSGTPAP-PPCTQRPTRRCGGHT-GRGAA-ASPHGPRGRSDRP 566
               L  G+ P  T PA       AP  P  Q P+   G    G G   A P GP G +  P
Sbjct:   119 IGLTGGNGPCITCPAGAPGPAGAPGAPGPQGPSGAPGQDAVGEGPGPAGPQGPAGDAGAP 178

Query:   567 SRNG 578
              + G
Sbjct:   179 GQAG 182


>pir||D34768 ORF4 protein - Orf virus (strain NZ2) >gi|332566 (M30023) ORF4
            [Orf virus]
            Length = 264

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.076, P = 0.073
 Identities = 42/131 (32%), Positives = 54/131 (41%), Frame = +3

Query:   156 RRRPPRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGA 335
             RR P R   + A  P A     S+R   P+      A  PAP         A A+ P   
Sbjct:   149 RRAPGRAGRYPAARPAAASAAASRRHRGPAARSSPAAERPAP-----PRARAEAAAPR-- 201

Query:   336 CRGRRRGARQAS-PCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHT 512
              R    G+R +S P   S A +S  +GS P+ + PAAR     AP   + R +       
Sbjct:   202 -RASSSGSRASSGPPRRSAARSSAASGSRPAASGPAAR-----APAASSARTS------A 249

Query:   513 GRGAAASPHGPR 548
             G GAA  P  PR
Sbjct:   250 GEGAARGPGAPR 261


>gi|404807 (L13855) UL3.5 [Pseudorabies virus]
           Length = 220

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.089, P = 0.085
 Identities = 36/126 (28%), Positives = 52/126 (41%), Frame = +3

Query:   216 GRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRG----RRRGARQASPCGV 383
             GRS++  +  P     A+   P       HH  + HP    +     RRRG+  AS    
Sbjct:    69 GRSRQRGATEPDPVY-ATVVQPTHHHHQQHHHRSQHPQQQQQQQRAPRRRGSVHASATAA 127

Query:   384 SGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDR 563
              G  +   A +PP R   +   S T AP     RP +R   +    AA +P  PR R   
Sbjct:   128 DGPESC--AAAPPRRRG-SVHASATAAPAVQLPRPRQR-SINASTTAAPTPQLPRPRQRS 183

Query:   564 PSRNGRKLIP 593
              + + R  +P
Sbjct:   184 VNASARAAVP 193


>pir||G60110 repetitive protein antigen 69/70 - Trypanosoma cruzi (fragment)
            Length = 97

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.10, P = 0.098
 Identities = 26/97 (26%), Positives = 44/97 (45%), Frame = +3

Query:   234 ASPSPSCCSCA-SSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPA 410
             A+P+ +  + A ++ AP   +A+   A A+ P+ A     + A  A+P   + A A   A
Sbjct:     1 AAPAKAAAAPAKAAAAPAKAAAAPAKAAAA-PAKAAAAPAKAA--AAPAKAAAAPAK--A 55

Query:   411 GSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGA 524
              + P++TA AA      AP      P +      G+ A
Sbjct:    56 AAAPAKTAAAAPAKAAAAPAKAAAAPAKTAAAPVGKKA 93


>sp|P20630|CC12_CAEEL CUTICLE COLLAGEN 12 PRECURSOR >pir||S08169 collagen
            col-12 precursor - Caenorhabditis elegans >gi|6680 (X51622)
            collagen [Caenorhabditis elegans] >gnl|PID|e248307 (Z73972)
            F15H10.1 [Caenorhabditis elegans]
            Length = 316

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.11, P = 0.10
 Identities = 41/121 (33%), Positives = 49/121 (40%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGA--CRGRRRGARQASPCGVSGASASLP 407
             A P   C  C + P   SG+          PSGA    G+  GA    P G +G     P
Sbjct:   164 AGPDSFCFDCPAGPPGPSGAPGQ-----KGPSGAPGAPGQSGGAALPGPPGPAGPPG--P 216

Query:   408 AGSPPSRT---APAAR-----LSGTPAP--PPCTQRPTRRCG--GHTGRGAAASPHGPRG 551
             AG P S     AP A      + GTP P  PP +  P    G  G  G      P GP+G
Sbjct:   217 AGQPGSNGNAGAPGAPGQVVDVPGTPGPAGPPGSPGPAGAPGQPGQAGSSQPGGP-GPQG 275

Query:   552 RSDRPSRNG 578
              +  P   G
Sbjct:   276 DAGAPGAPG 284

 Score = 95 (33.4 bits), Expect = 0.14, P = 0.13
 Identities = 36/119 (30%), Positives = 45/119 (37%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHATASHPS-GACRGRRRGARQASPCGVSGASASLPAG 413
             S   SCCSC S  A  +GS     A  +  + GA     + A +    G        PAG
Sbjct:   117 SSGGSCCSCGSGAAGPAGSPGQDGAPGNDGAPGAPGNPGQDASEDQTAGPDSFCFDCPAG 176

Query:   414 SPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLI 590
              P    AP  +  SG P  P        + GG    G    P GP G + +P  NG    
Sbjct:   177 PPGPSGAPGQKGPSGAPGAPG-------QSGGAALPGPPG-PAGPPGPAGQPGSNGNAGA 228

Query:   591 P 593
             P
Sbjct:   229 P 229


>sp|P20631|CC13_CAEEL CUTICLE COLLAGEN 13 PRECURSOR >pir||S08170 collagen
            col-13 precursor - Caenorhabditis elegans >gi|6682 (X51623)
            collagen [Caenorhabditis elegans] >gnl|PID|e248308 (Z73972)
            F15H10.2 [Caenorhabditis elegans]
            Length = 316

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.11, P = 0.10
 Identities = 41/121 (33%), Positives = 49/121 (40%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGA--CRGRRRGARQASPCGVSGASASLP 407
             A P   C  C + P   SG+          PSGA    G+  GA    P G +G     P
Sbjct:   164 AGPDSFCFDCPAGPPGPSGAPGQ-----KGPSGAPGAPGQSGGAALPGPPGPAGPPG--P 216

Query:   408 AGSPPSRT---APAAR-----LSGTPAP--PPCTQRPTRRCG--GHTGRGAAASPHGPRG 551
             AG P S     AP A      + GTP P  PP +  P    G  G  G      P GP+G
Sbjct:   217 AGQPGSNGNAGAPGAPGQVVDVPGTPGPAGPPGSPGPAGAPGQPGQAGSSQPGGP-GPQG 275

Query:   552 RSDRPSRNG 578
              +  P   G
Sbjct:   276 DAGAPGAPG 284

 Score = 95 (33.4 bits), Expect = 0.14, P = 0.13
 Identities = 36/119 (30%), Positives = 45/119 (37%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHATASHPS-GACRGRRRGARQASPCGVSGASASLPAG 413
             S   SCCSC S  A  +GS     A  +  + GA     + A +    G        PAG
Sbjct:   117 SSGGSCCSCGSGAAGPAGSPGQDGAPGNDGAPGAPGNPGQDASEDQTAGPDSFCFDCPAG 176

Query:   414 SPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLI 590
              P    AP  +  SG P  P        + GG    G    P GP G + +P  NG    
Sbjct:   177 PPGPSGAPGQKGPSGAPGAPG-------QSGGAALPGPPG-PAGPPGPAGQPGSNGNAGA 228

Query:   591 P 593
             P
Sbjct:   229 P 229


>gi|868024 (L41919) HIC-1 gene product [Homo sapiens]
           Length = 544

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.11, P = 0.10
 Identities = 36/101 (35%), Positives = 43/101 (42%), Frame = +3

Query:   183 HVAPPPCAWPEGRSKRWA-SP-SPSCCSCASSPAPCSGSASHHHATASHPSGACRG---R 347
             H      A P GR + W  SP SP+  + ASS +P +      H  A+ P  A +G   R
Sbjct:   425 HAVGGAAARP-GRWRAWGGSPASPAPTARASSTSPRASLLWLAHGRAAEPEAAGQGGRDR 483

Query:   348 RRGARQASPCGVSG-ASASLPAGSPPSRTAPAARLSGTPAPP 470
               GA  A P    G A   LPAG    R  P  R  G  A P
Sbjct:   484 AAGADHALPARPQGGAGEPLPAGQVHGRAGPQPRQGGRGAEP 525


>prf||2113367A HIC-1 gene [Homo sapiens]
            Length = 548

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.11, P = 0.10
 Identities = 36/101 (35%), Positives = 43/101 (42%), Frame = +3

Query:   183 HVAPPPCAWPEGRSKRWA-SP-SPSCCSCASSPAPCSGSASHHHATASHPSGACRG---R 347
             H      A P GR + W  SP SP+  + ASS +P +      H  A+ P  A +G   R
Sbjct:   429 HAVGGAAARP-GRWRAWGGSPASPAPTARASSTSPRASLLWLAHGRAAEPEAAGQGGRDR 487

Query:   348 RRGARQASPCGVSG-ASASLPAGSPPSRTAPAARLSGTPAPP 470
               GA  A P    G A   LPAG    R  P  R  G  A P
Sbjct:   488 AAGADHALPARPQGGAGEPLPAGQVHGRAGPQPRQGGRGAEP 529


>pir||A45195 adenylylcyclase type V-alpha - dog >gi|290082 (M97886) adenylyl
            cyclase [Canis familiaris]
            Length = 596

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.12, P = 0.11
 Identities = 41/121 (33%), Positives = 49/121 (40%), Frame = +3

Query:   204 AWPEG----RSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRR-GARQA 368
             AWP       + RWA+ +P   + AS+ AP     S    TA   +G   G RR GA   
Sbjct:     7 AWPSAGAATTTPRWAATTPWPGASASASAPGRPGRSAAATTAGAAAGGGGGARRAGAAPG 66

Query:   369 SPCGVSG--ASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPT-RRCGGHTGRGAAAS-P 536
              PCG            G+PP   A   R +G P P     R   RR  G   RGA    P
Sbjct:    67 RPCGRRRRPGGGGRGGGAPPLGGAGPGRAAG-PGPRRARARGRGRRPRGRP-RGAGRRRP 124

Query:   537 HGP 545
              GP
Sbjct:   125 AGP 127


>gnl|PID|e236201 (Z70756) T06E4.4 [Caenorhabditis elegans]
            Length = 290

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.12, P = 0.11
 Identities = 36/121 (29%), Positives = 48/121 (39%), Frame = +3

Query:   216 GRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGAS 395
             GR KR  +   + C+C +    C             P GA +G    A +A   G +G +
Sbjct:    64 GRIKRGINKRGAQCNCGAQSNGCPAGPP---GPPGQP-GA-QGEAGHAGEAGKPGANGVT 118

Query:   396 ASLPAGSPPSRTAPAARLSGTPAP-PPCTQRPTRRCGGHT-GRGAA-ASPHGPRGRSDRP 566
               L  G+ P  T PA       AP  P  Q P+   G    G G   A P GP G +  P
Sbjct:   119 IGLTGGNGPCITCPAGAPGPAGAPGAPGPQGPSGAPGQDAVGGGPGPAGPQGPAGDAGAP 178

Query:   567 SRNG 578
              + G
Sbjct:   179 GQAG 182


>pir||EDBEIF immediate-early protein IE180 - suid herpesvirus 1 (strain
            Indiana-Funkhauser)
            Length = 1460

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.12, Sum P(2) = 0.12
 Identities = 40/122 (32%), Positives = 57/122 (46%), Frame = +3

Query:   237 SPS-PSCCSCASSPAPCSGSASHHHATASHPSGACRGRR-RGARQASPCGVSGASAS--L 404
             SPS P   + A++ A  S S+S   +++S  S +  G    G R  +P   +G   S   
Sbjct:   371 SPSAPRAPAAAAAAARRSASSSSSSSSSSSSSSSSEGEEDEGVRPGAPLARAGPPPSPPA 430

Query:   405 PAGSP-PSRTAPAARLSG---TPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSR 572
             PA +P PS ++ +A  S    +PAP P   RP RR    T    +    GP      P  
Sbjct:   431 PAAAPRPSASSASATSSSAAASPAPAPEPARPPRRKRRSTNNHLSLMADGP------PPT 484

Query:   573 NGRKLIPL 596
             +G  L PL
Sbjct:   485 DGPLLTPL 492

 Score = 97 (34.1 bits), Expect = 0.36, Sum P(2) = 0.30
 Identities = 40/124 (32%), Positives = 50/124 (40%), Frame = +3

Query:   213 EGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGA 392
             EG  +R    S S  S   S +  S + S     A  P+ A    RR A  +S    S +
Sbjct:   345 EGALRRGRGFSSS--SSGGSDSDLSPARSPSAPRA--PAAAAAAARRSASSSSSSSSSSS 400

Query:   393 SASLPAGSPPSRTAPAARLS--GTPAPPPC---TQRPTRRCGGHTGRGAAASPHGPRGRS 557
             S+S   G       P A L+  G P  PP      RP+      T   AAASP  P    
Sbjct:   401 SSSSSEGEEDEGVRPGAPLARAGPPPSPPAPAAAPRPSASSASATSSSAAASP-APAPEP 459

Query:   558 DRPSRNGRK 584
              RP R  R+
Sbjct:   460 ARPPRRKRR 468

 Score = 92 (32.4 bits), Expect = 2.2, P = 0.89
 Identities = 43/131 (32%), Positives = 55/131 (41%), Frame = +3

Query:   195 PPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASP 374
             PP  WPE       +P+P+    A S  P SG +S     AS  SG+      G +    
Sbjct:   822 PPL-WPEQPGLVVPAPAPAAAG-APSGLPGSGPSS----PASTKSGSSTKSSSGTKS--- 872

Query:   375 CGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPT--RRCGGHTGRGAAASPHGPR 548
              G+SG+S    A  P  R  P+AR +   AP    +RP       G +G       HG R
Sbjct:   873 -GLSGSSGY--ARLPRRRPGPSARAAQEEAPRAGARRPGDGEEDEGLSGSALRGDGHGHR 929

Query:   549 G-RSDR-PSRNGRKL 587
                 DR P R  R L
Sbjct:   930 DDEEDRGPRRKRRSL 944

 Score = 44 (15.5 bits), Expect = 0.12, Sum P(2) = 0.12
 Identities = 10/19 (52%), Positives = 13/19 (68%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSP 248
             PPP   P GRS+R A+ +P
Sbjct:   240 PPP---PPGRSRRPAAAAP 255

 Score = 41 (14.4 bits), Expect = 0.24, Sum P(2) = 0.22
 Identities = 10/18 (55%), Positives = 10/18 (55%), Frame = +1

Query:   193 PLPAPGLKAALSAGRRPR 246
             P PAP    A  A RRPR
Sbjct:   178 PPPAPPAPPAPPAPRRPR 195


>sp|P05997|CA25_HUMAN PROCOLLAGEN ALPHA 2(V) CHAIN PRECURSOR >pir||CGHU2V
            collagen alpha 2(V) chain precursor - human >gnl|PID|e339680
            (Y14690) procollagen alpha 2(V) [Homo sapiens]
            Length = 1496

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.13, P = 0.12
 Identities = 43/130 (33%), Positives = 57/130 (43%), Frame = -3

Query:   598 IKGISLRPFREGRSDLPRGPCGLAAAPRPVCP---PHRRVGRCVHG--GGAGVPDSRAAG 434
             +KG    P ++G +  P GP GLA +P P  P   P  + GR   G  G  G P S  AG
Sbjct:   856 VKGEPGEPGQKGDAGSP-GPQGLAGSPGPHGPNGVPGLKGGRGTQGPPGATGFPGS--AG 912

Query:   433 AVREGGEPAGKEAEAPDTPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQ 254
              V   G PAG  A  P  P G+  +     PR  P     V     A P  G G++    
Sbjct:   913 RVGPPG-PAG--APGPAGPLGEPGKEGPPGPRGDPGSHGRVGVRGPAGPPGGPGDKGDPG 969

Query:   253 QEGEGDAQRLERPSG 209
             ++G+        P+G
Sbjct:   970 EDGQPGPDGPPGPAG 984


>gnl|PID|e257912 (Z78064) F57B1.4 [Caenorhabditis elegans]
            Length = 356

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.13, P = 0.12
 Identities = 36/119 (30%), Positives = 46/119 (38%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHATASHPS-GACRGRRRGARQASPCGVSGASASLPAG 413
             S   SCCSC +  A  +GS     A  +  + GA     + A +    G        PAG
Sbjct:   157 SAGGSCCSCGTGAAGPAGSPGQDGAPGNDGAPGAPGNPGQDASEDQTAGPDSFCFDCPAG 216

Query:   414 SPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLI 590
              P    AP  +  SG P  P        + GG +  G    P GP G S +P  NG    
Sbjct:   217 PPGPSGAPGQKGPSGAPGAPG-------QSGGASLPGPPG-PAGPPGPSGQPGSNGNAGA 268

Query:   591 P 593
             P
Sbjct:   269 P 269

 Score = 94 (33.1 bits), Expect = 0.22, P = 0.20
 Identities = 40/122 (32%), Positives = 51/122 (41%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGA--CRGRRRGARQASPCGVSGASASLP 407
             A P   C  C + P   SG+          PSGA    G+  GA    P G +G     P
Sbjct:   204 AGPDSFCFDCPAGPPGPSGAPGQ-----KGPSGAPGAPGQSGGASLPGPPGPAGPPG--P 256

Query:   408 AGSPPSRT---APAAR-----LSGTPAP--PPCTQRPTRRCGGHTGRGAAASPHGP--RG 551
             +G P S     AP A      + GTP P  PP    P     G  G+  +A P GP  +G
Sbjct:   257 SGQPGSNGNAGAPGAPGQVVDVPGTPGPAGPPGPPGPAG-APGQPGQSGSAQPGGPGPQG 315

Query:   552 RSDRPSRNGR 581
              +  P   G+
Sbjct:   316 DAGAPGAPGQ 325


>sp|P33485|VNUA_PRVKA PROBABLE NUCLEAR ANTIGEN >pir||B45344 probable nuclear
            antigen - suid herpesvirus 1 (strain Kaplan) >gi|334072 (M34651)
            ORF-3 protein [Pseudorabies virus]
            Length = 1733

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.15, P = 0.14
 Identities = 45/131 (34%), Positives = 49/131 (37%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCS--CASSPAPCSGSASH-HHATASHPSGACRGRRRGAR 362
             PPP   P+    RW  PSP   S   A S        SH  +   SHP G      RG  
Sbjct:   205 PPP---PQRPPPRWPPPSPQKISETRAGSENTAQTLFSHSENKLFSHPMGEGGEGDRGTA 261

Query:   363 QASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHG 542
                  G  G     P  SPP R  P   L   P PPP  Q P    GG   R       G
Sbjct:   262 G----GGEGDRDDPPPPSPPPRPPPP--LPPPPPPPPPPQPPP--AGGSARRRRRGG--G 311

Query:   543 PRGRSDRPSRNGRK 584
             P GR  R  R G++
Sbjct:   312 PPGRGGR-RRGGKR 324

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 7.6, P = 1.0
 Identities = 32/76 (42%), Positives = 38/76 (50%), Frame = -3

Query:   412 PAGKEAEAPDTPHGDACRAPRRR--PRHAPEGCDAVAWWCDAEPEQ-GAGEEAQEQQ--E 248
             PAG  A       G   R  RRR   R   EG +A A   DAE E+ G G+E +++   E
Sbjct:   298 PAGGSARRRRRGGGPPGRGGRRRGGKRRRAEGTEAAA--ADAEEEEDGDGDEDEDEDRAE 355

Query:   247 GEGDAQRLERPSGQAQGGGA 188
             GEG     E P G   GGGA
Sbjct:   356 GEGREDGGEGPRGA--GGGA 373


>pir||S14085 protamine - common cuttlefish
            Length = 57

  Minus Strand HSPs:

 Score = 49 (17.2 bits), Expect = 0.15, Sum P(2) = 0.14
 Identities = 11/20 (55%), Positives = 12/20 (60%), Frame = -2

Query:   281 RRWRRSTRAARRRGRRPALR 222
             RR+RR  R  RRR RR   R
Sbjct:    24 RRYRRRRRRRRRRSRRRRYR 43

 Score = 43 (15.1 bits), Expect = 0.67, Sum P(2) = 0.49
 Identities = 10/22 (45%), Positives = 13/22 (59%), Frame = -2

Query:   275 WRRSTRAARRRGRRPALRAAFR 210
             +RR  R  RRR RR + R  +R
Sbjct:    22 YRRRYRRRRRRRRRRSRRRRYR 43

 Score = 42 (14.8 bits), Expect = 0.15, Sum P(2) = 0.14
 Identities = 9/11 (81%), Positives = 10/11 (90%), Frame = -2

Query:   422 RRRASRQRSRS 390
             RRR SR+RSRS
Sbjct:    10 RRRRSRRRSRS 20

 Score = 42 (14.8 bits), Expect = 0.86, Sum P(2) = 0.58
 Identities = 10/16 (62%), Positives = 11/16 (68%), Frame = -2

Query:   281 RRWRRSTRAARRRGRR 234
             RR RR  R+ RRR RR
Sbjct:    29 RRRRRRRRSRRRRYRR 44

 Score = 41 (14.4 bits), Expect = 1.1, Sum P(2) = 0.66
 Identities = 10/20 (50%), Positives = 13/20 (65%), Frame = -2

Query:   293 RA*TRRWRRSTRAARRRGRR 234
             R+  RR+RR    +RRR RR
Sbjct:    36 RSRRRRYRRRRSYSRRRYRR 55


>sp|P20186|YT35_STRFR HYPOTHETICAL 35.5 KD PROTEIN IN TRANSPOSON TN4556
            >pir||JQ0431 hypothetical 35.5K protein - Streptomyces fradiae
            transposon Tn4556 >gi|1196912 (M29297) unknown protein [Transposon
            Tn4556]
            Length = 348

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.16, P = 0.15
 Identities = 43/147 (29%), Positives = 57/147 (38%), Frame = +3

Query:   150 AQRRRPPRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPS 329
             ++ R P   +   +P P A     + R   P+ +  S   +P P + SAS   A A    
Sbjct:   196 SETRSPGGTVQPKSPAPLA-ARCSASRAGCPT-AAGSLLPAPRPPASSASSPQAAAPAAP 253

Query:   330 GACRGRRRGARQASPCGVSGASASLPAGSPPSRTAPAA-RLSGTPAPPPCTQRPTRRC-G 503
              A R  RR    A       A   +PA  PP R  P   R +   A  P    P RR   
Sbjct:   254 SATRLPRRTTPSAPRPSSRPARPPIPAARPPPRRTPGTPRPAAARARAPAGCSPARRTPS 313

Query:   504 GHTGRGAAASPHG-PRGRSDRP-SRNGRK 584
               T R   A+  G PR  + RP  R G +
Sbjct:   314 APTDRRCRAARRGSPRPPAARPPGRQGTR 342


>pir||B40505 hypothetical protein - suid herpesvirus 1 (strain
            Indiana-Funkhuser or Becker) >gi|334068 (M57505) ORF2 [Pseudorabies
            virus]
            Length = 1958

  Plus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.17, P = 0.15
 Identities = 44/131 (33%), Positives = 48/131 (36%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCS--CASSPAPCSGSASH-HHATASHPSGACRGRRRGAR 362
             PPP   P+    RW  PSP   S   A S        SH  +   SHP G   G   G  
Sbjct:   415 PPP---PQRPPPRWPPPSPQKISETRAGSENTAQTLFSHSENKLFSHPMG--EG---GEG 466

Query:   363 QASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHG 542
                  G  G        SPP R  P   L   P PPP  Q P    GG   R       G
Sbjct:   467 DRGTAGGEGDRDDPRPPSPPPRPPPP--LPPPPPPPPPPQPPP--AGGSARRRRRGGGGG 522

Query:   543 PRGRSDRPSRNGRK 584
             P GR  R  R G++
Sbjct:   523 PPGRGGR-RRGGKR 535


>gi|903938 (U28835) similar to human GATA-4 cDNA sequence, GenBank Accession
           Number L34357 [Homo sapiens]
           Length = 203

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.17, P = 0.15
 Identities = 41/114 (35%), Positives = 52/114 (45%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSP--APCSGSASHHHATASHPSGACRG---RRRG 356
             PP    P   ++R A+P+PSC   A  P  + C  + +   A    P G  RG   RRR 
Sbjct:     8 PPTTGRPPVPTRR-AAPAPSCXXXAPRPRQSTCPPAGALLRAGPVLPPGRRRGLCVRRRL 66

Query:   357 ARQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAAS 533
              R +S    SGA      GSP    A A   + TP  PP +  P     G TG  AAA+
Sbjct:    67 GR-SSGGAASGAGPGTQQGSPGWSQAGADGAAYTP--PPVS--PRFSFPGPTGSLAAAA 120


>gnl|PID|e1297929 (Z82268) F52B11.d [Caenorhabditis elegans]
            Length = 304

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 5.5, P = 1.0
 Identities = 36/109 (33%), Positives = 44/109 (40%), Frame = +3

Query:   276 APCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAGSP--PSRTA-P-AA 443
             +P + S     A      G  +G   GA+  S  G     A+ PAG+P  P R   P AA
Sbjct:    70 SPKNASRFARQAGYGGDEGVDQGSE-GAQGGSCSGCCLPGAAGPAGTPGKPGRPGRPGAA 128

Query:   444 RLSGTPA-PP--PC---TQRPTRRCG-GHTGRGAAASPHGPRGRSDRPSR 572
              L G P  PP  PC   T  P + C  G  G   A  P G  G    P +
Sbjct:   129 GLPGNPGRPPAQPCEPITPPPCKPCPQGPAGAPGAPGPQGDAGAPGAPGQ 178

 Score = 80 (28.2 bits), Expect = 7.2, P = 1.0
 Identities = 36/119 (30%), Positives = 42/119 (35%), Frame = +3

Query:   246 PSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAGSPPS 425
             P C  C   PA   G A      A  P GA  G+  GA    P G  GAS + P G+P  
Sbjct:   148 PPCKPCPQGPAGAPG-APGPQGDAGAP-GA-PGQGSGAGAPGPAGPKGASGA-P-GNPGQ 202

Query:   426 RTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLIPLMK 602
               AP     G P         +    G  G+     P GP G    P   G+   P  K
Sbjct:   203 AGAP-----GQPG----ADAQSESIPGAPGQAGPQGPPGPAGSPGAPGGPGQPGAPGQK 252

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.17, P = 0.16
 Identities = 42/129 (32%), Positives = 51/129 (39%), Frame = -3

Query:   580 RPFREGRSDLPRGPCGLAAAP-RPVCPPHRRVGRCVHG--GGAGVPDSRA-AGAVREGGE 413
             RP R G + LP  P    A P  P+ PP  +   C  G  G  G P  +  AGA    G+
Sbjct:   121 RPGRPGAAGLPGNPGRPPAQPCEPITPPPCKP--CPQGPAGAPGAPGPQGDAGAPGAPGQ 178

Query:   412 PAGKEAEAPDTPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQQEGE-GD 236
              +G  A  P  P G A  AP    +    G        DA+ E   G   Q   +G  G 
Sbjct:   179 GSGAGAPGPAGPKG-ASGAPGNPGQAGAPGQPGA----DAQSESIPGAPGQAGPQGPPGP 233

Query:   235 AQRLERPSGQAQGG 194
             A     P G  Q G
Sbjct:   234 AGSPGAPGGPGQPG 247


>gi|3002799 (AF036343) 2-aminomuconic acid semialdehyde dehydrogenase
            [Pseudomonas pseudoalcaligenes]
            Length = 542

  Plus Strand HSPs:

 Score = 97 (34.1 bits), Expect = 0.18, P = 0.17
 Identities = 47/142 (33%), Positives = 56/142 (39%), Frame = +3

Query:   159 RRPPRCI*HVAPPPCA---WPEGRSKRWASPS------PSC-CSCASSPAPCSGSASHHH 308
             RR PR      P P A   WP   ++R A+ S      P    SC ++     G+    H
Sbjct:   359 RRIPRAQPGCRPSPGADSQWPRTVARRAAAESAGDVGDPGGRASCGAARRSAGGAQRGPH 418

Query:   309 ATASHPSGACRGRRRGARQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRP 488
                 +P G     RR  R A   G  GA  +   G    R    A LS  P   P   R 
Sbjct:   419 VPGGYPLGTAGATRRVHRAAGAAG--GAPGA--GGGKRQR----AGLSSRPGRDPPRSRR 470

Query:   489 TRRCGGHTGRGAAASPHGPRGRSDRPSRNGR 581
               R    T RGAA  P   R R  RP+R  R
Sbjct:   471 LARSPWRTPRGAAL-PAAWRARPRRPARRHR 500


>sp|P35311|HSP1_TACAC SPERM PROTAMINE P1 >pir||S39424 protamine P1 - Australian
            echidna >gi|407184 (Z26848) protamine P1 [Tachyglossus aculeatus]
            Length = 69

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 4.8, P = 0.99
 Identities = 16/33 (48%), Positives = 20/33 (60%), Frame = -2

Query:   281 RRWRRSTRA-ARRRGRRPALRAAFRPGAGRGRN 186
             RR RRS R  +RR GR+   R   R G GRG++
Sbjct:    16 RRRRRSRRQRSRRGGRQTGPRKITRRGRGRGKS 48

 Score = 51 (18.0 bits), Expect = 0.18, Sum P(2) = 0.17
 Identities = 11/16 (68%), Positives = 13/16 (81%), Frame = -2

Query:   281 RRWRRSTRAARRRGRR 234
             RR RRS R++RRR RR
Sbjct:    51 RRGRRSMRSSRRRRRR 66

 Score = 50 (17.6 bits), Expect = 0.24, Sum P(2) = 0.21
 Identities = 15/33 (45%), Positives = 21/33 (63%), Frame = -2

Query:   284 TRRWRRSTRAARRRGRRPALRAAFRPGAGRGRN 186
             TRR R   ++ RRRGRR ++R++ R    R RN
Sbjct:    39 TRRGRGRGKSRRRRGRR-SMRSS-RRRRRRRRN 69

 Score = 39 (13.7 bits), Expect = 0.18, Sum P(2) = 0.17
 Identities = 8/10 (80%), Positives = 9/10 (90%), Frame = -2

Query:   422 RRRASRQRSR 393
             RRR+ RQRSR
Sbjct:    18 RRRSRRQRSR 27


>sp|P11675|IE18_PRVIF IMMEDIATE-EARLY PROTEIN IE180 >gi|59968 (X15120)
            immediate-early protein (AA 1-1460) [Suid herpesvirus 1]
            Length = 1461

  Plus Strand HSPs:

 Score = 101 (35.6 bits), Expect = 0.21, P = 0.19
 Identities = 40/122 (32%), Positives = 57/122 (46%), Frame = +3

Query:   237 SPS-PSCCSCASSPAPCSGSASHHHATASHPSGACRGRR-RGARQASPCGVSGASAS--L 404
             SPS P   + A++ A  S S+S   +++S  S +  G    G R  +P   +G   S   
Sbjct:   371 SPSAPRAPAAAAAAARRSASSSSSSSSSSSSSSSSEGEEDEGVRPGAPLARAGPPPSPPA 430

Query:   405 PAGSP-PSRTAPAARLSG---TPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSR 572
             PA +P PS ++ +A  S    +PAP P   RP RR    T    +    GP      P  
Sbjct:   431 PAAAPRPSASSASATSSSAAASPAPAPEPARPPRRKRRSTNNHLSLMADGP------PPT 484

Query:   573 NGRKLIPL 596
             +G  L PL
Sbjct:   485 DGPLLTPL 492

 Score = 97 (34.1 bits), Expect = 0.59, P = 0.44
 Identities = 40/124 (32%), Positives = 50/124 (40%), Frame = +3

Query:   213 EGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGA 392
             EG  +R    S S  S   S +  S + S     A  P+ A    RR A  +S    S +
Sbjct:   345 EGALRRGRGFSSS--SSGGSDSDLSPARSPSAPRA--PAAAAAAARRSASSSSSSSSSSS 400

Query:   393 SASLPAGSPPSRTAPAARLS--GTPAPPPC---TQRPTRRCGGHTGRGAAASPHGPRGRS 557
             S+S   G       P A L+  G P  PP      RP+      T   AAASP  P    
Sbjct:   401 SSSSSEGEEDEGVRPGAPLARAGPPPSPPAPAAAPRPSASSASATSSSAAASP-APAPEP 459

Query:   558 DRPSRNGRK 584
              RP R  R+
Sbjct:   460 ARPPRRKRR 468

 Score = 90 (31.7 bits), Expect = 3.7, P = 0.98
 Identities = 38/127 (29%), Positives = 50/127 (39%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             P P A     +     P  S  S AS  +  SGS+     ++  P  +   RR    +  
Sbjct:   149 PTPAALAAAEAGAPGGPGRSSPSAASPASSSSGSSG----SSGSPGPSAAPRRWSPARGD 204

Query:   372 PCGVSGASASLPAGSPPSR-----TAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASP 536
             P G  G +A     +PP++      APA R   +PA P     P    GG    G A S 
Sbjct:   205 PVGEPGPAARPRTPAPPAQPAAVAAAPARRGPASPASPAAG--PVSAPGG----GGAPSG 258

Query:   537 HGPRGRSDRPSR 572
              G RGR     R
Sbjct:   259 GGDRGRHHHQHR 270


>gi|3047415 (AF058717) cysteine protease [Volvox carteri f. nagariensis]
            Length = 658

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.21, Sum P(2) = 0.19
 Identities = 36/95 (37%), Positives = 43/95 (45%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCASSPAP-----CSGSASHHHATASHPSGA--CRGR 347
             APPP  WP   S    SP P   S  SSP P     C  SAS++   A++P G   C   
Sbjct:   438 APPP-PWPLP-SPPLVSPPPPSPSPPSSPPPPPPPTCQKSASYYWNEATNPLGPNRCNPA 495

Query:   348 RRGAR--QASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPP 473
              RG        C   G    +   SPP R+ P       P+PPP
Sbjct:   496 GRGCECDGLRTCSSYGWCQGISRPSPPLRSPP-------PSPPP 532

 Score = 40 (14.1 bits), Expect = 0.21, Sum P(2) = 0.19
 Identities = 8/22 (36%), Positives = 13/22 (59%), Frame = +2

Query:   536 TRPTGKIRPAFAERPQTYPFNE 601
             +RPT    PA  ++  +Y +NE
Sbjct:   581 SRPTSPPPPAACQKSASYYWNE 602


>gi|310622 (L20249) homologous to Saccharopolyspora erythraea beta-ketoacyl
           synthase [Streptomyces coriofaciens]
           Length = 527

  Plus Strand HSPs:

 Score = 96 (33.8 bits), Expect = 0.23, P = 0.20
 Identities = 48/136 (35%), Positives = 61/136 (44%), Frame = +3

Query:   165 PPRCI*HVAPPPCAWPEGRSKRWA-SPSPSCCSCASSPA-PCSGSASHHHATASHPSGAC 338
             P  C    A P       RS   A SP+P      +SP+ P S + S    ++  PS  C
Sbjct:   394 PAAC--RSATPSTPRSRNRSSSSARSPAPWRTPNRASPSSPTSPAPSPRPVSSPIPSTGC 451

Query:   339 --RGRRRGARQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPT-RRCGGH 509
                G R   R+       GA A L AG  P+ ++P +   G P  P  T RP+ RR    
Sbjct:   452 GTSGDRPLRRRLRALAERGADAYLEAG--PAASSPPS--PGRPWAP--TPRPSPRRAAQG 505

Query:   510 TGRGAAASP---HGPRGRSDRPSR 572
              GRGA  +    H PR R  RP R
Sbjct:   506 PGRGARPAHRARHAPRHR--RPRR 527

 Score = 92 (32.4 bits), Expect = 0.56, Sum P(2) = 0.43
 Identities = 36/99 (36%), Positives = 42/99 (42%), Frame = +3

Query:   297 SHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPP-- 470
             +HHH       G  R   R  R   PC   G S   P  + P      AR++ +PAPP  
Sbjct:   118 AHHHRAGPGDRGG-RAALRPPRLRRPC--PGPSPRSPRSARPQ----LARIATSPAPPRS 170

Query:   471 ----PCTQR----PTRRCGGHTGRG-AAASPHGP-RGRSDRPSRNG 578
                 PCT R    P    GGH  RG A     GP RG   R +  G
Sbjct:   171 TSATPCTARLLRAPRGPAGGHRRRGRAGGGGAGPCRGAQARGALPG 216

 Score = 84 (29.6 bits), Expect = 4.7, Sum P(2) = 0.99
 Identities = 29/87 (33%), Positives = 31/87 (35%), Frame = +3

Query:   324 PSGACRGRRRGARQASPCGVSGASASLPA-GSPPSRTAPAARLSGTPAPPPCTQRPTRRC 500
             P  AC  RR   R   P   S  SA     G  P    PA R    P      +RP   C
Sbjct:   286 PCTACWSRRACRRSRGPVTPSARSARARGRGLLPGGRLPAGRRPRPPDAGTARRRPMAPC 345

Query:   501 GGHTGRGAAASPHGPRGR-SDRPSRNGR 581
               H GRG   +  G   R   RP   GR
Sbjct:   346 R-HRGRGRPTADRGTLPRCGQRPGLRGR 372

 Score = 38 (13.4 bits), Expect = 0.56, Sum P(2) = 0.43
 Identities = 13/33 (39%), Positives = 15/33 (45%), Frame = +1

Query:   205 PGLKAALSAGRRPRLLAALVLLR-QRLVQARHH 300
             P L     A  RP      +LLR QR  +A HH
Sbjct:    89 PLLTETTEARDRPSTPRRRLLLRDQRHQRAHHH 121

  Minus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 4.8, Sum P(2) = 0.99
 Identities = 29/86 (33%), Positives = 35/86 (40%), Frame = -3

Query:   577 PFREGRSDLPRGPCGLAAAPRPVCPPHRRVGRCVHGGGAGVPDSRAAGAVREGGEPA--- 407
             P+R      P  P   A +PRPV  P    G C  G     P  R   A+ E G  A   
Sbjct:   420 PWRTPNRASPSSPTSPAPSPRPVSSPIPSTG-C--GTSGDRPLRRRLRALAERGADAYLE 476

Query:   406 -GKEAEAPDTPHGDACRAPRRRPRHAPEG 323
              G  A +P +P       PR  PR A +G
Sbjct:   477 AGPAASSPPSPGRPWAPTPRPSPRRAAQG 505

 Score = 39 (13.7 bits), Expect = 4.8, Sum P(2) = 0.99
 Identities = 13/26 (50%), Positives = 14/26 (53%), Frame = -2

Query:   260 RAARR--RGRRPALRAAFRPGAGRGR 189
             RAA+   RG RPA RA   P   R R
Sbjct:   501 RAAQGPGRGARPAHRARHAPRHRRPR 526


>sp||CA11_RAT_1 [Segment 1 of 2] COLLAGEN ALPHA 1(I) CHAIN
            Length = 567

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.27, Sum P(2) = 0.23
 Identities = 40/131 (30%), Positives = 57/131 (43%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRR--RGAR- 362
             PP  A   G      +  P   +  + P    G+A         P GA RG    +G R 
Sbjct:   153 PPGSAGARGDDGAVGAAGPPGPTGPTGPPGFPGAAGAKGEAG--PQGA-RGSEGPQGVRG 209

Query:   363 QASPCGVSGASASLPAGSPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTG-RGAAASP 536
             +  P G +GA+   PAG+P +   P A+  +G P        P  R  G +G +G + +P
Sbjct:   210 EPGPPGPAGAAG--PAGNPGADGQPGAKGANGAPGIAGAPGFPGAR--GPSGPQGPSGAP 265

Query:   537 HGPRGRSDRPSRNGRK 584
              GP+G S  P   G K
Sbjct:   266 -GPKGNSGEPGAPGNK 280

 Score = 88 (31.0 bits), Expect = 0.78, Sum P(2) = 0.54
 Identities = 40/131 (30%), Positives = 45/131 (34%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             P   A   G++     P P     A  PA   G A    A    P+G    R       S
Sbjct:   423 PKGTAGEPGKAGERGVPGPPG---AVGPAGKDGEAGAQGAPG--PAGPAGERGEQGPAGS 477

Query:   372 PCGVSGASASLPAGSPPSRTAPAARLSGTP----APPPCTQRPTRRCGGHTGRGAAASPH 539
             P G  G     PAG P     P     G P    AP P   R  R   G  G      P 
Sbjct:   478 P-GFQGLPG--PAGPPGEAGKPGZZ--GVPGDLGAPGPSGARGERGFPGERGVQGPPGPA 532

Query:   540 GPRGRSDRPSRNGRK 584
             GPRG +  P  +G K
Sbjct:   533 GPRGNNGAPGNDGAK 547

 Score = 42 (14.8 bits), Expect = 0.27, Sum P(2) = 0.23
 Identities = 10/24 (41%), Positives = 12/24 (50%), Frame = +1

Query:   139 GSPWLSDDGHPGASNMLRPLPAPG 210
             G P   + G PGAS  + P   PG
Sbjct:    41 GPP--GEPGEPGASGPMGPRGPPG 62


>sp|P30803|CYA5_CANFA ADENYLATE CYCLASE, TYPE V (ATP PYROPHOSPHATE-LYASE)
            (CA(2+)-INHIBITABLE ADENYLYL CYCLASE) >pir||A42904 adenylylcyclase
            type V - dog
            Length = 1184

  Plus Strand HSPs:

 Score = 99 (34.8 bits), Expect = 0.27, P = 0.24
 Identities = 41/121 (33%), Positives = 49/121 (40%), Frame = +3

Query:   204 AWPEG----RSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRR-GARQA 368
             AWP       + RWA+ +P   + AS+ AP     S    TA   +G   G RR GA   
Sbjct:     7 AWPSAGAATTTPRWAATTPWPGASASASAPGRPGRSAAATTAGAAAGGGGGARRAGAAPG 66

Query:   369 SPCGVSG--ASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPT-RRCGGHTGRGAAAS-P 536
              PCG            G+PP   A   R +G P P     R   RR  G   RGA    P
Sbjct:    67 RPCGRRRRPGGGGRGGGAPPLGGAGPGRAAG-PGPRRARARGRGRRPRGRP-RGAGRRRP 124

Query:   537 HGP 545
              GP
Sbjct:   125 AGP 127


>sp|P52949|HXA5_RAT HOMEOBOX PROTEIN HOX-A5 (HOX-1.3) >gi|204644 (L03556)
            hox1.3 protein [Rattus norvegicus]
            Length = 233

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.31, P = 0.27
 Identities = 35/107 (32%), Positives = 43/107 (40%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHATAS-HPSGACRGRRRGARQASPCGVSGASASLPAG 413
             SP P    C S+ AP  GS +HH    S   S  C         +S  GV  ASA+    
Sbjct:    74 SPPPDPLPC-SAVAPLPGSDTHHGGKNSLGNSSGCSANCGSTHISSREGVGTASAA-EED 131

Query:   414 SPPSRTAPAARLSGTPAPPPCTQ-RPTRRCGGHTGRGAAASPHGPRGRS 557
             +P S     A+   +PAPP   Q  P  R   H        P G R R+
Sbjct:   132 APASSEQAGAQSEPSPAPPAQPQIYPWMR-KLHISHDNIGGPEGKRART 179


>gnl|PID|e256050 (X98534) vasodilator-stimulated phosphoprotein [Homo sapiens]
            Length = 378

  Plus Strand HSPs:

 Score = 93 (32.7 bits), Expect = 0.31, P = 0.27
 Identities = 33/113 (29%), Positives = 40/113 (35%), Frame = +3

Query:   213 EGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGA 392
             E    RWA  +PS         P  G        A+ P GA R      R+ + C     
Sbjct:   109 EALEGRWAPSTPSTSHLVGPERPLPGGGGAAEKAAARPVGAHRAPGLQCRRPT-CSPRWG 167

Query:   393 SASLPAGSPPSRTAPAARLS--GTPA--------PPPCTQRPTRRCGGHTGRGA 524
             S      SP SR+ P  R +  G PA        PPP    P  +  G  G GA
Sbjct:   168 STPTTRTSPSSRSPPTPRFAPFGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGA 221


>gi|1304439 (U27488) glycoprotein gX [Suid herpesvirus 1]
            Length = 103

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 0.35, P = 0.29
 Identities = 31/96 (32%), Positives = 44/96 (45%), Frame = +3

Query:   198 PCAWPEGRSK-RWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASP 374
             P A    RS+ R  +P P   +C ++ AP S SAS   A +S  S +C    R +    P
Sbjct:     4 PSAASSSRSRPRPPTPPPPRRACRATSAPRSTSASPSPAWSSWASSSCASIWRSS---GP 60

Query:   375 CGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQR 485
                + A+A+ P   PP    P      +PA PP + R
Sbjct:    61 GPGTTATATWP---PPDPAPP-----DSPAIPPLSHR 89

 Score = 70 (24.6 bits), Expect = 3.9, P = 0.98
 Identities = 26/81 (32%), Positives = 38/81 (46%), Frame = +3

Query:   198 PCAWPEGRSK-RWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASP 374
             P A    RS+ R  +P P   +C ++ AP S SAS   A +S  S +C    R +    P
Sbjct:     4 PSAASSSRSRPRPPTPPPPRRACRATSAPRSTSASPSPAWSSWASSSCASIWRSS---GP 60

Query:   375 CGVSGASASLPAGSPPSRTAPA 440
                + A+A+ P   P    +PA
Sbjct:    61 GPGTTATATWPPPDPAPPDSPA 82


>gi|18992 (X56260) lichenase [Hordeum vulgare]
          Length = 335

  Minus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.35, P = 0.29
 Identities = 37/94 (39%), Positives = 44/94 (46%), Frame = -3

Query:   598 IKGISLRPFREGRSDLP------RGPCGLAAAPRPVCPPHRRVGRCVHGGGAGVPDSRAA 437
             + G+ L+P R G           RGP  L   P PV   H R GR +HG G      R A
Sbjct:   200 VPGLGLQPERHGHELRALHRLRHRGPGRLLRVPEPV--RHHR-GRLLHGHGQARRLQREA 256

Query:   436 GAVRE--------GGEPAGKEAEAPDTPHGDACRAPRRRPRHAP 329
             G VRE        GG+P G+  +    PH      PRR  RH P
Sbjct:   257 GGVRERVAVSRRHGGDP-GQRQDLQPVPH-----QPRRA-RHPP 293


>sp|P10569|MYSC_ACACA MYOSIN IC HEAVY CHAIN >pir||MWAXIC myosin heavy chain IC
            - Acanthamoeba castellanii >gi|155625 (J02974) myosin IB heavy
            chain [Acanthamoeba castellanii]
            Length = 1168

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.35, P = 0.30
 Identities = 45/109 (41%), Positives = 48/109 (44%), Frame = +3

Query:   228 RWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGAS--AS 401
             R A+P+P   S    PAP  G  S   A    P G  RGR  G     P G  GA    +
Sbjct:  1035 RAAAPAPGP-SGGPRPAP-PGGKSGRAAPMGGP-GPMRGRG-GPAPGGP-GRGGAPPPGA 1089

Query:   402 LPAGSPPSRTAPA---ARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGR 554
               AG P  R  PA   A   G  APPP    P    GG  GRG A  P G RGR
Sbjct:  1090 GRAGPPGGRGMPAPGGAAPRGRGAPPPGAGGPP---GG--GRGGAPPPGGMRGR 1138


>gi|2961227 (AF051353) myosin IC heavy chain [Acanthamoeba castellanii]
            Length = 1186

  Plus Strand HSPs:

 Score = 98 (34.5 bits), Expect = 0.36, P = 0.30
 Identities = 45/109 (41%), Positives = 48/109 (44%), Frame = +3

Query:   228 RWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGAS--AS 401
             R A+P+P   S    PAP  G  S   A    P G  RGR  G     P G  GA    +
Sbjct:  1053 RAAAPAPGP-SGGPRPAP-PGGKSGRAAPMGGP-GPMRGRG-GPAPGGP-GRGGAPPPGA 1107

Query:   402 LPAGSPPSRTAPA---ARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGR 554
               AG P  R  PA   A   G  APPP    P    GG  GRG A  P G RGR
Sbjct:  1108 GRAGPPGGRGMPAPGGAAPRGRGAPPPGAGGPP---GG--GRGGAPPPGGMRGR 1156


>gnl|PID|e214000 (Z68219) T05A1.2 [Caenorhabditis elegans]
            Length = 300

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.37, P = 0.31
 Identities = 32/110 (29%), Positives = 37/110 (33%), Frame = +3

Query:   249 SCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCG--VSGASASLPAGSPP 422
             SC  C    A  S  A+    T   P         G    SPC         + P G P 
Sbjct:    96 SCDGCCLPGAAGSVGAAGRPGTPGRPGAPGAPGHPGKPPQSPCEPLTPPPCPACPPGPPG 155

Query:   423 SRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNG 578
             +  AP    S  P  PP    P    GG  G+     PHGP G   +P   G
Sbjct:   156 APGAPGKPGSEGPPGPPGHDGPN---GG-PGQPGQPGPHGPNGHPGKPGSQG 203


>pir||CGRT1S collagen alpha 1(I) chain - rat (fragments)
            Length = 671

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.40, Sum P(2) = 0.33
 Identities = 40/131 (30%), Positives = 57/131 (43%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRR--RGAR- 362
             PP  A   G      +  P   +  + P    G+A         P GA RG    +G R 
Sbjct:   153 PPGSAGARGDDGAVGAAGPPGPTGPTGPPGFPGAAGAKGEAG--PQGA-RGSEGPQGVRG 209

Query:   363 QASPCGVSGASASLPAGSPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTG-RGAAASP 536
             +  P G +GA+   PAG+P +   P A+  +G P        P  R  G +G +G + +P
Sbjct:   210 EPGPPGPAGAAG--PAGNPGADGQPGAKGANGAPGIAGAPGFPGAR--GPSGPQGPSGAP 265

Query:   537 HGPRGRSDRPSRNGRK 584
              GP+G S  P   G K
Sbjct:   266 -GPKGNSGEPGAPGNK 280

 Score = 89 (31.3 bits), Expect = 0.88, Sum P(2) = 0.59
 Identities = 40/131 (30%), Positives = 45/131 (34%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             P   A   G++     P P     A  PA   G A    A    P+G    R       S
Sbjct:   423 PKGTAGEPGKAGERGVPGPPG---AVGPAGKDGEAGAQGAPG--PAGPAGERGEQGPAGS 477

Query:   372 PCGVSGASASLPAGSPPSRTAPAARLSGTP----APPPCTQRPTRRCGGHTGRGAAASPH 539
             P G  G     PAG P     P     G P    AP P   R  R   G  G      P 
Sbjct:   478 P-GFQGLPG--PAGPPGEAGKPGZZ--GVPGDLGAPGPSGARGERGFPGERGVQGPPGPA 532

Query:   540 GPRGRSDRPSRNGRK 584
             GPRG +  P  +G K
Sbjct:   533 GPRGNNGAPGBBGAK 547

 Score = 87 (30.6 bits), Expect = 1.5, Sum P(2) = 0.78
 Identities = 27/81 (33%), Positives = 36/81 (44%), Frame = +3

Query:   351 RGARQASPCGVSGASASLPA-GSPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGA 524
             RG    +P G  GA     A G+P S+ AP    +SG   PP     P     G +G   
Sbjct:   535 RG-NNGAP-GBBGAKGDTGAPGAPGSQGAPGLZGMSGLZGPPGPPGSPGZZ--GPSGASG 590

Query:   525 AASPHGPRGRSDRPSRNGRKLIP 593
              A P GP G +  P ++G   +P
Sbjct:   591 PAGPRGPPGSAGSPGKBGLBGLP 613

 Score = 42 (14.8 bits), Expect = 0.40, Sum P(2) = 0.33
 Identities = 10/24 (41%), Positives = 12/24 (50%), Frame = +1

Query:   139 GSPWLSDDGHPGASNMLRPLPAPG 210
             G P   + G PGAS  + P   PG
Sbjct:    41 GPP--GEPGEPGASGPMGPRGPPG 62


>sp|P26645|MACS_MOUSE MYRISTOYLATED ALANINE-RICH C-KINASE SUBSTRATE (MARCKS)
            >pir||A39169 myristoylated alanine-rich C kinase substrate
            (MARCKS), macrophage - mouse >gi|199027 (M60474) myristoylated
            alanine-rich C-kinase substrate [Mus musculus]
            Length = 309

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.40, P = 0.33
 Identities = 33/96 (34%), Positives = 43/96 (44%), Frame = -3

Query:   472 GGGAGVPDSRAAGAVREGGEPAGKE-AEAPDTPHGDACR--APRRRPRHAPEGCDAVAWW 302
             G GA    + A GA  E    AG E A AP    G A    A    PR A E  +     
Sbjct:   172 GEGAEAEGATAEGAKDEAAAAAGGEGAAAPGEQAGGAGAEGAAGGEPREA-EAAEPEQ-- 228

Query:   301 CDAEPEQGAGEEAQEQQEGEGDAQRLERPSGQAQGGGAT 185
                +PEQ A EE Q +++ E   ++ E P+  A  G A+
Sbjct:   229 -PEQPEQPAAEEPQAEEQSEAAGEKAEEPAPGATAGDAS 266


>prf||2113331A ORF 1 [Streptomyces lavendulae]
            Length = 156

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.40, P = 0.33
 Identities = 29/73 (39%), Positives = 37/73 (50%), Frame = +3

Query:   390 ASASLPAGSPPSRTA--PAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGR-SD 560
             A A  PA SPPS +   P  +   TPAPP    R TR C   T       P G RGR S 
Sbjct:    32 AWAPRPAHSPPSASPAPPRTQPPPTPAPPYPPARSTR-C---TRAAHTDHPGGGRGRPSW 87

Query:   561 RPSRNGRKLIPLMKVN 608
             RP R   + +P ++++
Sbjct:    88 RPPRRRPRRLPTVRID 103


>gi|1814029 (U84501) cuticle collagen [Caenorhabditis briggsae]
            Length = 316

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.41, P = 0.33
 Identities = 40/121 (33%), Positives = 48/121 (39%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGA--CRGRRRGARQASPCGVSGASASLP 407
             A P   C  C + P   +G+          PSGA    G+  GA    P G +G     P
Sbjct:   164 AGPDSFCFDCPAGPPGPAGAPGQ-----KGPSGAPGAPGQSGGAALPGPPGPAGPPG--P 216

Query:   408 AGSPPSRT---APAAR-----LSGTPAP--PPCTQRPTRRCG--GHTGRGAAASPHGPRG 551
             AG P S     AP A      + GTP P  PP    P    G  G  G      P GP+G
Sbjct:   217 AGQPGSNGNAGAPGAPGQVVDVPGTPGPAGPPGPPGPAGAPGQPGQAGSSQPGQP-GPQG 275

Query:   552 RSDRPSRNG 578
              +  P   G
Sbjct:   276 DAGAPGAPG 284

 Score = 84 (29.6 bits), Expect = 2.7, P = 0.93
 Identities = 34/119 (28%), Positives = 44/119 (36%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRR-RGARQASPCGVSGASASLPAG 413
             S   SCCSC    A  +G+     A  +  +    G   + A + S  G        PAG
Sbjct:   117 SAGGSCCSCGVGAAGPAGAPGQDGAPGNDGAPGQDGAPGQDASEDSVAGPDSFCFDCPAG 176

Query:   414 SPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLI 590
              P    AP  +  SG P  P        + GG    G    P GP G + +P  NG    
Sbjct:   177 PPGPAGAPGQKGPSGAPGAPG-------QSGGAALPGPPG-PAGPPGPAGQPGSNGNAGA 228

Query:   591 P 593
             P
Sbjct:   229 P 229

  Minus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.6, P = 0.79
 Identities = 38/121 (31%), Positives = 42/121 (34%), Frame = -3

Query:   556 DLPRGPCGLAAAPRPVCPPHRRVGRCVHGGGAGVPDSRA-AGAVREGGEPAGK-EAEAPD 383
             D P GP G A AP     P    G     GGA +P     AG     G+P     A AP 
Sbjct:   172 DCPAGPPGPAGAPGQK-GPSGAPGAPGQSGGAALPGPPGPAGPPGPAGQPGSNGNAGAPG 230

Query:   382 TPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQQEGEGDAQRLERPSGQA 203
              P G     P       P G    A     +P Q AG     Q   +GDA     P    
Sbjct:   231 AP-GQVVDVPGTPGPAGPPGPPGPAG-APGQPGQ-AGSSQPGQPGPQGDAGAPGAPGAPG 287

Query:   202 QGG 194
             Q G
Sbjct:   288 QAG 290


>sp|P09021|HXA5_MOUSE HOMEOBOX PROTEIN HOX-A5 (HOX-1.3) (M2) >pir||WJMS13
            homeotic protein Hox 1.3 - mouse >gi|51372 (Y00208) homeo domain
            protein [Mus musculus] >gi|51471 (X16840) Hox 1.3 protein (AA
            1-270) [Mus musculus] >gi|193917 (M36604) homeobox 1.3 protein [Mus
            musculus] >gi|309314 (M28021) homeo domain protein [Mus musculus]
            Length = 270

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.41, P = 0.34
 Identities = 35/107 (32%), Positives = 44/107 (41%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPC-GVSGASASLPAG 413
             SP P    C S+ AP  GS SHH    S  + +      G+   S   GV  ASA+    
Sbjct:    95 SPPPDPLPC-SAVAPSPGSDSHHGGKNSLGNSSGASANAGSTHISSREGVGTASAA-EED 152

Query:   414 SPPSRTAPAARLSGTPAPPPCTQ-RPTRRCGGHTGRGAAASPHGPRGRS 557
             +P S     A+   +PAPP   Q  P  R   H        P G R R+
Sbjct:   153 APASSEQAGAQSEPSPAPPAQPQIYPWMR-KLHISHDNIGGPEGKRART 200


>bbs|132270 (S61739) omb biD4=optomotor-blind gene [Drosophila melanogaster,
            larvae, Peptide Mutant, 326 aa] [Drosophila melanogaster]
            Length = 326

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.43, P = 0.35
 Identities = 33/100 (33%), Positives = 44/100 (44%), Frame = +3

Query:   240 PSPSCCSCASSPAPCSGSASH--HHATASHPSGACRGRRRGARQASPCGVSGASASLPAG 413
             P P+  S +SS    + +A+H  HH TA+H S +      GA  A P G +G    LP  
Sbjct:   173 PPPNNNSSSSSSNNSASAAAHPSHHPTAAHHSPST-----GAA-APPAGPTG----LPPP 222

Query:   414 SPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPH 539
             +PP       +    PAPPP    P        G  + A PH
Sbjct:   223 TPPHHLQQQQQQQQHPAPPPPPYFPAAALAALAG--SPAGPH 262


>pir||S55392 msh potein - fruit fly (Drosophila melanogaster) >gi|853822
            (X85331) msh gene product [Drosophila melanogaster]
            Length = 437

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.43, Sum P(2) = 0.35
 Identities = 31/111 (27%), Positives = 47/111 (42%), Frame = +3

Query:   207 WPEGRSKR--WASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCG 380
             WP    +R  W   S  CCS  S+ +  S S+S   ++    S A    +  +R  S   
Sbjct:     3 WPVPPRRRHCWWPISSICCSSTSNTSSSSNSSSSARSSWRSASAAHHLHKTTSR-LSNFS 61

Query:   381 VSGASASLPAGSPPSR-------------TAPAARLSGTPAPPPCTQRPTRR 497
             V+   A     +PP++             T+P ++ S TP PPP   RP+ R
Sbjct:    62 VASLLADTRPRTPPNQAVDGPQNLTSSAATSPISQASSTPPPPPAVGRPSSR 113

 Score = 44 (15.5 bits), Expect = 0.43, Sum P(2) = 0.35
 Identities = 13/31 (41%), Positives = 16/31 (51%), Frame = +1

Query:   466 RRHVHSARRADAAGILAAAQQRAHTAHGEDQ 558
             R+H+ S RR  A   LAA    A  AH + Q
Sbjct:   113 RQHLPSRRRR-APRPLAAGAHAAAAAHAQHQ 142


>pir||S08491 hypothetical protein - golden hamster >gnl|PID|e14518 (X14898) ORF
            (AA 1-286) (1 is 2nd base in codon) [Cricetulus sp.]
            Length = 285

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.45, P = 0.36
 Identities = 45/144 (31%), Positives = 50/144 (34%), Frame = +3

Query:   207 WPE-GRSKRWASPSPSCCSCASSPAPCSGSA-SHHHATASHPSGACRGRRRGARQASPC- 377
             WP  GR  R   P        +SP      A       ASH S + +  RRG    SP  
Sbjct:   105 WPALGRPHRALQPFLRRLPRPASPPRLHQQALPPDRCAASHASSSSQAARRGLASVSPSL 164

Query:   378 GVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRS 557
               SG+       SP  R  P    S    P      P RR   H+     A P   RG  
Sbjct:   165 PRSGSDLKETPPSPGVRVPPG---SSPTTPTSSLALPVRRPQWHSHSFGLAWPWPLRGSH 221

Query:   558 D--RPSRNGRKLIPLMKVNLTWHWPSF 632
                RPS   RK   L  V  T   PSF
Sbjct:   222 SHPRPSPTFRKHHALALVRTTSSLPSF 248


>pir||S50754 hypothetical protein WP6 - Chlamydomonas eugametos >gi|530878
            (L29028) amino acid feature: N-glycosylation sites, aa 41 .. 43, 46
            .. 48, 51 .. 53, 72 .. 74, 107 .. 109, 128 .. 130, 132 .. 134, 158
            .. 160, 163 .. 165; amino acid feature: Rod protein domain, aa 169
            .. 340; amino acid feature: globular pro...
            Length = 351

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.48, P = 0.38
 Identities = 35/117 (29%), Positives = 48/117 (41%), Frame = +3

Query:   186 VAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQ 365
             + P P   P        SPSPS     +SP+P S  AS   +  + PS + +     + Q
Sbjct:   168 ITPTPSPSPSPSPSPSPSPSPSP---KASPSP-SPKASPSPSPKASPSPSPKASPAPSPQ 223

Query:   366 ASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASP 536
              SP     AS   P  SP     P+ R S TP+P P    P+ +         +ASP
Sbjct:   224 PSPTPSPKAS---PVASPQQSPTPSPRPSPTPSPTPS---PSPKASPPPSASPSASP 274

 Score = 87 (30.6 bits), Expect = 1.4, P = 0.76
 Identities = 40/127 (31%), Positives = 51/127 (40%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQA 368
             +P P A P    K   SPSP   S A SP P S + S   +  + P  +     R +   
Sbjct:   195 SPSPKASPSPSPKASPSPSPKA-SPAPSPQP-SPTPSPKASPVASPQQSPTPSPRPSPTP 252

Query:   369 SPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHG-P 545
             SP      S S P  SPP   +P+A  S +P   P T          +G   A+ P G P
Sbjct:   253 SPT----PSPS-PKASPPPSASPSASPSLSPKVSPSTPPTGSPAASPSGSPRASPPGGGP 307

Query:   546 RGRSDRPS 569
                S R S
Sbjct:   308 PAMSPRLS 315

 Score = 82 (28.9 bits), Expect = 5.2, P = 0.99
 Identities = 36/100 (36%), Positives = 42/100 (42%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQA 368
             +P     P  R     SP+PS    AS P   S SAS   +    PS        G+  A
Sbjct:   237 SPQQSPTPSPRPSPTPSPTPSPSPKASPPPSASPSASPSLSPKVSPSTP----PTGSPAA 292

Query:   369 SPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRP 488
             SP G     AS P G PP   A + RLS  P  PP T+ P
Sbjct:   293 SPSG--SPRASPPGGGPP---AMSPRLS--PTIPP-TRSP 324

 Score = 81 (28.5 bits), Expect = 6.9, P = 1.0
 Identities = 33/110 (30%), Positives = 43/110 (39%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQA 368
             +P P   P        SPSP      S+    S S S   + ++ P+G+      G+ +A
Sbjct:   241 SPTPSPRPSPTPSPTPSPSPKASPPPSASPSASPSLSPKVSPSTPPTGSPAASPSGSPRA 300

Query:   369 SPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQR-PTRRCGGHTGR 518
             SP G  G  A  P  SP   T P  R    P P P   R P+   G    R
Sbjct:   301 SPPG-GGPPAMSPRLSP---TIPPTRSPILPIPIPSPIRTPSPAIGRRNRR 347

 Score = 80 (28.2 bits), Expect = 8.9, P = 1.0
 Identities = 41/120 (34%), Positives = 51/120 (42%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCAS---SPAPCSGSASHHHATASHPSGACRGRRRGA 359
             +P P A P    K   SPSP      S   SPAP S   S   +  + P  + +     +
Sbjct:   187 SPSPKASPSPSPKASPSPSPKASPSPSPKASPAP-SPQPSPTPSPKASPVASPQQSPTPS 245

Query:   360 RQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPH 539
              + SP      S S P  SPP   +P+A  S +P   P T  PT   G       AASP 
Sbjct:   246 PRPSPTPSPTPSPS-PKASPPPSASPSASPSLSPKVSPSTP-PT---GS-----PAASPS 295

Query:   540 G-PR 548
             G PR
Sbjct:   296 GSPR 299


>gi|552357 (L17501) [Mirounga leonina histone H2AF gene], gene product
           [Mirounga leonina]
           Length = 31

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.49, P = 0.39
 Identities = 15/32 (46%), Positives = 23/32 (71%), Frame = -1

Query:   399 KPKRLTPRTVTLAVRHDDDLGMLLKDVTLSRG 304
             K KR+TPR + LA+R D++L  L+K  T++ G
Sbjct:     1 KVKRITPRHLQLAIRGDEELDSLIK-ATIAGG 31


>gi|2822172 (AC004080) HXA5_HUMAN HOMEOBOX PROTEIN HOX-A5 [Homo sapiens]
            Length = 270

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.53, P = 0.41
 Identities = 34/107 (31%), Positives = 45/107 (42%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHA--TASHPSGACRGRRRGARQASPCGVSGASASLPA 410
             SP P    C S+ AP  GS SHH    + S+ SGA      G+   S     G ++    
Sbjct:    95 SPQPDPLPC-SAVAPSPGSDSHHGGKNSLSNSSGASADA--GSTHISSREGVGTASGAEE 151

Query:   411 GSPPSRTAPAARLSGTPAPPPCTQ-RPTRRCGGHTGRGAAASPHGPRGRS 557
              +P S    +A+   +PAPP   Q  P  R   H        P G R R+
Sbjct:   152 DAPASSEQASAQSEPSPAPPAQPQIYPWMR-KLHISHDNIGGPEGKRART 200


>pir||D29149 proline-rich protein - mouse (fragment) >gi|200543 (M19419)
            proline-rich salivary protein [Mus musculus]
            Length = 188

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.55, P = 0.43
 Identities = 41/135 (30%), Positives = 51/135 (37%), Frame = +3

Query:   162 RPPRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACR 341
             RPP+      PPP   P+ RS + + P P          P   +  H   T   P     
Sbjct:    58 RPPQ-----GPPPTGGPQQRSPQ-SPPPPGGPQPRPPQGPPPPAGPHPRPTQGPPP---T 108

Query:   342 GRRRGARQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQ-RPTRRCGGHTGR 518
             G +    Q  P   +G     P   PP    P  R    P PP   Q RPT+  G H   
Sbjct:   109 GPQPRPTQGPP--PTGGPQQRPPQGPPPPGGPQPRPPQGPPPPTGPQPRPTQ--GPHPTG 164

Query:   519 GA------AASPHGP-RGRSDRP 566
             G       A +P GP +GR   P
Sbjct:   165 GPQQTPPLAGNPQGPPQGRPQGP 187


>pir||B44984 collagen - nematode (Haemonchus contortus) (fragment)
            Length = 210

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.56, P = 0.43
 Identities = 35/121 (28%), Positives = 40/121 (33%), Frame = +3

Query:   240 PSPSCCSCASS-PAPCSG-SASHHHATASHPSGACRGRRRGAR-QASPCGVSGASASLPA 410
             P P C  C    P P           T  +P         G      P G  G + +  A
Sbjct:    52 PIPPCKPCPQGRPGPPGPIGPPGEPGTPGNPGAPGNDAPPGPPGPKGPPGPPGKAGAPGA 111

Query:   411 GSPPSRTAPAARL-SGTPAPPPCT--QRPTRRCG--GHTGRGAAASPHGPRGRSDRPSRN 575
                P   AP+  L  G P PP  T  Q P    G  GH G   A    GPRG+   P   
Sbjct:   112 AGQPGANAPSEPLVPGPPGPPGPTGPQGPPGPNGAPGHPGAPGAPGEKGPRGQDGHPGAP 171

Query:   576 G 578
             G
Sbjct:   172 G 172


>gnl|PID|e303012 (Y08140) helix-loop-helix protein [Rattus norvegicus]
            Length = 112

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.56, P = 0.43
 Identities = 26/79 (32%), Positives = 35/79 (44%), Frame = +3

Query:   324 PSGACRGRRRGARQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTR--R 497
             P+  C  + R   Q+     + A+   PAG PP  TA AA   G  A P  +Q P R   
Sbjct:    12 PASRCH-QERPYFQSWLLSPADAAPDFPAGGPPPTTAVAAAAYGPDARP--SQSPGRLEA 68

Query:   498 CGGHTGRGAAASPHGPRGRSD 560
              GG   R   + P   R R++
Sbjct:    69 LGGRLPRRKGSGPKKERRRTE 89


>sp|P06487|VGLI_HSV11 GLYCOPROTEIN I >pir||QQBE77 glycoprotein I precursor -
            human herpesvirus 1 (strain 17) >gnl|PID|e312379 (X14112) Virion
            glycoprotein I [human herpesvirus 1] >gi|59879 (X02138) 41K (Us7)
            (aa 1-390) [Human herpesvirus 1] >gi|291497 (L00036) 41 kDa protein
            [Human herpesvirus 1]
            Length = 390

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.56, P = 0.43
 Identities = 28/84 (33%), Positives = 40/84 (47%), Frame = +3

Query:   219 RSKR--WASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGA 392
             RS+R  ++   P+  SCA + A  +   +      SHPS   + RRR +R   P   + A
Sbjct:   305 RSRRPIYSPQMPTGISCAVNEAAMARLGAE---LKSHPSTPPKSRRRSSRTPMPSLTAIA 361

Query:   393 SASLPAGSPPSRTAPAARLSGTPAPP 470
               S PAG+    T P    + TP PP
Sbjct:   362 EESEPAGAAGLPTPPVDPTTPTPTPP 387


>prf||0910139A collagen alpha1(I)CN8 [Bos taurus]
            Length = 279

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.57, P = 0.43
 Identities = 34/112 (30%), Positives = 48/112 (42%), Frame = +3

Query:   264 ASSPAPC--SGSASHHHATASHPSGACRGRR-----RGAR-QASPCGVSGASASLPAGSP 419
             A  P P   +G      A  +   G  +G R     +G R +  P G +GA+   PAG+P
Sbjct:    30 AGPPGPTGPAGPPGFPGAVGAKGEGGPQGPRGSEGPQGVRGEPGPPGPAGAAG--PAGNP 87

Query:   420 PSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRK 584
              +   P A+  +G P        P  R  G +G    + P GP+G S  P   G K
Sbjct:    88 GADGEPGAKGANGAPGIAGAPGFPGAR--GPSGPQGPSGPPGPKGNSGEPGAPGNK 141


>bbs|132291 (S61744) omb omb3198=optomotor-blind gene [Drosophila melanogaster,
            larvae, Peptide Mutant, 394 aa] [Drosophila melanogaster]
            Length = 394

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.57, P = 0.44
 Identities = 33/100 (33%), Positives = 44/100 (44%), Frame = +3

Query:   240 PSPSCCSCASSPAPCSGSASH--HHATASHPSGACRGRRRGARQASPCGVSGASASLPAG 413
             P P+  S +SS    + +A+H  HH TA+H S +      GA  A P G +G    LP  
Sbjct:   173 PPPNNNSSSSSSNNSASAAAHPSHHPTAAHHSPST-----GAA-APPAGPTG----LPPP 222

Query:   414 SPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPH 539
             +PP       +    PAPPP    P        G  + A PH
Sbjct:   223 TPPHHLQQQQQQQQHPAPPPPPYFPAAALAALAG--SPAGPH 262


>gi|1658503 (U75467) Atu [Drosophila melanogaster]
            Length = 724

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.58, P = 0.44
 Identities = 42/139 (30%), Positives = 59/139 (42%), Frame = +3

Query:   219 RSKRWASPSPSCCSCASSPAPCSGSASHHH----ATA-SHPSGACRGRRRGARQASPCGV 383
             RS+  +  S S     S  +  SGSA   H    A+A S  S +   RR G+ +    G 
Sbjct:    44 RSRSGSRSSRSRSGSGSPRSARSGSAESRHSQLSASARSKRSRSAHSRRSGSARTRKSGT 103

Query:   384 SGASASLPAGSPPSRTA--PAARLSGTPAPPPCTQRPTRRCGG-HTGR-GAAASPHGPRG 551
               +  S  +GS  SR +  P +R SG+P         +RR G  H+ R G+A S      
Sbjct:   104 PESPQSHRSGSLQSRKSGSPQSRRSGSPQSRKSGSTHSRRSGSAHSRRSGSARSRKSGSA 163

Query:   552 RSDRPSRNGRKLIPLMKVN 608
             +SDR     R     +K N
Sbjct:   164 QSDRSESRSRSHSGSLKGN 182

 Score = 89 (31.3 bits), Expect = 2.2, P = 0.88
 Identities = 35/116 (30%), Positives = 51/116 (43%), Frame = +3

Query:   258 SCASSPAPCSGSASHHHATASHP--SGACRGRRRGARQASPCGVSGASASLPAGSPPSRT 431
             S  S  +  S SA    + ++H   SG+ R R+ G  ++     SG+  S  +GSP SR 
Sbjct:    68 SAESRHSQLSASARSKRSRSAHSRRSGSARTRKSGTPESPQSHRSGSLQSRKSGSPQSRR 127

Query:   432 A--PAARLSGTPAPPPCTQRPTRRCGGHTGR--GAAASPHGP-RGRSDRPSRNGRK 584
             +  P +R SG+          +RR G    R  G+A S     R RS   S  G +
Sbjct:   128 SGSPQSRKSGSTHSRRSGSAHSRRSGSARSRKSGSAQSDRSESRSRSHSGSLKGNE 183


>gi|3165522 (AF067607) Similar to cuticular collagen; C18H7.3 [Caenorhabditis
            elegans]
            Length = 460

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.61, Sum P(2) = 0.46
 Identities = 31/118 (26%), Positives = 44/118 (37%), Frame = +3

Query:   204 AWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGAR-QASPCG 380
             A P G +   A+ +P      ++PA          A A+ P  A       A  +A+P  
Sbjct:   351 AEPAGAAPDAAAAAPEAAPAEAAPAAEGAGGGAEPAGAAAPDAAAAAPEAAAAPEAAPAA 410

Query:   381 VSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRS 557
                   + PAG+ P   A A   +G    PP             G+G  ASP  P G+S
Sbjct:   411 EGAGGGAEPAGAAPEAAAAAPEGAGGGEAPPTN-----------GKGGEASPAYPTGQS 458

 Score = 80 (28.2 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 37/128 (28%), Positives = 51/128 (39%), Frame = +3

Query:   204 AWPEGRSKRWASPSPSCCSCASSPAPCS--GSASHHHATASHPSGACRGRRRGARQASPC 377
             A PE      A+P+       + PA  +   +A+   A  +  + A  G   GA  A   
Sbjct:   331 AAPEAAPAE-AAPAAEGAGGGAEPAGAAPDAAAAAPEAAPAEAAPAAEGAGGGAEPAGAA 389

Query:   378 GVSGASASLPAGSPPSRTAPAARLSG---TPA---PPPCTQRPTRRCGGHT----GRGAA 527
                 A+A+  A + P   APAA  +G    PA   P      P    GG      G+G  
Sbjct:   390 APDAAAAAPEAAAAPE-AAPAAEGAGGGAEPAGAAPEAAAAAPEGAGGGEAPPTNGKGGE 448

Query:   528 ASPHGPRGRS 557
             ASP  P G+S
Sbjct:   449 ASPAYPTGQS 458

 Score = 42 (14.8 bits), Expect = 0.61, Sum P(2) = 0.46
 Identities = 10/25 (40%), Positives = 12/25 (48%), Frame = +1

Query:   160 DGHPGASNMLRPLPAPGLKAALSAG 234
             DG PGA+       APG K   + G
Sbjct:   185 DGKPGAAGSDGEAGAPGTKTTNAPG 209


>gi|16864 (Z17688) histone H2A [Arabidopsis thaliana]
          Length = 46

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 0.63, P = 0.47
 Identities = 13/34 (38%), Positives = 22/34 (64%), Frame = -1

Query:   339 GMLLKDVTLSRGGVMPSLNKALAKKHKSSKKARA 238
             G LL  VT++ GGV+P++N  L  K  ++  ++A
Sbjct:     1 GRLLHGVTIASGGVLPNINPVLLPKKSTASSSQA 34


>pir||PN0081 sperm chromatin protein I2-1 - Argentinian shortfin squid
            (fragment)
            Length = 52

  Minus Strand HSPs:

 Score = 44 (15.5 bits), Expect = 0.66, Sum P(2) = 0.48
 Identities = 9/11 (81%), Positives = 11/11 (100%), Frame = -2

Query:   422 RRRASRQRSRS 390
             RRR+SR+RSRS
Sbjct:     9 RRRSSRRRSRS 19

 Score = 41 (14.4 bits), Expect = 0.66, Sum P(2) = 0.48
 Identities = 10/22 (45%), Positives = 13/22 (59%), Frame = -2

Query:   275 WRRSTRAARRRGRRPALRAAFR 210
             +RR +R  RRR RR   R + R
Sbjct:    21 YRRRSRHHRRRRRRSTTRRSRR 42


>gi|2564955 (AF030001) unknown [Mus musculus]
            Length = 306

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.66, P = 0.48
 Identities = 33/107 (30%), Positives = 43/107 (40%), Frame = +3

Query:   168 PRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGR 347
             P  + H +PPP   P+  ++    P P        P   + S+ HHH    H SG     
Sbjct:     9 PDSVPHTSPPPYNAPQPPAE---PPIP--------PPQTAPSSHHHHHHHYHQSGTATLP 57

Query:   348 RRGARQASPCGVS---GASASLPAGSPPSRTAPAARLSGTPAPPPCTQRP 488
             R GA   +    S   G S+S     PP   AP    +G P PP C   P
Sbjct:    58 RLGAGGLASAAASAQRGPSSSATLPRPPHH-APPGPAAGAP-PPGCATLP 105


>bbs|132259 (S61732) omb=optomotor-blind gene [Drosophila melanogaster, larvae,
            Peptide Partial, 447 aa] [Drosophila melanogaster]
            Length = 447

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.69, P = 0.50
 Identities = 33/100 (33%), Positives = 44/100 (44%), Frame = +3

Query:   240 PSPSCCSCASSPAPCSGSASH--HHATASHPSGACRGRRRGARQASPCGVSGASASLPAG 413
             P P+  S +SS    + +A+H  HH TA+H S +      GA  A P G +G    LP  
Sbjct:   173 PPPNNNSSSSSSNNSASAAAHPSHHPTAAHHSPST-----GAA-APPAGPTG----LPPP 222

Query:   414 SPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPH 539
             +PP       +    PAPPP    P        G  + A PH
Sbjct:   223 TPPHHLQQQQQQQQHPAPPPPPYFPAAALAALAG--SPAGPH 262


>pir||S34827 omb protein - fruit fly (Drosophila melanogaster)
            Length = 457

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.71, P = 0.51
 Identities = 33/100 (33%), Positives = 44/100 (44%), Frame = +3

Query:   240 PSPSCCSCASSPAPCSGSASH--HHATASHPSGACRGRRRGARQASPCGVSGASASLPAG 413
             P P+  S +SS    + +A+H  HH TA+H S +      GA  A P G +G    LP  
Sbjct:   173 PPPNNNSSSSSSNNSASAAAHPSHHPTAAHHSPST-----GAA-APPAGPTG----LPPP 222

Query:   414 SPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPH 539
             +PP       +    PAPPP    P        G  + A PH
Sbjct:   223 TPPHHLQQQQQQQQHPAPPPPPYFPAAALAALAG--SPAGPH 262


>sp|O00268|T2D3_HUMAN TRANSCRIPTION INITIATION FACTOR TFIID 135 KD SUBUNIT
            (TAFII-135) (TAFII135) (TAFII-130) (TAFII130) >gnl|PID|e305208
            (Y11354) subunit of RNA polymerase II transcription factor TFIID
            [Homo sapiens]
            Length = 1083

  Plus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.72, P = 0.51
 Identities = 32/113 (28%), Positives = 48/113 (42%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAG 413
             A P+P+  S  ++PAP + +A+        P+ A   R  G     P G   A+ ++P  
Sbjct:   246 APPAPAAPSPPAAPAPAAPAAA---PPPPPPAPATLARPPG----HPAGPPTAAPAVP-- 296

Query:   414 SPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSR 572
              PP+           PAP P    P     G  G GAAA+   P  +++ P R
Sbjct:   297 -PPAAAQNGGSAGAAPAPAPAAGGPAG-VSGQPGPGAAAAAPAPGVKAESPKR 347

 Score = 88 (31.0 bits), Expect = 4.5, P = 0.99
 Identities = 38/117 (32%), Positives = 46/117 (39%), Frame = +3

Query:   165 PPRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRG 344
             PP     V PPP A   G S   A+P+P+    A  PA  SG      A A+   G    
Sbjct:   288 PPTAAPAV-PPPAAAQNGGSAG-AAPAPA--PAAGGPAGVSGQPGPGAAAAAPAPGVKAE 343

Query:   345 RRRGARQASPCGVSGASASLPAGSPPSR----TAPAARLSGTPAPPPCTQRPTRRCGGHT 512
               +   QA+P      +AS PA +  S     T   A  S    PPP    PT    G  
Sbjct:   344 SPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAA 403

Query:   513 G 515
             G
Sbjct:   404 G 404


>sp|P31271|HXAD_HUMAN HOMEOTIC PROTEIN HOX-A13 (HOX-1J) >gi|1832353 (U82827)
            transcription factor HOXA13 [Homo sapiens]
            Length = 388

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.74, P = 0.52
 Identities = 31/106 (29%), Positives = 48/106 (45%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASP--SPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQ 365
             P P A P   S   ++P  +P   + A++ A  + +A+   +++  P  A       A+Q
Sbjct:    94 PAPLA-PGAASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAAAEAAKQ 152

Query:   366 ASPCGVSGASASLPAGSP----PSRTAPAARLSGTP-APPPCTQRPT 491
              SPC  +  S+S PA  P     S   P AR+   P A   C Q P+
Sbjct:   153 CSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPPPNAIKSCPQPPS 199


>gnl|PID|e249086 (Z74037) F57B7.3 [Caenorhabditis elegans]
            Length = 295

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 0.81, P = 0.56
 Identities = 41/128 (32%), Positives = 57/128 (44%), Frame = +3

Query:   216 GRSKRWASPSPSCCSCASSPAPC-SGSASHHHATASHPSGACRGRRRGARQASPCGVSGA 392
             GR+KR AS     C+C + P+ C +G      A          G+     Q +      A
Sbjct:    73 GRNKRQAS-----CNCGTQPSNCPAGPPGPPGAPGDQGLDGAPGQPGNVGQNAVVASIAA 127

Query:   393 SAS----LPAGSP-PSRT--APAAR-LSGTPAPPPCTQRPTRRCGGHTG-RGAAASPHGP 545
             S S     PAG+P P     AP A   SG P     + +P     G  G +G A +P  P
Sbjct:   128 STSECIPCPAGAPGPQGPDGAPGAPGPSGQPGQDGASGQPG--APGVAGPQGDAGTPGQP 185

Query:   546 --RGRSDRPSRNGRK 584
               +G+  RP +NGR+
Sbjct:   186 GQQGQDGRPGQNGRR 200


>gi|1103869 (U39815) surface coat glycoprotein TES-120 precursor [Toxocara
            canis]
            Length = 176

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 0.82, P = 0.56
 Identities = 29/89 (32%), Positives = 39/89 (43%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATAS-HPSGACRGRRRGARQASPCGVSGASASLP- 407
             A+P     S +SSP+  S SAS   ++AS   S A       +  +SP   S +SAS   
Sbjct:    16 ATPQMMSSSSSSSPSTSSSSASTSSSSASTSSSSASTSSSSASTSSSPASTSSSSASTSS 75

Query:   408 -AGSPPSRTAPAARLS-GTPAPPPCTQRP 488
              AGS  +   P +  S  T  P   T  P
Sbjct:    76 MAGSTSTAAGPTSSSSVSTSTPAVMTTTP 104


>pir||S14086 protamine - common cuttlefish
            Length = 56

  Minus Strand HSPs:

 Score = 45 (15.8 bits), Expect = 0.82, Sum P(2) = 0.56
 Identities = 12/24 (50%), Positives = 13/24 (54%), Frame = -2

Query:   281 RRWRRSTRAARRRGRRPALRAAFR 210
             RR RRS R  R R RR   R  +R
Sbjct:    30 RRRRRSRRRRRYRRRRSYSRRRYR 53

 Score = 40 (14.1 bits), Expect = 2.8, Sum P(2) = 0.94
 Identities = 9/16 (56%), Positives = 11/16 (68%), Frame = -2

Query:   281 RRWRRSTRAARRRGRR 234
             RR+RR    +RRR RR
Sbjct:    39 RRYRRRRSYSRRRYRR 54

 Score = 39 (13.7 bits), Expect = 0.82, Sum P(2) = 0.56
 Identities = 8/11 (72%), Positives = 10/11 (90%), Frame = -2

Query:   422 RRRASRQRSRS 390
             RRR+ R+RSRS
Sbjct:    10 RRRSRRRRSRS 20


>prf||2208307A PNG gene [Homo sapiens]
            Length = 199

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 0.84, P = 0.57
 Identities = 38/97 (39%), Positives = 47/97 (48%), Frame = +3

Query:   309 ATASHPSGACRGR-RRGARQASPCGVS--GASAS--LPAGS-PPSRTAPAARLSGTPAPP 470
             A A+ P GA  G   R +R+ASP  V+  GA  S   PA +   S TA  A L+  PAP 
Sbjct:    12 ALAAEPRGADAGELTRASRRASPEAVAQGGARRSHVAPAAAMADSGTAGGAALAA-PAPG 70

Query:   471 PCTQRPTRRCGGHTGRGAAASPHGPRGRSDR-PSRNGRKL 587
             P +  P  R    +  GAA    GP G  D  P R   K+
Sbjct:    71 PGSGGPGPRVYFQSPPGAAGE--GPGGADDEGPVRRQGKV 108


>gi|30016 (X07884) preprocollagen (AA -22 to 450) (1500 is 1st base in codon)
          [Homo sapiens] >gi|553615 (M36546) alpha-1 collagen type I [Homo
          sapiens]
          Length = 472

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 0.84, Sum P(2) = 0.57
 Identities = 30/87 (34%), Positives = 40/87 (45%), Frame = +3

Query:   324 PSGACRGRR--RGAR-QASPCGVSGASASLPAGSPPSRTAPAAR-LSGTPAPPPCTQRPT 491
             P G  RG    +G R +  P G +GA+   PAG+P +   P A+  +G P        P 
Sbjct:   357 PQGP-RGSEGPQGVRGEPGPPGPAGAAG--PAGNPGADGQPGAKGANGAPGIAGAPGFPG 413

Query:   492 RRCGGHTGRGAAASPHGPRGRSDRPSRNGRK 584
              R  G +G      P GP+G S  P   G K
Sbjct:   414 AR--GPSGPQGPGGPPGPKGNSGEPGAPGSK 442

 Score = 42 (14.8 bits), Expect = 0.84, Sum P(2) = 0.57
 Identities = 10/24 (41%), Positives = 12/24 (50%), Frame = +1

Query:   139 GSPWLSDDGHPGASNMLRPLPAPG 210
             G P   + G PGAS  + P   PG
Sbjct:   203 GPP--GEPGEPGASGPMGPRGPPG 224


>gi|294759 (L04667) resolvase [Plasmid RP4]
           Length = 123

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 0.84, Sum P(2) = 0.57
 Identities = 23/54 (42%), Positives = 27/54 (50%), Frame = -3

Query:   499 HR-RVGRCVHGGGAGVPDSRAAGAVREGGEPAGKEA-EAPDTPHGDACRAPRRRPR 338
             HR R+G C  GG  G+  +   GA R    P G  A +A D P   ACRA  R  R
Sbjct:    23 HRCRLGGC--GGPVGL-HADDGGACRRR-TPQGTRAMDADDVPGAAACRADVRAHR 74

 Score = 49 (17.2 bits), Expect = 0.84, Sum P(2) = 0.57
 Identities = 18/46 (39%), Positives = 19/46 (41%), Frame = -2

Query:   296 CRA*TRRWRRSTRAARRRGRRPALRAAFRPGAGR---GRNMLDAPG 168
             CRA  R  R      R  GR  A R   RP  GR   GR +   PG
Sbjct:    66 CRADVRAHRVQHLRRRASGRWQAHRFPQRPDHGRHGPGRQLGRCPG 111


>pir||I57561 GATA-4 - human >gnl|PID|d1011996 (D78260) GATA-4 transcription
            factor [Homo sapiens]
            Length = 439

  Plus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.88, P = 0.59
 Identities = 39/129 (30%), Positives = 52/129 (40%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             PP    P   ++R A+P+PSC + A    P   +  H  A          GRRRG     
Sbjct:     8 PPTTGRPPVPTRR-AAPAPSCTARAR---PRQSTCPHRGALLRAGPVLPPGRRRGLCVRR 63

Query:   372 PCGVSGASASLPAGSPPSRTAPAARLSGTPA----PPPCTQRPTRRCGGHTGRGAAASPH 539
             P G S   A+  AG    + +P    +G       PPP +  P     G TG  AAA+  
Sbjct:    64 PSGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVS--PRFSFPGTTGSLAAAAAA 121

Query:   540 GPRGRSDRPSRNG 578
               R  +   S  G
Sbjct:   122 AAREAAAYSSGGG 134


>gi|2338034 (AF005370) putative immediate early protein [Alcelaphine
            herpesvirus 1]
            Length = 1300

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.89, P = 0.59
 Identities = 29/92 (31%), Positives = 37/92 (40%), Frame = -3

Query:   469 GGAGVPDSRAAGAVREGGEPAGKEAEAPDTPHGDACRAPRRRPRHAPEGCDAVAWWCDAE 290
             G  G       G  R  G P G+  E P+ P G+    P    R +P+G  A       E
Sbjct:   459 GPEGPEGPEGEGPERPEG-PEGEGPEGPEGPEGEGPEGPEGPERDSPDGPGAQEGPEGPE 517

Query:   289 PEQGAGEEAQEQQEGEGDAQRLERPSGQAQGG 194
               +G G E  E  EGEG  +  E P G+   G
Sbjct:   518 GPEGEGPEGLEGPEGEGP-EGPEGPEGEGPEG 548

 Score = 90 (31.7 bits), Expect = 3.3, P = 0.96
 Identities = 39/123 (31%), Positives = 50/123 (40%), Frame = -3

Query:   550 PRGPCGLAAAPRPVCP--PHRRVGRCVHGGGAGVPDSRAAGAVREGGE-PAG-KEAEAPD 383
             P GP G    P    P  P    G    G      DS      +EG E P G +E E P+
Sbjct:   535 PEGPEG----PEGEGPEGPEGPEGEGPEGPEGPERDSPDGPGAQEGPEGPEGPEEDEGPE 590

Query:   382 TPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQQEGEGDAQRLER----P 215
              P G     P       PEG +      D  PE+  G E  +  +G G AQ +      P
Sbjct:   591 GPEGPEGEGPEGPEGEGPEGLEGPEG--DEGPEEPEGPEG-DSPDGPG-AQEVPEGPKGP 646

Query:   214 SGQAQGGGATC 182
              G+ Q G ++C
Sbjct:   647 EGECQSGPSSC 657

 Score = 87 (30.6 bits), Expect = 7.2, P = 1.0
 Identities = 39/128 (30%), Positives = 46/128 (35%), Frame = -3

Query:   568 EG-RSDLPRGPCGLAAAPRPVCPPHRRVGRCVHGGGAGVPDSRAAGAVREGGE-PAGKEA 395
             EG   D P GP      P     P    G     G  G       G   EG E P G E 
Sbjct:   335 EGPEGDSPDGP-DAQEGPEGPGGPDEDEGPEEPEGPEGEGPEGPEGPEGEGPEGPEGPEG 393

Query:   394 EAPDT---PHGDACRAPRRRPRHAPEGCDAVAWWCDAEPEQGAGEEAQEQQEGEGDAQRL 224
             E P+    P G+    P      +P+G  A       E  +G G E  E  EGEG  +  
Sbjct:   394 EGPEGLEGPEGEGPEGPEGPEGDSPDGPGAQEGPEGPEGPEGEGPEGLEGPEGEGP-EGP 452

Query:   223 ERPSGQAQGG 194
             E P G+   G
Sbjct:   453 EGPEGEGPEG 462

 Score = 87 (30.6 bits), Expect = 7.2, P = 1.0
 Identities = 40/133 (30%), Positives = 48/133 (36%), Frame = -3

Query:   577 PFREGRSDLPRGPCGLAAAPRPVCPPHRRVGRCVHGGGAGVPDSRAAGAVREGGE-PAGK 401
             P  EG    P GP G    P  +  P         G     PD   A    EG E P G+
Sbjct:   380 PEGEGPEG-PEGPEG--EGPEGLEGPEGEGPEGPEGPEGDSPDGPGAQEGPEGPEGPEGE 436

Query:   400 EAEAPDTPHGDACRAPRRRPRHAPEGCDAVAWWCDAEPE--QGAGEEAQEQQEGEG---- 239
               E  + P G+    P       PEG +         PE  +G G E  E  EGEG    
Sbjct:   437 GPEGLEGPEGEGPEGPEGPEGEGPEGPEGPEGEGPERPEGPEGEGPEGPEGPEGEGPEGP 496

Query:   238 DAQRLERPSGQ-AQGG 194
             +    + P G  AQ G
Sbjct:   497 EGPERDSPDGPGAQEG 512


>gi|1491961 (U60315) MC018L [Molluscum contagiosum virus subtype 1]
            Length = 680

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.91, P = 0.60
 Identities = 31/90 (34%), Positives = 41/90 (45%), Frame = +3

Query:   240 PSPSCCSCASS-PAP-CSGSASHHHATASHPSGACRGRRRGARQASPCGV-SGASASLPA 410
             P P+C S  S  PAP C  +     A AS P+ A       A  ++P    + A AS PA
Sbjct:   194 PVPACTSAPSCVPAPACMSAPVPACAPASAPARAPASAPARAPASAPASAPASAPASAPA 253

Query:   411 GSPPSRTAPAARLSGTPAP-PPCTQRPTRR 497
              +P S  A   +  GTP P  P ++R   R
Sbjct:   254 SAPASAPARTHKRKGTPLPLRPRSKRVRAR 283


>gi|2145052 (AF000412) merozoite surface protein-1 [Plasmodium berghei]
            Length = 144

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.97, P = 0.62
 Identities = 31/110 (28%), Positives = 45/110 (40%), Frame = +3

Query:   186 VAPPPCAWPEGRSKRWASPSPSCC-SCASSPAPCSGSASHHHATASHPSGACRGRRRGAR 362
             + P P A P         P+P    +  ++P P + +A     T   P  A      GA 
Sbjct:     7 IDPEPVASPPTPPTPPTPPTPPTPPTLPTTPTPVTPAAPSEQTTT--PEAATAASNPGAS 64

Query:   363 QA-SPCGVSGASASLPAGSPPSRTAPAARLSGTP-------APPPCTQRPTR 494
              + +P    GASAS    +P + + P A  S TP       AP   T +PT+
Sbjct:    65 ASETPASNPGASASSTPSTPAAASNPGASASSTPSTASNPSAPASSTVQPTQ 116


>gi|1054708 (Z67738) W03G11.1 [Caenorhabditis elegans]
            Length = 279

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 0.97, P = 0.62
 Identities = 34/117 (29%), Positives = 43/117 (36%), Frame = +3

Query:   243 SPSCCSCASSPA--PCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAGS 416
             S  C  C  +PA  P        +  A  P       R GAR  SP G  G S +  A  
Sbjct:   129 SQFCFDCPEAPAGPPGRPGPDGENGGAGEPGRDGLAGRPGAR-GSP-GPRGPSGNPGADG 186

Query:   417 PPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLIP 593
             P  +  P    +  P+P            G  G   A  P GP G + RP R+G+   P
Sbjct:   187 PAGQLGPQGGSNVAPSP-----------AGEPGAPGAQGPKGPPGAAGRPGRDGQPGAP 234


>gi|2559000 (AF025995) hypothetical 21 kDa protein; p21 [Mycobacterium
            genavense]
            Length = 190

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.0, P = 0.63
 Identities = 38/110 (34%), Positives = 46/110 (41%), Frame = +3

Query:   264 ASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAGSPPSRTAPAA 443
             AS P    G+   H A   H +  CRG+R+  R   P  V G  A    G    R +   
Sbjct:    22 ASPPHQGFGTRRRHCANTGH-AAVCRGQRQTGRSIEP--VDGRGAR--RGPNSVRKSSPR 76

Query:   444 RLSGTPAPPPCTQR---PTRRCGGHTGRGAAASPHGPRGRSDRPS---RNGRKLIP 593
             R+      P  T R   P RR GG       A  HGPR    RP+    +GRK  P
Sbjct:    77 RIGNRYLHPQRTPRVRVPRRRPGG-------AYRHGPRRLHLRPTVRAASGRKPRP 125


>pir||S29309 hypothetical protein 4 (phaC2 3' region) - Pseudomonas aeruginosa
            (fragment)
            Length = 217

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 1.0, P = 0.64
 Identities = 31/129 (24%), Positives = 54/129 (41%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSG--ACRGRRRGAR 362
             A    A P  +    A+  P+    A   A  + +A      A+ P+   A +   + A 
Sbjct:    66 AKTAAAKPAAKPAAKAAAKPAAKPAAKKTAAKTAAAKPAAKPAAKPTAKAAAKPATKPAA 125

Query:   363 QASPCGVSGASASLPAGSPPSR--TAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASP 536
             +A+    +  +A+ PA  P ++   A AA+ +  PA  P  ++P  +      + AAA P
Sbjct:   126 KAAAKPAAKPAAAKPAAKPAAKPAAATAAKPAAKPAAKPAAKKPAAK--KPAAKPAAAKP 183

Query:   537 HGPRGRSDRPS 569
               P   S  P+
Sbjct:   184 AAPAASSSAPA 194

 Score = 79 (27.8 bits), Expect = 5.2, P = 0.99
 Identities = 30/117 (25%), Positives = 48/117 (41%), Frame = +3

Query:   186 VAPPPCAWPEGRSKRWASPS--PSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGA 359
             V+  P A  +  +K  A P+  P+  + A+ PA    +A      A+ P+      +  A
Sbjct:    44 VSVKPAA--KAAAKPAAKPAAKPAAKTAAAKPA-AKPAAKAAAKPAAKPAAKKTAAKTAA 100

Query:   360 RQASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASP 536
               A P     A  +  A + P+ T PAA+ +  PA  P   +P  +         AA P
Sbjct:   101 --AKPAAKPAAKPTAKAAAKPA-TKPAAKAAAKPAAKPAAAKPAAKPAAKPAAATAAKP 156


>bbs|175868 buforin II=antimicrobial peptide [Bufo bufo=Asian toads,
            gargarizans, stomach, Peptide, 21 aa]
            Length = 21

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 1.1, P = 0.65
 Identities = 14/20 (70%), Positives = 17/20 (85%), Frame = -1

Query:   576 RSAKAGLIFPVGRVGSLLRR 517
             RS++AGL FPVGRV  LLR+
Sbjct:     2 RSSRAGLQFPVGRVHRLLRK 21


>gnl|PID|e229796 (X96713) collagen [Globodera pallida]
            Length = 297

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 1.1, P = 0.67
 Identities = 38/140 (27%), Positives = 49/140 (35%), Frame = -3

Query:   580 RPFREGRSDLPRGPCGLAAAPRPVCP---PHRRVGRCVHG--GGAGVPDSRAAGAVREGG 416
             +P + G    P  PC     P P CP   P R  G+   G  GGAG P + A G  +   
Sbjct:   122 QPGQPGAPGQPSAPCPAQNVPCPRCPAGPPGRPGGQGPAGPPGGAGQPGTPAQGGGQGPP 181

Query:   415 EPAGKEAEAPDTPHGDACRAPRR--------RPRHAPEGCDAVAWWCDAEPEQGAGEEAQ 260
              P G +       HG     P +        RP   P+G          +P  G G    
Sbjct:   182 GPPGPQGPPGQPGHGGGPGQPGQPGAPAVVSRPVPGPKGPSGAP----GQPGHGGGPGQP 237

Query:   259 EQQEGEGDAQRLERPSGQAQGGGA 188
              Q  G+G       P      GG+
Sbjct:   238 GQPGGQGPPGPPGAPGQSGHPGGS 261


>gi|3425850 (U13220) forkhead protein FREAC-2 [Homo sapiens]
            Length = 444

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.2, P = 0.69
 Identities = 26/79 (32%), Positives = 38/79 (48%), Frame = +3

Query:   186 VAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQ 365
             ++PPP A     +   A+P  +  S +SS A C+ S+S  ++ AS PS AC+    G   
Sbjct:    28 MSPPPAA----AAAAAAAPETTSSSSSSSSASCASSSSSSNS-ASAPSAACKSAGGGGAG 82

Query:   366 ASPCGVSGASASLPAGSPP 422
             A   G   AS+ L     P
Sbjct:    83 AGSGGAKKASSGLRRPEKP 101


>sp|P20719|HXA5_HUMAN HOMEOBOX PROTEIN HOX-A5 (HOX-1C) >pir||WJHU1C homeotic
            protein Hox A5 - human >gi|387668 (M26679) HOX 1.3 [Homo sapiens]
            Length = 270

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.2, P = 0.70
 Identities = 33/107 (30%), Positives = 45/107 (42%), Frame = +3

Query:   237 SPSPSCCSCASSPAPCSGSASHHHA--TASHPSGACRGRRRGARQASPCGVSGASASLPA 410
             SP P    C S+ AP  GS +HH    + S+ SGA      G+   S     G ++    
Sbjct:    95 SPQPDPLPC-SAVAPSPGSDTHHGGKNSLSNSSGASADA--GSTHISSREGVGTASGAEE 151

Query:   411 GSPPSRTAPAARLSGTPAPPPCTQ-RPTRRCGGHTGRGAAASPHGPRGRS 557
              +P S    +A+   +PAPP   Q  P  R   H        P G R R+
Sbjct:   152 DAPASSEQASAQSEPSPAPPAQPQIYPWMR-KLHISHDNIGGPEGKRART 200


>gi|2384940 (AF022985) Similar to collagen; coded for by C. elegans cDNA
            yk55f3.3; coded for by C. elegans cDNA yk66d5.3; coded for by C.
            elegans cDNA yk71e4.3; coded for by C. elegans cDNA yk55f3.5; coded
            for by C. elegans cDNA yk66d5.5; coded for by C...
            Length = 319

  Plus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 1.2, P = 0.70
 Identities = 37/118 (31%), Positives = 47/118 (39%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             PP    P+G + +  +P+ S       P   +G A        HP       R G R   
Sbjct:   144 PPGAPGPKGNNGQPGAPAQSGGRGPPGPRGPAGDAGSP-GQPGHPGSPGNPGRGGQRSRG 202

Query:   372 PCGVSGASASL-PAGSP--PSRTAPAARLSGTPAPPPCTQRPTRRCG--GHTGR-GAAAS 533
               G SG      PAG+P  P R+  A    GTP P    Q P    G  GH+G  G   +
Sbjct:   203 TPGASGRPGPQGPAGAPGQPGRSGGA----GTPGP----QGPPGPSGQPGHSGNDGVPGT 254

Query:   534 PHGP 545
             P  P
Sbjct:   255 PGNP 258


>gi|1020231 (U31786) putative [Human papillomavirus type 37]
            Length = 207

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.2, P = 0.71
 Identities = 37/134 (27%), Positives = 47/134 (35%), Frame = +3

Query:   234 ASPSPSCCSCASS-PAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPA 410
             ++P P   S   S P PC     HHH        A +    G +        G     P 
Sbjct:    50 STPYPGRRSHGDSLPPPCPPENGHHHGDTEEKHLALQPPPPGKKDKEKTPQQGDQGPPPG 109

Query:   411 GS--PPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRK 584
             G+  PP     A      P P      PT    G    G    P+  +G S  P R GR 
Sbjct:   110 GNKQPPGEGTDADGDENAPTPETPPVPPTGEGEGEVEGGPRHDPN--QGPSHDPGR-GRD 166

Query:   585 ---LIPLMKVNLTWHWPS 629
                L+P + + LT  W S
Sbjct:   167 PEGLLPGVALRLT-QWES 183


>pir||CGBO1S collagen alpha 1(I) chain - bovine (fragments)
            Length = 779

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.2, Sum P(2) = 0.71
 Identities = 39/136 (28%), Positives = 47/136 (34%), Frame = +3

Query:   204 AWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACR-GRRRGARQASPCG 380
             A P G +     P P     A  P    GSA    AT   P  A R G    +  A P G
Sbjct:   400 AGPPGPAGPAGPPGPIGNVGAPGPKGARGSAGPPGATG-FPGAAGRVGPPGPSGNAGPPG 458

Query:   381 VSGASASLPAGSPPSRTAPAARLS--GTPAPP-PCTQRPTRRCGGHTGRGAAASPHG--- 542
               G +    +  P   T PA R    G P PP P  ++      G  G      P G   
Sbjct:   459 PPGPAGKEGSKGPRGETGPAGRPGEVGPPGPPGPAGEKGAPGADGPAGAPGTPGPQGIAG 518

Query:   543 PRGRSDRPSRNGRKLIP 593
              RG    P + G +  P
Sbjct:   519 QRGVVGLPGQRGERGFP 535

 Score = 84 (29.6 bits), Expect = 4.6, Sum P(2) = 0.99
 Identities = 39/131 (29%), Positives = 45/131 (34%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             P   A   G++     P P     A  PA   G A         P+G    R       S
Sbjct:   150 PKGAAGEPGKAGERGVPGPPG---AVGPAGKDGEAGAQGPPG--PAGPAGERGEQGPAGS 204

Query:   372 PCGVSGASASLPAGSPPSRTAPAARLSGTP----APPPCTQRPTRRCGGHTGRGAAASPH 539
             P G  G     PAG P     P  +  G P    AP P   R  R   G  G      P 
Sbjct:   205 P-GFQGLPG--PAGPPGEAGKPGEQ--GVPGDLGAPGPSGARGERGFPGERGVEGPPGPA 259

Query:   540 GPRGRSDRPSRNGRK 584
             GPRG +  P  +G K
Sbjct:   260 GPRGANGAPGNDGAK 274

 Score = 42 (14.8 bits), Expect = 1.2, Sum P(2) = 0.71
 Identities = 10/24 (41%), Positives = 12/24 (50%), Frame = +1

Query:   139 GSPWLSDDGHPGASNMLRPLPAPG 210
             G P   + G PGAS  + P   PG
Sbjct:    41 GPP--GEPGEPGASGPMGPRGPPG 62


>pir||S50755 hypothetical protein VSP-3 - Chlamydomonas reinhardtii >gi|530876
            (L29029) amino acid feature: Rod protein domain, aa 266 .. 468;
            amino acid feature: globular protein domain, aa 32 .. 265
            [Chlamydomonas reinhardtii]
            Length = 473

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 1.3, P = 0.72
 Identities = 31/97 (31%), Positives = 43/97 (44%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCAS-SPAPC-SGSASHHHATASHPSGACRGRRRGAR 362
             +P P A P       ASPSPS    AS SP+P  S S S   + +  PS + +   + + 
Sbjct:   290 SPSPKASPSPSPSPKASPSPSPSPKASPSPSPSPSPSPSPKASPSPSPSPSVQPASKPSP 349

Query:   363 QASPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPP 473
               SP        S P  SP    +P+   S +P+P P
Sbjct:   350 SPSPSPSPSPRPSPPLPSPSPSPSPSPSPSPSPSPKP 386


>sp|P16252|CAC2_HAECO CUTICLE COLLAGEN 2C >gi|159167 (J04670) collagen 2c
            [Haemonchus contortus]
            Length = 210

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.3, P = 0.72
 Identities = 34/121 (28%), Positives = 40/121 (33%), Frame = +3

Query:   240 PSPSCCSCASS-PAPCSG-SASHHHATASHPSGACRGRRRGAR-QASPCGVSGASASLPA 410
             P P C  C    P P           T  +P         G      P G  G + +  A
Sbjct:    52 PIPPCKPCPQGRPGPPGPIGPPGEPGTPGNPGAPGNDAPPGPPGPKGPPGPPGKAGAPGA 111

Query:   411 GSPPSRTAPAARL-SGTPAPPPCT--QRPTRRCG--GHTGRGAAASPHGPRGRSDRPSRN 575
                P   AP+  L  G P PP  T  + P    G  GH G   A    GPRG+   P   
Sbjct:   112 AGQPGANAPSEPLVPGPPGPPGPTGPEGPPGPNGAPGHPGAPGAPGEKGPRGQDGHPGAP 171

Query:   576 G 578
             G
Sbjct:   172 G 172


>sp|P11087|CA11_MOUSE PROCOLLAGEN ALPHA 1(I) CHAIN PRECURSOR >pir||S57243
            collagen alpha 1(I) chain precursor - mouse >gi|470674 (U08020)
            collagen pro-alpha-1 type I chain [Mus musculus]
            Length = 1453

  Plus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 1.3, P = 0.72
 Identities = 38/131 (29%), Positives = 53/131 (40%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRR--RGAR- 362
             PP  A   G      +  P   +  + P    G+          P GA RG    +G R 
Sbjct:   304 PPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAG--PQGA-RGSEGPQGVRG 360

Query:   363 QASPCGVSGASASLPAGSPPSRTAPAAR-LSGTPAPPPCTQRPTRRCGGHTGRGAAASPH 539
             +  P G +GA+   PAG+P +   P A+  +G P        P  R  G +G    + P 
Sbjct:   361 EPGPPGPAGAAG--PAGNPGADGQPGAKGANGAPGIAGAPGFPGAR--GPSGPQGPSGPP 416

Query:   540 GPRGRSDRPSRNGRK 584
             GP+G S  P   G K
Sbjct:   417 GPKGNSGEPGAPGNK 431

 Score = 89 (31.3 bits), Expect = 4.8, P = 0.99
 Identities = 40/131 (30%), Positives = 46/131 (35%), Frame = +3

Query:   192 PPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQAS 371
             P   A   G++     P P     A  PA   G A    A    P+G    R       S
Sbjct:   574 PKGTAGEPGKAGERGLPGPPG---AVGPAGKDGEAGAQGAPG--PAGPAGERGEQGPAGS 628

Query:   372 PCGVSGASASLPAGSPPSRTAPAARLSGTP----APPPCTQRPTRRCGGHTGRGAAASPH 539
             P G  G     PAG P     P  +  G P    AP P   R  R   G  G      P 
Sbjct:   629 P-GFQGLPG--PAGPPGEAGKPGEQ--GVPGDLGAPGPSGARGERGFPGERGVQGPPGPA 683

Query:   540 GPRGRSDRPSRNGRK 584
             GPRG +  P  +G K
Sbjct:   684 GPRGNNGAPGNDGAK 698


>gi|938175 (X65122) alpha1 (XIV) collagen [Gallus gallus]
           Length = 189

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.3, P = 0.72
 Identities = 22/61 (36%), Positives = 26/61 (42%), Frame = +3

Query:   378 GVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRS 557
             G  G     P G P S   P    +G+P PP  +  P R   GHTG   +  P GP G  
Sbjct:   131 GNPGVGTQGPRGPPGSTGPPGESRTGSPGPPG-SPGP-RGPAGHTGPPGSQGPAGPPGYC 188

Query:   558 D 560
             D
Sbjct:   189 D 189


>gi|1698773 (U70040) ICP0D [Human herpesvirus 1]
            Length = 90

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 1.4, P = 0.74
 Identities = 27/73 (36%), Positives = 33/73 (45%), Frame = -3

Query:   529 AAAPRPVCPPHRRVGRCVHGGGAGVPDSRAAGAVREGGEPAGKEAEA-PDTPHGDACRAP 353
             A+  RP   P R     + GG  G PDS A+G  RE  E  G  ++    T  G  CR P
Sbjct:     7 ASTRRPEGRPQREEPPAIFGGRRGTPDSGASGG-REKREEEGSGSKGRTQTTFG--CR-P 62

Query:   352 RRRPR-HAPEG---CDA 314
                P   A  G   C+A
Sbjct:    63 LSPPSSEASRGAGLCEA 79


>pir||JQ0405 hypothetical 119.5K protein (uvrA region) - Micrococcus luteus
            Length = 1106

  Plus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 1.4, Sum P(2) = 0.75
 Identities = 30/82 (36%), Positives = 32/82 (39%), Frame = +3

Query:   321 HPSGACRGRRRGARQASPCGVSGASA----SLPAGSPPSRTAPAARLSGTPAPPPCTQRP 488
             H     R RRRG     P G  G  A     LP   P  R A AA   G  A     +RP
Sbjct:   665 HRPSRGRVRRRGRALGLPGGSQGEHAVRHRRLPLRPPLHRGAGAASRPGEGARADGPRRP 724

Query:   489 TRRCGGHTGRGAAASPHGPRGR 554
               +  G  G G A  PHG  GR
Sbjct:   725 GEQPEGRLGPGPARGPHGRDGR 746

 Score = 85 (29.9 bits), Expect = 10., P = 1.0
 Identities = 39/111 (35%), Positives = 42/111 (37%), Frame = +3

Query:   240 PSPSCCSCASSP-APCSGSASHH---HATASHPSGACRGRRRGARQASPCGVSGASASLP 407
             P P+       P  P   +A  H       +HP G     R G R   P       A  P
Sbjct:   569 PGPAGVPAGRRPRVPQPRAAGRHPLRRRGPAHPPGHTDRLRAGRRPLRPRRAVHRPA--P 626

Query:   408 AGSPPSRTAPAARLSGTPAPPPCTQRPTRRCG--GHTGRGAAASPHGP-RGRSDRPSR 572
             AG PP    P A     PA P   Q P RR    GH  RG     H P RGR  R  R
Sbjct:   627 AGQPPPHRDPPA-----PAGP--RQHPHRRRARRGHDRRGGLDRGHRPSRGRVRRRGR 677

 Score = 46 (16.2 bits), Expect = 1.4, Sum P(2) = 0.75
 Identities = 16/40 (40%), Positives = 19/40 (47%), Frame = +1

Query:   130 ATCGSPWLSDDGHPGASNMLRPLPAPGLKAALSAGRRPRL 249
             A    P  +D G PGA       P P   A + AGRRPR+
Sbjct:   551 AAADGPGAADRG-PGAQGD----PGP---AGVPAGRRPRV 582

 Score = 39 (13.7 bits), Expect = 6.9, Sum P(2) = 1.0
 Identities = 9/17 (52%), Positives = 9/17 (52%), Frame = +1

Query:   193 PLPAPGLKAALSAGRRP 243
             P   PG    L AGRRP
Sbjct:   598 PAHPPGHTDRLRAGRRP 614


>pir||S41171 transrepressor protein BICP22 - bovine herpesvirus 1 >gi|438614
            (L27212) transrepressor protein [Bovine herpesvirus type 1]
            >gi|439627 (X76943) BICP22 [Bovine herpesvirus 1] >gnl|PID|e1187350
            (AJ004801) immediate-early and late transrepressor protein (cell
            nucleus) [Bovine herpesvirus 1] >gnl|PID|e1187359 (AJ004801)
            immediate-early and late transrepressor protein (cell nucleus)
            [Bovine herpesvirus 1]
            Length = 300

  Plus Strand HSPs:

 Score = 86 (30.3 bits), Expect = 1.4, P = 0.76
 Identities = 41/124 (33%), Positives = 51/124 (41%), Frame = +3

Query:   150 AQRRRPPRCI*HVAPPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATA---- 317
             A    PPRC    A    A P   +  + S SP+  S  SS +  S SAS          
Sbjct:   176 AAAESPPRCRPRAAVLSSASPAASAVSFVS-SPTASSSTSSSSLSSFSASDGDDDVFFPG 234

Query:   318 ---SHPSGACRGR-----RRGARQASPCGVSGASASLPAGSP-PSRT-APAARLSGTPAP 467
                  P+GA  G      R G R+ +PC    +S S P  SP PS   +P+ R    PAP
Sbjct:   235 PGDPRPAGAGPGAGGPPARAGRRRPAPCW-RWSSGSSPGSSPYPSPGGSPSGRARARPAP 293

Query:   468 PPCTQR 485
                 QR
Sbjct:   294 AKRRQR 299

 Score = 83 (29.2 bits), Expect = 3.2, P = 0.96
 Identities = 39/132 (29%), Positives = 52/132 (39%), Frame = +3

Query:   189 APPPCAWPEGRSKRWASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQA 368
             +PP C  P       ASP+ S  S  SSP   S ++S   ++ S   G            
Sbjct:   180 SPPRCR-PRAAVLSSASPAASAVSFVSSPTASSSTSSSSLSSFSASDGD----------- 227

Query:   369 SPCGVSGASASLPAGSPPSRTAPAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHG-P 545
                   G     PAG+ P    P AR +G   P PC +  +   G   G     SP G P
Sbjct:   228 DDVFFPGPGDPRPAGAGPGAGGPPAR-AGRRRPAPCWRWSS---GSSPGSSPYPSPGGSP 283

Query:   546 RGRSD-RPSRNGRK 584
              GR+  RP+   R+
Sbjct:   284 SGRARARPAPAKRR 297


>gi|725487 (U07008) merozoite surface antigen 2 [Plasmodium falciparum]
           Length = 198

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 1.4, P = 0.76
 Identities = 34/120 (28%), Positives = 43/120 (35%), Frame = +3

Query:   234 ASPSPSCCSCASSPAPCSGSASHHHATASHPSGACRGRRRGARQASPCGVSGASASLPAG 413
             A  S S     S+     GS S   +      G+  G   G+  A   G +G SA   AG
Sbjct:     6 AGGSGSAGGSGSAGGSAGGSGSAGGSAGGSAGGSAGGSAGGSGSAGGSGSAGGSAGGSAG 65

Query:   414 SPPSRTA-PAARLSGTPAPPPCTQRPTRRCGGHTGRGAAASPHGPRGRSDRPSRNGRKLI 590
             S     A P A   G+ + P  T   T      T   A AS       S+ P+ N  K  
Sbjct:    66 SGDGNGANPGADAEGSSSTPATTTTTTTTTTTTTTNDAEASTSTS---SENPNHNNAKTN 122

Query:   591 P 593
             P
Sbjct:   123 P 123


WARNING:  HSPs involving 158 database sequences were not reported due to the
          limiting value of parameter B = 250.


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.95
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.329   0.141   0.502  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.332   0.140   0.450  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.340   0.146   0.478  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.333   0.142   0.431  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.365   0.157   0.653  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.329   0.146   0.503  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      211       205       10.  74 3 1000 22  0.097   35
                                                     31  0.11    38
   +2      0      211       208       10.  74 3 1000 22  0.098   35
                                                     31  0.11    38
   +1      0      212       206       10.  74 3 1000 22  0.097   35
                                                     31  0.11    38
   -1      0      212       207       10.  74 3 1000 22  0.098   35
                                                     31  0.11    38
   -2      0      211       205       10.  74 3 1000 22  0.097   35
                                                     31  0.11    38
   -3      0      211       206       10.  74 3 1000 22  0.097   35
                                                     31  0.11    38


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  408
  No. of states in DFA:  378 (37 KB)
  Total size of DFA:  51 KB (64 KB)
  Time to generate neighborhood:  0.01u 0.00s 0.01t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  59.81u 1.19s 61.00t  Elapsed: 00:00:12
  Total cpu time:  60.18u 13.46s 73.64t  Elapsed: 00:00:25
  Start:  Thu Sep 24 11:30:27 1998   End:  Thu Sep 24 11:30:52 1998

WARNINGS ISSUED:  1

Date: 14:52:53 on Sun 17 Dec 117.