blastx_gbnr_files/CcruzaQ_1768_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CcruzaQ_1768
        (522 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gi|2995585           (AE001274) PPCTIB; cyclophilin B;... +3   467  1.3e-43   1
A sp|P24367|CYPB_CHICK PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   277  1.7e-23   1
A gi|939726            (U31370) cyclophilin [Arabidopsis... +3   274  3.6e-23   1
A sp|P14851|CYPH_CRILO PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   273  4.5e-23   1
A sp|P17742|CYPH_MOUSE PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   273  4.5e-23   1
A gi|992633            (U30874) cyclophilin B [Schistoso... +3   273  4.5e-23   1
A sp|P80311|CYPB_BOVIN PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   272  5.8e-23   1
A pir||S71220          cytosolic cyclophilin ROC2 - Arab... +3   272  5.8e-23   1
A sp|P05092|CYPH_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   270  9.4e-23   1
A sp|P04374|CYPH_BOVIN PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   270  9.4e-23   1
A prf||1503232A        peptidyl-Pro cis trans isomerase ... +3   270  9.4e-23   1
A pdb|3CYS|A           Cyclophilin A Complexed With Cycl... +3   270  9.4e-23   1
A pdb|5CYH|A           Homo sapiens >pdb|4CYH|A Homo sap... +3   270  9.4e-23   1
A pir||S71547          peptidylprolyl isomerase (EC 5.2.... +3   269  1.2e-22   1
A gi|3288923           (AF071225) cyclophilin B [Rattus ... +3   269  1.2e-22   1
A sp|P10111|CYPH_RAT   PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   268  1.5e-22   1
A gi|181250            (M60457) cyclophilin [Homo sapiens]  +3   267  2.0e-22   1
A gi|337999            (M63573) secreted cyclophilin-lik... +3   267  2.0e-22   1
A sp|P23284|CYPB_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   267  2.0e-22   1
A pdb|1CYN|A           Cyclophilin B Complexed With [d-(... +3   267  2.0e-22   1
A pir||S48017          peptidylprolyl isomerase (EC 5.2.... +3   265  3.2e-22   1
A gi|849081            (U17900) cyclophilin B precursor ... +3   265  3.2e-22   1
A gi|2443755           (AF020433) cyclophilin [Arabidops... +3   265  3.2e-22   1
A gi|3420055           (AC004680) cyclophilin [Arabidops... +3   265  3.2e-22   1
A gi|1490551           (U63545) natural killer tumor rec... +3   264  4.1e-22   1
A gi|1245400           (U50389) cyclophilin B [Schistoso... +3   263  5.2e-22   1
A sp|P21569|CYPH_MAIZE PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   262  6.7e-22   1
A sp|P24368|CYPB_RAT   PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   262  6.7e-22   1
A gi|2624966           (AF017993) cyclophilin [Entamoeba... +3   262  6.7e-22   1
A gnl|PID|d1024669     (AB002814) cyclophilin G [Tachypl... +3   260  1.1e-21   1
A gi|600769            (L29470) cyclophilin 2 [Oryza sat... +3   259  1.4e-21   1
A sp|P24369|CYPB_MOUSE PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   258  1.8e-21   1
A pir||A56861          peptidylprolyl isomerase (EC 5.2.... +3   258  1.8e-21   1
A gi|1480463           (U47813) cyclophilin Dicyp-2 [Dir... +3   257  2.3e-21   1
A bbs|178427           (S82440) cyclophilin [Hemicentrot... +3   255  3.7e-21   1
A pdb|1AWS|A           Chain A, Secypa Complexed With Ha... +3   255  3.7e-21   1
A sp|P15425|CYPR_DROME PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   251  9.7e-21   1
A sp|P23285|CYPB_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   251  9.7e-21   1
A sp|P52011|CYP3_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   251  9.7e-21   1
A gnl|PID|e32235       (X51497) cyclophilin-related prot... +3   251  9.7e-21   1
A gnl|PID|e267528      (Y08320) cyclophylin [Digitalis l... +3   251  9.7e-21   1
A sp|P52009|CYP1_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   250  1.2e-20   1
A gi|192867            (L04289) cyclophilin-related prot... +3   264  1.3e-20   1
A sp|P52016|CYP8_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   255  1.3e-20   1
A sp|P30415|NKCR_MOUSE NK-TUMOR RECOGNITION PROTEIN (NAT... +3   264  1.4e-20   1
A pir||B47328          natural killer cell tumor-recogni... +3   264  1.4e-20   1
A sp|P34887|CYPH_ALLCE PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   249  1.6e-20   1
A sp|P28517|CYPR_CALVI PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   249  1.6e-20   1
A sp|P30405|CYPM_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   248  2.0e-20   1
A gi|1209511           (U33869) cyclophilin [Plasmodium ... +3   248  2.0e-20   1
A sp|P29117|CYPM_RAT   PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   248  2.0e-20   1
A gi|1480465           (U47812) cyclophilin Ovcyp-2 [Onc... +3   247  2.6e-20   1
A gi|1480461           (U47811) cyclophilin Bmcyp-2 [Bru... +3   245  4.2e-20   1
A gnl|PID|e267365      (Y08273) cyclophilin [Digitalis l... +3   245  4.2e-20   1
A sp|P54985|CYPH_BLAGE PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   245  4.2e-20   1
A sp|P18253|CYPH_SCHPO PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   244  5.4e-20   1
A pir||S48018          peptidylprolyl isomerase (EC 5.2.... +3   242  8.8e-20   1
A pir||A53422          peptidylprolyl isomerase (EC 5.2.... +3   242  8.8e-20   1
A sp|Q09637|CYP9_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   242  8.8e-20   1
A gnl|PID|e284969      (Z48245) T27D1.1 [Caenorhabditis ... +3   242  8.8e-20   1
A sp|P30412|CYPC_MOUSE PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   241  1.1e-19   1
A pdb|2RMC|A           Mus musculus >pdb|2RMC|C Mus musc... +3   241  1.1e-19   1
A pir||S62327          cyclophilin-like protein wis2 - f... +3   241  1.1e-19   1
A sp|P45877|CYPC_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   240  1.4e-19   1
A gi|1045518           (U36797) cyclophilin-A [Hirudo me... +3   240  1.4e-19   1
A sp|P52014|CYP6_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   239  1.8e-19   1
A gi|2443757           (AF020434) cyclophilin [Arabidops... +3   239  1.8e-19   1
A sp|P30414|NKCR_HUMAN NK-TUMOR RECOGNITION PROTEIN (NAT... +3   253  1.9e-19   1
A sp|P52015|CYP7_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   238  2.3e-19   1
A sp|Q39613|CYPH_CATRO PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   238  2.3e-19   1
A pir||S71219          cytosolic cyclophilin ROC3 - Arab... +3   238  2.3e-19   1
A gnl|PID|d1018574     (D90909) peptidyl-prolyl cis-tran... +3   238  2.3e-19   1
A sp|P21568|CYPH_LYCES PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   237  3.0e-19   1
A pir||CSTO            peptidylprolyl isomerase (EC 5.2.... +3   237  3.0e-19   1
A gi|1532210           (U68268) cyclophilin A [Trypanoso... +3   237  3.0e-19   1
A pir||S66681          peptidylprolyl isomerase (EC 5.2.... +3   236  3.8e-19   1
A gi|2828149           (AF042385) cyclophilin-33A [Homo ... +3   236  3.8e-19   1
A sp|P26882|CYP4_BOVIN 40 KD PEPTIDYL-PROLYL CIS-TRANS I... +3   237  4.3e-19   1
A pir||JT0686          peptidylprolyl isomerase (EC 5.2.... +3   235  4.8e-19   1
A gnl|PID|e1226445     (Y16088) cytosolic form of cyclop... +3   235  4.8e-19   1
A sp|P34791|CYP4_ARATH PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   234  6.2e-19   1
A pir||S50141          peptidylprolyl isomerase (EC 5.2.... +3   233  7.9e-19   1
A sp|P34790|CYP1_ARATH PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   233  7.9e-19   1
A gi|348725            (L11668) cyclophilin-40 [Bos taurus] +3   232  1.0e-18   1
A gnl|PID|d1025140     (AB002414) cyclophilin-type pepti... +3   232  1.0e-18   1
A sp|P35176|CYPD_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   231  1.3e-18   1
A sp|P35627|CYP2_ARATH PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   231  1.3e-18   1
A sp|Q08752|CYP4_HUMAN 40 KD PEPTIDYL-PROLYL CIS-TRANS I... +3   232  1.7e-18   1
A gi|2708309           (AF016371) U-snRNP-associated cyc... +3   229  2.1e-18   1
A gi|167138            (M55018) cyclophilin [Brassica na... +3   227  3.4e-18   1
A pir||CSRP            peptidylprolyl isomerase (EC 5.2.... +3   227  3.4e-18   1
A sp|P24525|CYPH_BRANA PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   227  3.4e-18   1
A gnl|PID|e1188506     (Z92822) ZK520.5 [Caenorhabditis ... +3   226  4.3e-18   1
A gnl|PID|d1026688     (AB012947) GC-CyP [Vicia faba]       +3   224  7.1e-18   1
A gi|499693            (L32095) cyclophilin [Vicia faba]    +3   223  9.0e-18   1
A pdb|1A58|            Cyclophilin From Brugia Malayi Is... +3   223  9.0e-18   1
A sp|P10255|CYPH_NEUCR PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   222  1.2e-17   1
A gi|295927            (X17692) cyclophilin (cytosolic f... +3   222  1.2e-17   1
A sp|P52013|CYP5_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   221  1.5e-17   1
A gnl|PID|e1254653     (AL022023) cyclophilin - like pro... +3   221  1.5e-17   1
A gnl|PID|e1297816     (Z92784) F31C3.1 [Caenorhabditis ... +3   221  1.5e-17   1
A sp|P25007|CYPH_DROME PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   219  2.4e-17   1
A gi|160945            (M93420) cyclophilin [Schistosoma... +3   219  2.4e-17   1
A gi|1532212           (U68269) cyclophilin A [Trypanoso... +3   219  2.4e-17   1
A gi|2959712           (AF052206) cyclophilin 1 [Chlamyd... +3   219  2.4e-17   1
A pir||A53522          18.5k cyclophilin precursor - Tox... +3   218  3.1e-17   1
A gi|2828710           (AF043642) matrin cyclophilin [Ra... +3   228  3.5e-17   1
A sp|P14088|CYPH_ECHGR PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   217  3.9e-17   1
A gi|1117968           (U40763) CARS-Cyp [Homo sapiens] ... +3   227  4.6e-17   1
A sp|P22011|CYPH_CANAL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   216  5.0e-17   1
A pir||S54833          peptidylprolyl isomerase (EC 5.2.... +3   216  5.0e-17   1
A gi|972781            (L46884) cyclophilin [Schistosoma... +3   216  5.0e-17   1
A pir||S51497          peptidylprolyl isomerase (EC 5.2.... +3   216  5.0e-17   1
A pir||S71849          peptidylprolyl isomerase (EC 5.2.... +3   215  6.4e-17   1
A gi|642360            (Z48002) cyclophilin, cytosolic f... +3   215  6.4e-17   1
A gi|1532214           (U68270) cyclophilin A [Trypanoso... +3   214  8.1e-17   1
A gnl|PID|e316521      (Y13117) peptidylprolyl isomerase... +3   214  8.1e-17   1
A sp|P14832|CYPH_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   213  1.0e-16   1
A sp|P52010|CYP2_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   213  1.0e-16   1
A gi|2190533           (U30265) similar to Schistosoma j... +3   213  1.0e-16   1
A gi|2828151           (AF042386) cyclophilin-33B [Homo ... +3   213  1.0e-16   1
A gi|436957            (U04633) 18 kDa cyclophilin [Toxo... +3   212  1.3e-16   1
A prf||1713247A        cyclophilin [Dictyostelium discoi... +3   212  1.3e-16   1
A pir||B53522          20k cyclophilin - Toxoplasma gond... +3   214  1.4e-16   1
A sp|Q27450|CYP1_BRUMA PEPTIDYLPROLYL ISOMERASE CYP-1 (P... +3   223  1.5e-16   1
A sp|P53691|CYP6_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   215  1.5e-16   1
A gi|2655157           (AF025803) cyclophilin 1 [Drosoph... +3   211  1.7e-16   1
A gi|1245402           (U50388) cyclophilin A [Schistoso... +3   209  2.7e-16   1
A pir||S52760          peptidylprolyl isomerase (EC 5.2.... +3   208  3.5e-16   1
A gi|1000521           (U10322) cyclophilin [Plasmodium ... +3   208  3.5e-16   1
A sp|P48820|CYPR_BOVIN PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   208  3.5e-16   1
A sp|P52018|CYPB_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   208  3.5e-16   1
A gnl|PID|e280557      (Y09143) cyclophilin [Lumbricus r... +3   205  7.3e-16   1
A sp|Q06118|CYPH_STRCH PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   203  1.2e-15   1
A gi|2655159           (AF025804) cyclophilin 1 [Drosoph... +3   203  1.2e-15   1
A sp|P49792|N358_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP3... +3   219  2.1e-15   1
A pir||S58884          Ran-binding protein 2 - human >gn... +3   219  2.1e-15   1
A prf||2115390A        Ran/TC4-binding nucleopore protei... +3   219  2.1e-15   1
A gi|1928939           (U92087) stress responsive cyclop... +3   200  2.5e-15   1
A gi|2988417           (U97573) peptidyl-prolyl cis-tran... +3   198  4.0e-15   1
A gi|1764137           (U81792) PIG28 [Uromyces fabae]      +3   196  6.6e-15   1
A gi|1004090           (L41691) spliced variant with Ran... +3   208  8.5e-15   1
A pir||S52758          adenosine kinase (EC 2.7.1.20) - ... +3   195  2.5e-14   1
A gi|972047            (F14571) cyclophilin A [Sus scrofa]  +3   187  5.9e-14   1
A gi|1314810           (U55771) cyclophilin homolog Ta c... +3   187  5.9e-14   1
A gnl|PID|d1008136     (D38552) The ha1539 protein is re... +3   186  8.8e-13   1
A gi|1330343           (U58755) C34D4.12 gene product [C... +3   173  1.8e-12   1
A sp|P52017|CYPA_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   172  2.3e-12   1
A gi|3057040           (AF000668) cyclophilin Dicyp-3 [D... +3   177  5.8e-12   1
A sp|Q09928|YAL5_SCHPO PROBABLE PEPTIDYL-PROLYL CIS-TRAN... +3   176  6.0e-12   1
A sp|P87051|YDJ3_SCHPO PROBABLE PEPTIDYL-PROLYL CIS-TRAN... +3   168  6.1e-12   1
A sp|P47103|CYP7_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   136  1.9e-11   2
A gi|1515350           (U48868) Cpr7p [Saccharomyces cer... +3   136  1.9e-11   2
A gi|972055            (F14628) cyclophilin B [Sus scrofa]  +3   161  3.4e-11   1
A sp|P71578|CYPI_MYCTU PROBABLE PEPTIDYL-PROLYL CIS-TRAN... +3   156  1.1e-10   1
A gi|1199600           (U37220) cyclophilin-like protein... +3   158  1.4e-10   1
A gi|1199602           (U37221) cyclophilin-like protein... +3   158  2.0e-10   1
A pir||S64705          cyclophilin-like protein CyP-60 -... +3   158  6.4e-10   1
A sp|P52012|CYP4_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERA... +3   150  9.6e-10   1
A gi|1575509           (U64692) cyclophilin ScCypB [Stre... +3   145  1.7e-09   1
A gi|972057            (F14629) NK-tumor recognition pro... +3   142  3.5e-09   1
A gi|2981639           (U36187) cyclophilin isoform 4 [C... +3   150  4.7e-09   1
A gnl|PID|e236568      (X97255) cyclophilin [Digitalis l... +3   134  2.4e-08   1
A gi|2622445           (AE000897) peptidyl-prolyl cis-tr... +3   132  4.0e-08   1
A gnl|PID|e1263915     (AL022104) peptidyl-prolyl cis-tr... +3   132  3.4e-07   1
A gi|16994             (Z17785) peptidyl-prolyl cis-tran... +3   107  1.8e-05   1
A pir||CSRT31          protein P31 - rat >prf||1112143A ... +3   106  2.3e-05   1
A gnl|PID|e1245738     (AL021411) peptidylprolyl isomera... +3   111  2.5e-05   1
A gi|602789            (Z46935) F59E10.2 [Caenorhabditis... +3   113  5.5e-05   1
A gi|971608            (F14780) peptidyl-prolyl cis-tran... +3    91  0.0013    1
A gi|2327017           (U82823) putative peptidyl-prolyl... +3    92  0.031     1
A gnl|PID|e244458      (Z71698) ATPase subunit 6 [uniden... -3    55  0.14      2
A gi|1066992           (Z36949) F59E10.2 [Caenorhabditis... +3    91  0.27      1
A gi|1399828           (U59235) unknown [Synechococcus P... +3    89  0.43      1
A gi|1911396           (U75930) unknown [Orgyia pseudots... -1    66  0.62      1
A gnl|PID|e1301253     (AJ006854) gamma-glutamyltransfer... -1    63  0.88      1
A gnl|PID|d1010901     (D64001) hypothetical protein [Sy... +3    84  0.91      1
A gi|4517              (X02156) URF 2 [Saccharomyces cer... -3    62  0.93      1
A gi|2275210           (AC002337) peptidyl-prolyl cis-tr... +3    79  0.98      1
A gi|3414821           (AF064214) globulin-1 [Zea mays s... +2    76  0.99993   1
A gi|3414843           (AF064225) globulin-1 [Zea mays s... +2    76  0.99993   1



>gi|2995585 (AE001274) PPCTIB; cyclophilin B; L2759.1 [Leishmania major]
            Length = 335

  Plus Strand HSPs:

 Score = 467 (164.4 bits), Expect = 1.3e-43, P = 1.3e-43
 Identities = 77/120 (64%), Positives = 102/120 (85%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+G+TFFR L+ AWVMGGD++  H+GNGGYSCYGR FP+ +YA+PHDA G++GMCND   
Sbjct:   213 YKGTTFFRTLKDAWVMGGDVTGAHSGNGGYSCYGRCFPDETYAVPHDAAGILGMCNDGPH 272

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             T++S+FYIT++ MSWMNG+YVAFGRV+DGM+VV+AIH V+ +HNQ+P   I I+DC V+D
Sbjct:   273 TSSSAFYITLRPMSWMNGKYVAFGRVMDGMHVVDAIHAVEARHNQAPKASIVITDCDVLD 332


>sp|P24367|CYPB_CHICK PEPTIDYL-PROLYL CIS-TRANS ISOMERASE B PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN B) (S-CYCLOPHILIN) (SCYLP) >pir||A40516
            peptidylprolyl isomerase (EC 5.2.1.8) (S-cyclophilin) precursor -
            chicken >gi|212649 (M63553) S-cyclophilin [Gallus gallus]
            Length = 207

  Plus Strand HSPs:

 Score = 277 (97.5 bits), Expect = 1.7e-23, P = 1.7e-23
 Identities = 46/121 (38%), Positives = 77/121 (63%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++GS F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    79 FKGSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAGKD 137

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    +W++G++V FG+V++GM+VV  + +        P K++TI+DCG I+
Sbjct:   138 TNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVTIADCGTIE 197

Query:   369 L 371
             +
Sbjct:   198 V 198


>gi|939726 (U31370) cyclophilin [Arabidopsis thaliana]
           Length = 176

  Plus Strand HSPs:

 Score = 274 (96.5 bits), Expect = 3.6e-23, P = 3.6e-23
 Identities = 50/119 (42%), Positives = 74/119 (62%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F RI+ G    GGD +R  NG GG S YG  F + ++ + H  PG++ M N  
Sbjct:    53 LHYKGSAFHRIIPGFMCQGGDFTRG-NGTGGESIYGSKFEDENFKLKHTGPGILSMANSG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I  +  SW++G++V FG+V+DG NVV+A+ DV   +  +P + + I DCG
Sbjct:   112 PNTNGSQFFICTEKTSWLDGKHVVFGKVVDGYNVVKAMEDVG-SYMGNPSERVVIEDCG 169


>sp|P14851|CYPH_CRILO PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (PPIASE) (ROTAMASE)
            (CYCLOPHILIN A) (CYCLOSPORIN A-BINDING PROTEIN) >pir||CSHYAC
            peptidylprolyl isomerase (EC 5.2.1.8) A - Chinese hamster >gi|49496
            (X17105) cyclophilin (AA 1-164) [Cricetulus longicaudatus]
            Length = 164

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 4.5e-23, P = 4.5e-23
 Identities = 50/117 (42%), Positives = 75/117 (64%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSSFHRIIPGFMCQGGDFTR-HNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I      W++G++V FG+V +GMN+VEA+     ++ ++  K+ITISDCG
Sbjct:   107 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTS-KKITISDCG 162


>sp|P17742|CYPH_MOUSE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (PPIASE) (ROTAMASE)
            (CYCLOPHILIN A) (CYCLOSPORIN A-BINDING PROTEIN) (SP18) >pir||CSMSA
            peptidylprolyl isomerase (EC 5.2.1.8) A - mouse >gi|50621 (X52803)
            cyclophilin (AA 1 - 164) [Mus musculus]
            Length = 164

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 4.5e-23, P = 4.5e-23
 Identities = 50/117 (42%), Positives = 75/117 (64%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSSFHRIIPGFMCQGGDFTR-HNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I      W++G++V FG+V +GMN+VEA+     ++ ++  K+ITISDCG
Sbjct:   107 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTS-KKITISDCG 162


>gi|992633 (U30874) cyclophilin B [Schistosoma mansoni] >prf||2208425A B-like
           cyclophilin [Schistosoma mansoni]
           Length = 213

  Plus Strand HSPs:

 Score = 273 (96.1 bits), Expect = 4.5e-23, P = 4.5e-23
 Identities = 48/120 (40%), Positives = 73/120 (60%), Frame = +3

Query:     6 TYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNE 185
             +Y+GSTF R+++   + GGD + +H+G GG+S YG  FP+ ++ + H   G + M N   
Sbjct:    80 SYKGSTFHRVIKSFMIQGGDFT-NHDGTGGFSIYGDRFPDENFKLRHVGAGWLSMANAGP 138

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             DTN S F+IT    SW++G++V FG+V++GMN+V  I          P K I I+ CG I
Sbjct:   139 DTNGSQFFITTVKTSWLDGKHVVFGKVVEGMNIVRQIESETTDSRDRPVKSIKIASCGHI 198


>sp|P80311|CYPB_BOVIN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE B PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN B) (S-CYCLOPHILIN) (SCYLP)
            >gnl|PID|d1003665 (D14073) cyclophilin B [Bos taurus]
            Length = 208

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 5.8e-23, P = 5.8e-23
 Identities = 46/121 (38%), Positives = 75/121 (61%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    80 YKDSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 138

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    +W++G++V FG+V++GM+VV  +          P K++TI+DCG I+
Sbjct:   139 TNGSQFFITTVKTAWLDGKHVGFGKVLEGMDVVRKVESTKTDGRDKPLKDVTIADCGKIE 198

Query:   369 L 371
             +
Sbjct:   199 V 199


>pir||S71220 cytosolic cyclophilin ROC2 - Arabidopsis thaliana >gi|1305457
            (U40400) cytosolic cyclophilin [Arabidopsis thaliana]
            Length = 176

  Plus Strand HSPs:

 Score = 272 (95.7 bits), Expect = 5.8e-23, P = 5.8e-23
 Identities = 50/122 (40%), Positives = 75/122 (61%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F RI+ G    GGD +R  NG GG S YG  F + ++ + H  PG++ M N  
Sbjct:    53 LHYKGSAFHRIIPGFMCQGGDFTRG-NGTGGESIYGSKFEDENFKLKHTGPGILSMANSG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F+I  +  SW++G++V FG+V+DG NVV+A+ DV      +P + + I DCG 
Sbjct:   112 PNTNGSQFFICTEKTSWLDGKHVVFGKVVDGYNVVKAMEDVGSDMG-NPSERVVIEDCGE 170

Query:   363 ID 368
             ++
Sbjct:   171 LN 172


>sp|P05092|CYPH_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (PPIASE) (ROTAMASE)
            (CYCLOPHILIN A) (CYCLOSPORIN A-BINDING PROTEIN) >pir||CSHUA
            peptidylprolyl isomerase (EC 5.2.1.8) A - human >pdb|2CPL|
            Cyclophilin A >pdb|2RMA|A Homo sapiens >pdb|2RMA|C Homo sapiens
            >pdb|2RMA|E Homo sapiens >pdb|2RMA|G Homo sapiens >pdb|2RMA|I Homo
            sapiens >pdb|2RMA|K Homo sapiens >pdb|2RMA|M Homo sapiens
            >pdb|2RMA|O Homo sapiens >pdb|2RMA|Q Homo sapiens >pdb|2RMA|S Homo
            sapiens >pdb|2RMB|A Homo sapiens >pdb|2RMB|C Homo sapiens
            >pdb|2RMB|E Homo sapiens >pdb|2RMB|G Homo sapiens >pdb|2RMB|I Homo
            sapiens >pdb|2RMB|K Homo sapiens >pdb|2RMB|M Homo sapiens
            >pdb|2RMB|O Homo sapiens >pdb|2RMB|Q Homo sapiens >pdb|2RMB|S Homo
            sapiens >pdb|1CWC|A Mol_id: 1; Molecule: Cyclophilin A; Chain: A;
            Engineered: Yes; Mol_id: 2; Molecule:
            [4,N-Dimethylnorleucine]4-Cyclosporin; Chain: C; Engineered: Yes
            >pdb|1CWB|A Mol_id: 1; Molecule: Cyclophilin A; Chain: A;
            Engineered: Yes; Mol_id: 2; Molecule:
            [4-[(E)-2-Butenyl]-4,4,N-Trimethyl-L-Threonine]1- Cyclosporin;
            Chain: C; Engineered: Yes >pdb|1CWA|A Mol_id: 1; Molecule:
            Cyclophilin A; Chain: A; Engineered: Yes; Mol_id: 2; Molecule:
            Cyclosporin A; Chain: C; Engineered: Yes >pdb|1MIK|A Mol_id: 1;
            Molecule: Cyclophilin A; Chain: A; Engineered: Yes; Mol_id: 2;
            Molecule: [(5-Hydroxy)norvaline2]-Cyclosporin; Chain: B;
            Engineered: Yes >pdb|1FGL|A Homo sapiens >pdb|1AK4|A Chain A, Human
            Cyclophilin A Bound To The Amino-Terminal Domain Of Hiv-1 Capsid
            Capsid, Hiv-1, Cyclophilin A, Isomerase, Rotamase Complex (Capsid
            ProteinCYCLOSPORIN) Mol_id: 1; Molecule: Cyclophilin A; Chain: A,
            B; Ec: 5.2.1.8; En... >pdb|1AK4|B Chain B, Human Cyclophilin A
            Bound To The Amino-Terminal Domain Of Hiv-1 Capsid Capsid, Hiv-1,
            Cyclophilin A, Isomerase, Rotamase Complex (Capsid
            ProteinCYCLOSPORIN) Mol_id: 1; Molecule: Cyclophilin A; Chain: A,
            B; Ec: 5.2.1.8; En... >pdb|1OCA|  Human Cyclophilin A, Unligated,
            Nmr, 20 Structures Isomerase, Peptidyl-Prolyl Cis-Trans Isomerase
            Mol_id: 1; Molecule: Cyclophilin A; Chain: Null; Ec: 5.2.1.8;
            Engineered: Yes >pdb|1CWF|A Chain A, Human Cyclophilin A Complexed
            With 2-Val Cyclosporin Complex (IsomeraseIMMUNOSUPPRESSANT) Mol_id:
            1; Molecule: Cyclophilin A; Chain: A; Ec: 5.2.1.8; Engineered: Yes;
            Mol_id: 2; Molecule: Cyclosporin A; Chain: C; Engineere...
            >pdb|1CWH|A Chain A, Human Cyclophilin A Complexed With 3-D-Ser
            Cyclosporin Complex (IsomeraseIMMUNOSUPPRESSANT) Mol_id: 1;
            Molecule: Cyclophilin A; Chain: A; Ec: 5.2.1.8; Engineered: Yes;
            Mol_id: 2; Molecule: Cyclosporin A; Chain: C; Enginee...
            >pdb|1CWK|A Chain A, Human Cyclophilin A Complexed With
            1-(6,7-Dihydro)mebmt 2-Val 3-D-(2-S-Methyl)sarcosine Cyclosporin
            Complex (IsomeraseIMMUNOSUPPRESSANT) Mol_id: 1; Molecule:
            Cyclophilin A; Chain: A; Ec: 5.2.1.8; Engineered: Yes; Mol_id: ...
            >pdb|1CWL|A Chain A, Human Cyclophilin A Complexed With 4
            4-Hydroxy-Meleu Cyclosporin Complex (IsomeraseIMMUNOSUPPRESSANT)
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A; Ec: 5.2.1.8;
            Engineered: Yes; Mol_id: 2; Molecule: Cyclosporin A; Chain: ...
            >pdb|1CWM|A Chain A, Human Cyclophilin A Complexed With 4 Meile
            Cyclosporin Complex (IsomeraseIMMUNOSUPPRESSANT) Mol_id: 1;
            Molecule: Cyclophilin A; Chain: A; Ec: 5.2.1.8; Engineered: Yes;
            Mol_id: 2; Molecule: Cyclosporin A; Chain: C; Enginee... >gi|30168
            (X52851) peptidylprolyl isomerase [Homo sapiens] >gi|30309 (Y00052)
            cyclophilin (AA 1-165) [Homo sapiens] >gi|2565299 (AF023859)
            cyclophilin A [Papio hamadryas] >gi|2565301 (AF023860) cyclophilin
            A [Cercopithecus aethiops] >gi|2565303 (AF023861) cyclophilin A
            [Macaca mulatta]
            Length = 165

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 9.4e-23, P = 9.4e-23
 Identities = 49/120 (40%), Positives = 76/120 (63%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSCFHRIIPGFMCQGGDFTR-HNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+I      W++G++V FG+V +GMN+VEA+     ++ ++  K+ITI+DCG ++
Sbjct:   107 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTS-KKITIADCGQLE 165


>sp|P04374|CYPH_BOVIN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (PPIASE) (ROTAMASE)
            (CYCLOPHILIN A) (CYCLOSPORIN A-BINDING PROTEIN) >pir||CSBOAB
            peptidylprolyl isomerase (EC 5.2.1.8) A - bovine >pir||CSPGA
            peptidylprolyl isomerase (EC 5.2.1.8) A - pig
            Length = 163

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 9.4e-23, P = 9.4e-23
 Identities = 50/119 (42%), Positives = 75/119 (63%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    47 YKGSCFHRIIPGFMCQGGDFTR-HNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPN 105

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+I      W++G++V FG+V +GMN+VEA+     ++ ++  K+ITI+DCG I
Sbjct:   106 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTS-KKITIADCGQI 163


>prf||1503232A peptidyl-Pro cis trans isomerase [Sus scrofa domestica]
            Length = 164

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 9.4e-23, P = 9.4e-23
 Identities = 50/119 (42%), Positives = 75/119 (63%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSCFHRIIPGFMCQGGDFTR-HNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+I      W++G++V FG+V +GMN+VEA+     ++ ++  K+ITI+DCG I
Sbjct:   107 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTS-KKITIADCGQI 164


>pdb|3CYS|A Cyclophilin A Complexed With Cyclosporin A (Nmr, 22 Structures)
            Length = 165

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 9.4e-23, P = 9.4e-23
 Identities = 49/120 (40%), Positives = 76/120 (63%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSCFHRIIPGFMCQGGDFTR-HNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+I      W++G++V FG+V +GMN+VEA+     ++ ++  K+ITI+DCG ++
Sbjct:   107 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTS-KKITIADCGQLE 165


>pdb|5CYH|A Homo sapiens >pdb|4CYH|A Homo sapiens >pdb|3CYH|A Homo sapiens
            >pdb|2CYH|A Homo sapiens >pdb|1RMH|A Homo sapiens >pdb|1RMH|B Homo
            sapiens >pdb|1AWQ|A Chain A, Cypa Complexed With Hagpia
            (Pseudo-Symmetric Monomer) Complex (IsomerasePEPTIDE), CYCLOPHILIN
            A, HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin
            A; Chain: A; Ec: 5.2.1.8; Engineered: Yes; Biological_unit: M...
            >pdb|1AWR|A Chain A, Cypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C, D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Biological_unit: Monomer; Mol_...
            >pdb|1AWR|B Chain B, Cypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C, D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Biological_unit: Monomer; Mol_...
            >pdb|1AWR|C Chain C, Cypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C, D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Biological_unit: Monomer; Mol_...
            >pdb|1AWR|D Chain D, Cypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C, D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Biological_unit: Monomer; Mol_...
            >pdb|1AWR|E Chain E, Cypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C, D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Biological_unit: Monomer; Mol_...
            >pdb|1AWR|F Chain F, Cypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C, D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Biological_unit: Monomer; Mol_...
            >pdb|1AWU|A Chain A, Cypa Complexed With Hvgpia (Pseudo-Symmetric
            Monomer) Complex (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid,
            Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A; Chain: A; Ec:
            5.2.1.8; Engineered: Yes; Biological_unit: M... >pdb|1AWV|A Chain
            A, Cypa Complexed With Hvgpia Complex (IsomerasePEPTIDE),
            CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule:
            Cyclophilin A; Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered:
            Yes; Biological_unit: Monomer; Mol_... >pdb|1AWV|B Chain B, Cypa
            Complexed With Hvgpia Complex (IsomerasePEPTIDE), CYCLOPHILIN A,
            HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A;
            Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered: Yes;
            Biological_unit: Monomer; Mol_... >pdb|1AWV|C Chain C, Cypa
            Complexed With Hvgpia Complex (IsomerasePEPTIDE), CYCLOPHILIN A,
            HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A;
            Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered: Yes;
            Biological_unit: Monomer; Mol_... >pdb|1AWV|D Chain D, Cypa
            Complexed With Hvgpia Complex (IsomerasePEPTIDE), CYCLOPHILIN A,
            HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A;
            Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered: Yes;
            Biological_unit: Monomer; Mol_... >pdb|1AWV|E Chain E, Cypa
            Complexed With Hvgpia Complex (IsomerasePEPTIDE), CYCLOPHILIN A,
            HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A;
            Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered: Yes;
            Biological_unit: Monomer; Mol_... >pdb|1AWV|F Chain F, Cypa
            Complexed With Hvgpia Complex (IsomerasePEPTIDE), CYCLOPHILIN A,
            HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A;
            Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered: Yes;
            Biological_unit: Monomer; Mol_...
            Length = 164

  Plus Strand HSPs:

 Score = 270 (95.0 bits), Expect = 9.4e-23, P = 9.4e-23
 Identities = 49/120 (40%), Positives = 76/120 (63%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    47 YKGSCFHRIIPGFMCQGGDFTR-HNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPN 105

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+I      W++G++V FG+V +GMN+VEA+     ++ ++  K+ITI+DCG ++
Sbjct:   106 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTS-KKITIADCGQLE 164


>pir||S71547 peptidylprolyl isomerase (EC 5.2.1.8), isoform 20.3K - rat
            Length = 183

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.2e-22, P = 1.2e-22
 Identities = 46/121 (38%), Positives = 74/121 (61%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    55 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 113

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    SW++G++V FG+V++GM+VV  + +        P K++ I DCG I+
Sbjct:   114 TNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIE 173

Query:   369 L 371
             +
Sbjct:   174 V 174


>gi|3288923 (AF071225) cyclophilin B [Rattus norvegicus]
            Length = 208

  Plus Strand HSPs:

 Score = 269 (94.7 bits), Expect = 1.2e-22, P = 1.2e-22
 Identities = 46/121 (38%), Positives = 74/121 (61%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    80 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 138

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    SW++G++V FG+V++GM+VV  + +        P K++ I DCG I+
Sbjct:   139 TNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIE 198

Query:   369 L 371
             +
Sbjct:   199 V 199


>sp|P10111|CYPH_RAT PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (PPIASE) (ROTAMASE)
            (CYCLOPHILIN A) (CYCLOSPORIN A-BINDING PROTEIN) (P31) >pir||CSRTA
            peptidylprolyl isomerase (EC 5.2.1.8) A - rat >gi|203702 (M19533)
            cyclophilin [Rattus norvegicus] >gi|951425 (M25637) housekeeping
            protein [Rattus norvegicus]
            Length = 164

  Plus Strand HSPs:

 Score = 268 (94.3 bits), Expect = 1.5e-22, P = 1.5e-22
 Identities = 49/117 (41%), Positives = 75/117 (64%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSSFHRIIPGFMCQGGDFTR-HNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I      W++G++V FG+V +GM++VEA+     ++ ++  K+ITISDCG
Sbjct:   107 TNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTS-KKITISDCG 162


>gi|181250 (M60457) cyclophilin [Homo sapiens]
           Length = 207

  Plus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.0e-22, P = 2.0e-22
 Identities = 45/121 (37%), Positives = 73/121 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    79 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 137

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    +W++G++V FG+V++GM VV  +          P K++ I+DCG I+
Sbjct:   138 TNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIE 197

Query:   369 L 371
             +
Sbjct:   198 V 198


>gi|337999 (M63573) secreted cyclophilin-like protein [Homo sapiens]
           Length = 216

  Plus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.0e-22, P = 2.0e-22
 Identities = 45/121 (37%), Positives = 73/121 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    88 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 146

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    +W++G++V FG+V++GM VV  +          P K++ I+DCG I+
Sbjct:   147 TNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIE 206

Query:   369 L 371
             +
Sbjct:   207 V 207


>sp|P23284|CYPB_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE B PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN B) (S-CYCLOPHILIN) (SCYLP) (CYP-S1)
            >pir||CSHUB peptidylprolyl isomerase (EC 5.2.1.8) B precursor -
            human >gi|181335 (M60857) cyclophilin B [Homo sapiens]
            Length = 208

  Plus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.0e-22, P = 2.0e-22
 Identities = 45/121 (37%), Positives = 73/121 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    80 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 138

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    +W++G++V FG+V++GM VV  +          P K++ I+DCG I+
Sbjct:   139 TNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIE 198

Query:   369 L 371
             +
Sbjct:   199 V 199


>pdb|1CYN|A Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin
            Cyclosporin, Isomerase, Rotamase, Signal Mol_id: 1; Molecule:
            Cyclophilin B; Chain: A; Engineered: Yes; Mol_id: 2; Molecule:
            [d-(Cholinyl)ala]8-Cyclosporin; Chain: C...
            Length = 178

  Plus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.0e-22, P = 2.0e-22
 Identities = 45/121 (37%), Positives = 73/121 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    50 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 108

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    +W++G++V FG+V++GM VV  +          P K++ I+DCG I+
Sbjct:   109 TNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIE 168

Query:   369 L 371
             +
Sbjct:   169 V 169


>pir||S48017 peptidylprolyl isomerase (EC 5.2.1.8) Cyp2 - rice >gi|600767
            (L29469) cyclophilin 2 [Oryza sativa]
            Length = 172

  Plus Strand HSPs:

 Score = 265 (93.3 bits), Expect = 3.2e-22, P = 3.2e-22
 Identities = 51/119 (42%), Positives = 73/119 (61%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R++      GGD +R  NG GG S YG  F +  +   HD+PG++ M N  
Sbjct:    53 LHYKGSTFHRVIPEFMCQGGDFTRG-NGTGGESIYGEKFADEVFKFKHDSPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I     SW++G++V FGRV++GM+VV+AI  V  +   S  K + I+DCG
Sbjct:   112 PNTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGG-STAKPVVIADCG 169


>gi|849081 (U17900) cyclophilin B precursor [Orpinomyces sp.]
           Length = 203

  Plus Strand HSPs:

 Score = 265 (93.3 bits), Expect = 3.2e-22, P = 3.2e-22
 Identities = 47/124 (37%), Positives = 74/124 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  F + ++ + H  PG++ M N   D
Sbjct:    74 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFADENFKLRHTGPGILSMANAGRD 132

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    SW++GR+V FG+VI+GM+VV AI          P   + I+DCG + 
Sbjct:   133 TNGSQFFITTVTTSWLDGRHVVFGKVIEGMDVVTAIETTKTLPGDRPATPVIIADCGELP 192

Query:   369 LTDD 380
             ++++
Sbjct:   193 VSNN 196


>gi|2443755 (AF020433) cyclophilin [Arabidopsis thaliana]
            Length = 201

  Plus Strand HSPs:

 Score = 265 (93.3 bits), Expect = 3.2e-22, P = 3.2e-22
 Identities = 51/123 (41%), Positives = 76/123 (61%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F RI+    + GGD +   NG GG S YG+ F + ++ + H  PGV+ M N  
Sbjct:    81 LHYKGSKFHRIIPSFMIQGGDFTHG-NGMGGESIYGQKFADENFKLKHTGPGVLSMANSG 139

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             EDTN S F+IT    SW++GR+V FG+V+ GM+VV  I + + K + +P  ++ I+D G 
Sbjct:   140 EDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKI-EAEGKQSGTPKSKVVIADSGE 198

Query:   363 IDL 371
             + L
Sbjct:   199 LPL 201


>gi|3420055 (AC004680) cyclophilin [Arabidopsis thaliana]
            Length = 201

  Plus Strand HSPs:

 Score = 265 (93.3 bits), Expect = 3.2e-22, P = 3.2e-22
 Identities = 51/123 (41%), Positives = 76/123 (61%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F RI+    + GGD +   NG GG S YG+ F + ++ + H  PGV+ M N  
Sbjct:    81 LHYKGSKFHRIIPSFMIQGGDFTHG-NGMGGESIYGQKFADENFKLKHTGPGVLSMANSG 139

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             EDTN S F+IT    SW++GR+V FG+V+ GM+VV  I + + K + +P  ++ I+D G 
Sbjct:   140 EDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKI-EAEGKQSGTPKSKVVIADSGE 198

Query:   363 IDL 371
             + L
Sbjct:   199 LPL 201


>gi|1490551 (U63545) natural killer tumor recognition protein [Mus musculus]
            Length = 258

  Plus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 4.1e-22, P = 4.1e-22
 Identities = 52/135 (38%), Positives = 80/135 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R+++   + GGD S + NG GG S YG YF + ++ + HD   ++ M N  
Sbjct:    57 LCYKGSTFHRVVKNFMIQGGDFS-EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRG 115

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             + TN S F+IT K    ++G +V FG VI G  V+E I ++       P  ++ + DCGV
Sbjct:   116 KHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 175

Query:   363 I--DLTDD*YEKRRER 404
             +   LT D +EK+R++
Sbjct:   176 LATKLTKDVFEKKRKK 191


>gi|1245400 (U50389) cyclophilin B [Schistosoma japonicum]
            Length = 213

  Plus Strand HSPs:

 Score = 263 (92.6 bits), Expect = 5.2e-22, P = 5.2e-22
 Identities = 44/119 (36%), Positives = 74/119 (62%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GSTF R+++   + GGD + +H+G GG+S YG  FP+ ++ + H   G + M N   +
Sbjct:    81 YKGSTFHRVIKSFMIQGGDFT-NHDGTGGFSIYGERFPDENFKLKHVGAGWLSMANAGPN 139

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN + F+IT     W++G++V FG+V++GM+VV  I ++       P K + I++CG I
Sbjct:   140 TNGAQFFITTTQNPWLDGKHVVFGKVVEGMSVVRQIENMQTDSRDRPVKSVKIANCGHI 198


>sp|P21569|CYPH_MAIZE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >pir||CSZM
            peptidylprolyl isomerase (EC 5.2.1.8) - maize >gi|168461 (M55021)
            cyclophilin [Zea mays] >gi|829148 (X68678) cyclophilin [Zea mays]
            Length = 172

  Plus Strand HSPs:

 Score = 262 (92.2 bits), Expect = 6.7e-22, P = 6.7e-22
 Identities = 51/119 (42%), Positives = 73/119 (61%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R++      GGD +R  NG GG S YG  FP+  +     APGV+ M N  
Sbjct:    53 LHYKGSTFHRVIPEFMCQGGDFTRG-NGTGGESIYGEKFPDEKFVRKQPAPGVLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I   A  W++G++V FG+V++GM+VV+AI  V  + N S  K + ++DCG
Sbjct:   112 PNTNGSQFFICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTR-NGSTSKVVKVADCG 169


>sp|P24368|CYPB_RAT PEPTIDYL-PROLYL CIS-TRANS ISOMERASE B PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN B) (S-CYCLOPHILIN) (SCYLP) (CYP-S1)
            Length = 208

  Plus Strand HSPs:

 Score = 262 (92.2 bits), Expect = 6.7e-22, P = 6.7e-22
 Identities = 45/121 (37%), Positives = 73/121 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F  +++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    80 YKNSKFHHMIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 138

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    SW++G++V FG+V++GM+VV  + +        P K++ I DCG I+
Sbjct:   139 TNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIE 198

Query:   369 L 371
             +
Sbjct:   199 V 199


>gi|2624966 (AF017993) cyclophilin [Entamoeba histolytica]
            Length = 167

  Plus Strand HSPs:

 Score = 262 (92.2 bits), Expect = 6.7e-22, P = 6.7e-22
 Identities = 46/119 (38%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             LTY+G  F R+++   + GGD +R HNG GG S YG  F + ++ + H  PG++ M N  
Sbjct:    48 LTYKGCGFHRVIKDFMIQGGDFTR-HNGTGGKSIYGTKFADEAFTVKHTKPGMLSMANAG 106

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+IT     W++G++V FG+V++G +VV+ I +        P K + I+DCG
Sbjct:   107 PNTNGSQFFITTVPCPWLDGKHVVFGQVVEGYDVVKMIENNPTGAQDKPKKAVVIADCG 165


>gnl|PID|d1024669 (AB002814) cyclophilin G [Tachypleus tridentatus]
            Length = 220

  Plus Strand HSPs:

 Score = 260 (91.5 bits), Expect = 1.1e-21, P = 1.1e-21
 Identities = 47/119 (39%), Positives = 70/119 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+    + GGD ++  +G GG S YG  FP+ ++ + H   G + M N  +D
Sbjct:    88 YKGSIFHRIINDFMIQGGDFTKG-DGTGGRSIYGERFPDENFKLKHYGAGWLSMANAGKD 146

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT K  SW++G++V FG+V+ GM+VV  I          P K++ I+D G I
Sbjct:   147 TNGSQFFITCKKTSWLDGKHVVFGKVVKGMSVVRKIESTKTDSRDKPVKDVVIADSGTI 205


>gi|600769 (L29470) cyclophilin 2 [Oryza sativa]
           Length = 172

  Plus Strand HSPs:

 Score = 259 (91.2 bits), Expect = 1.4e-21, P = 1.4e-21
 Identities = 50/119 (42%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R++      GGD +R  NG GG S YG  F +  +   HD+PG++   N  
Sbjct:    53 LHYKGSTFHRVIPEFMCQGGDFTRG-NGTGGESIYGEKFADEVFKFKHDSPGILSTANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I     SW++G++V FGRV++GM+VV+AI  V  +   S  K + I+DCG
Sbjct:   112 PNTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGG-STAKPVVIADCG 169


>sp|P24369|CYPB_MOUSE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE B PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN B) (S-CYCLOPHILIN) (SCYLP) (CYP-S1)
            >gi|53035 (X58990) cyclophilin CyP-S1 [Mus musculus] >gi|192865
            (M60456) cyclophilin [Mus musculus]
            Length = 208

  Plus Strand HSPs:

 Score = 258 (90.8 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 45/121 (37%), Positives = 72/121 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    80 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 138

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    SW++G++V FG+V++GM+VV  +          P K++ I D G I+
Sbjct:   139 TNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIVDSGKIE 198

Query:   369 L 371
             +
Sbjct:   199 V 199


>pir||A56861 peptidylprolyl isomerase (EC 5.2.1.8) CyP-S1 precursor - mouse
            Length = 216

  Plus Strand HSPs:

 Score = 258 (90.8 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 45/121 (37%), Positives = 72/121 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R+++   + GGD +R  +G GG S YG  FP+ ++ + H  PG + M N  +D
Sbjct:    88 YKNSKFHRVIKDFMIQGGDFTRG-DGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD 146

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT    SW++G++V FG+V++GM+VV  +          P K++ I D G I+
Sbjct:   147 TNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIVDSGKIE 206

Query:   369 L 371
             +
Sbjct:   207 V 207


>gi|1480463 (U47813) cyclophilin Dicyp-2 [Dirofilaria immitis]
            Length = 171

  Plus Strand HSPs:

 Score = 257 (90.5 bits), Expect = 2.3e-21, P = 2.3e-21
 Identities = 48/119 (40%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++    + GGD +R  NG GG S YG  FP+ ++   H  PGV+ M N  
Sbjct:    53 LHYKGSKFHRVIPNFMLQGGDFTRG-NGTGGESIYGEKFPDENFQEKHTGPGVLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I      W++G++V FGRV++GMNVV+AI     +  ++   ++ I+DCG
Sbjct:   112 PNTNGSQFFICTAKTEWLDGKHVVFGRVVEGMNVVKAIESKGSQSGRTSA-DVVITDCG 169


>bbs|178427 (S82440) cyclophilin [Hemicentrotus pulcherrimus, early pluteus
            larva, Peptide, 164 aa] [Hemicentrotus pulcherrimus]
            Length = 164

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 3.7e-21, P = 3.7e-21
 Identities = 45/117 (38%), Positives = 71/117 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GSTF R++ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSTFHRVIPGFMCQGGDFTR-HNGTGGKSIYGEKFADENFTLKHTQPGILSMANAGVN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I     SW++G++V FG V  G+++++ +        ++  K+ITI+DCG
Sbjct:   107 TNGSQFFICTAVTSWLDGKHVVFGAVTQGLDIIKKVESYGSDSGKTS-KKITIADCG 162


>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer)
            Complex (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid,
            Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A; Chain: A; Ec:
            5.2.1.8; Engineered: Yes; Mutation: Seleno... >pdb|1AWT|A Chain A,
            Secypa Complexed With Hagpia Complex (IsomerasePEPTIDE),
            CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule:
            Cyclophilin A; Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered:
            Yes; Mutation: Seleno-Methionine ... >pdb|1AWT|B Chain B, Secypa
            Complexed With Hagpia Complex (IsomerasePEPTIDE), CYCLOPHILIN A,
            HIV-1 Capsid, Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A;
            Chain: A, B, C ,D, E, F; Ec: 5.2.1.8; Engineered: Yes; Mutation:
            Seleno-Methionine ... >pdb|1AWT|C Chain C, Secypa Complexed With
            Hagpia Complex (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid,
            Pseudo-Symmetry Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C
            ,D, E, F; Ec: 5.2.1.8; Engineered: Yes; Mutation: Seleno-Methionine
            ... >pdb|1AWT|D Chain D, Secypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C ,D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Mutation: Seleno-Methionine ...
            >pdb|1AWT|E Chain E, Secypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C ,D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Mutation: Seleno-Methionine ...
            >pdb|1AWT|F Chain F, Secypa Complexed With Hagpia Complex
            (IsomerasePEPTIDE), CYCLOPHILIN A, HIV-1 Capsid, Pseudo-Symmetry
            Mol_id: 1; Molecule: Cyclophilin A; Chain: A, B, C ,D, E, F; Ec:
            5.2.1.8; Engineered: Yes; Mutation: Seleno-Methionine ...
            Length = 164

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 3.7e-21, P = 3.7e-21
 Identities = 47/120 (39%), Positives = 73/120 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++   N   +
Sbjct:    47 YKGSCFHRIIPGFXCQGGDFTR-HNGTGGKSIYGEKFEDENFILKHTGPGILSXANAGPN 105

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+I      W++G++V FG+V +G N+VEA      ++ ++  K+ITI+DCG ++
Sbjct:   106 TNGSQFFICTAKTEWLDGKHVVFGKVKEGXNIVEAXERFGSRNGKTS-KKITIADCGQLE 164


>sp|P15425|CYPR_DROME PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, RHODOPSIN SPECIFIC
            ISOZYME PRECURSOR (PPIASE) (ROTAMASE) >pir||CYFFBE peptidylprolyl
            isomerase (EC 5.2.1.8) B, eye-specific, precursor - fruit fly
            (Drosophila melanogaster) >gi|157961 (M22851) cyclosporine A
            binding protein [Drosophila melanogaster] >gnl|PID|e1290481
            (X14769) ninaA [Drosophila melanogaster] >prf||1505369A ninaA gene
            [Drosophila melanogaster]
            Length = 237

  Plus Strand HSPs:

 Score = 251 (88.4 bits), Expect = 9.7e-21, P = 9.7e-21
 Identities = 48/121 (39%), Positives = 71/121 (58%), Frame = +3

Query:     6 TYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNX--SYAIPHDAPGVIGMCND 179
             +Y GS F R++    V GGDI    +G G  S YG YFP+   + A+ H+ PG +GM N 
Sbjct:    71 SYVGSRFHRVVDRFLVQGGDIVNG-DGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANR 129

Query:   180 NEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               DTN   FY+T     W++G++  FG+V++GM+ + AI DV    +  P + + IS+CG
Sbjct:   130 GPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCG 189

Query:   360 VI 365
              I
Sbjct:   190 EI 191


>sp|P23285|CYPB_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERASE B PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN B) (CYCLOPHILIN-RELATED PROTEIN)
            >pir||S12324 peptidylprolyl isomerase (EC 5.2.1.8) 2 - yeast
            (Saccharomyces cerevisiae) >gi|487955 (U00061) Cyp2p:
            Peptidyl-prolyl cis-trans isomerase B [Saccharomyces cerevisiae]
            Length = 205

  Plus Strand HSPs:

 Score = 251 (88.4 bits), Expect = 9.7e-21, P = 9.7e-21
 Identities = 49/115 (42%), Positives = 70/115 (60%), Frame = +3

Query:    15 GSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNEDTN 194
             GSTF R++    V GGD + D  G GG S YG  FP+ ++ + HD  G + M N  +DTN
Sbjct:    83 GSTFHRVIPNFMVQGGDFT-DGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTN 141

Query:   195 ASSFYITM-KAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              S F+IT  +  SW++G++V FG+V+DGM+VV  I  V    N  P + + I+ CG
Sbjct:   142 GSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCG 197


>sp|P52011|CYP3_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 3 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-3) >gi|1109668 (U31077) cyclophilin isoform 3
            [Caenorhabditis elegans]
            Length = 173

  Plus Strand HSPs:

 Score = 251 (88.4 bits), Expect = 9.7e-21, P = 9.7e-21
 Identities = 46/119 (38%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F RI+    + GGD +R  NG GG S YG  FP+ ++   H  PGV+ M N  
Sbjct:    53 LHFKGSKFHRIIPNFMIQGGDFTRG-NGTGGESIYGEKFPDENFKEKHTGPGVLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F++      W++G++V FGRV++G++VV+A+   +   +  P K+  I+DCG
Sbjct:   112 PNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVES-NGSQSGKPVKDCMIADCG 169


>gnl|PID|e32235 (X51497) cyclophilin-related protein [Saccharomyces cerevisiae]
            Length = 206

  Plus Strand HSPs:

 Score = 251 (88.4 bits), Expect = 9.7e-21, P = 9.7e-21
 Identities = 49/115 (42%), Positives = 70/115 (60%), Frame = +3

Query:    15 GSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNEDTN 194
             GSTF R++    V GGD + D  G GG S YG  FP+ ++ + HD  G + M N  +DTN
Sbjct:    85 GSTFHRVIPNFMVQGGDFT-DGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTN 143

Query:   195 ASSFYITM-KAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              S F+IT  +  SW++G++V FG+V+DGM+VV  I  V    N  P + + I+ CG
Sbjct:   144 GSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCG 199


>gnl|PID|e267528 (Y08320) cyclophylin [Digitalis lanata]
            Length = 172

  Plus Strand HSPs:

 Score = 251 (88.4 bits), Expect = 9.7e-21, P = 9.7e-21
 Identities = 48/121 (39%), Positives = 72/121 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++ G    GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKGSAFHRVIPGFMCQGGDFTAG-NGTGGESIYGAKFADENFVKKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
               TN S F+I  +  SW++G++V FG+V++GM+VV AI  V  +  ++  K + I+DCG 
Sbjct:   112 PGTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGKT-AKPVVIADCGQ 170

Query:   363 I 365
             I
Sbjct:   171 I 171


>sp|P52009|CYP1_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 1 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-1) >gi|1146430 (U30943) cyclophilin-1 [Caenorhabditis
            elegans]
            Length = 192

  Plus Strand HSPs:

 Score = 250 (88.0 bits), Expect = 1.2e-20, P = 1.2e-20
 Identities = 48/119 (40%), Positives = 71/119 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F RI+    + GGD +R HNG GG S YG  F + ++ + H  PG + M N  
Sbjct:    71 LHFKGSKFHRIIPEFMIQGGDFTR-HNGTGGESIYGNKFKDENFDLKHTGPGCLSMANAG 129

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I      W++G +V FG+V DGM+VV+ I  +  +   +P K +TI+DCG
Sbjct:   130 PNTNGSQFFICTVDTPWLDGGHVVFGQVTDGMSVVKKIEKMGSRSG-APAKTVTIADCG 187


>gi|192867 (L04289) cyclophilin-related protein [Mus musculus]
           Length = 1421

  Plus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 1.3e-20, P = 1.3e-20
 Identities = 52/135 (38%), Positives = 80/135 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R+++   + GGD S + NG GG S YG YF + ++ + HD   ++ M N  
Sbjct:    70 LCYKGSTFHRVVKNFMIQGGDFS-EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRG 128

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             + TN S F+IT K    ++G +V FG VI G  V+E I ++       P  ++ + DCGV
Sbjct:   129 KHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 188

Query:   363 I--DLTDD*YEKRRER 404
             +   LT D +EK+R++
Sbjct:   189 LATKLTKDVFEKKRKK 204


>sp|P52016|CYP8_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 8 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-8) >gi|1072171 (U40938) coded for by C. elegans cDNA
            CEESF41R;  contains a cyclophilin-like PPIase domain
            [Caenorhabditis elegans] >gi|1185432 (U31078) cyclophilin isoform 8
            [Caenorhabditis elegans]
            Length = 466

  Plus Strand HSPs:

 Score = 255 (89.8 bits), Expect = 1.3e-20, P = 1.3e-20
 Identities = 46/118 (38%), Positives = 74/118 (62%), Frame = +3

Query:     6 TYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNE 185
             +Y+GS F R+++G  + GGDI+   NG GGYS YGR F + + A+ H  P ++ M N   
Sbjct:    58 SYQGSVFHRVIKGFMIQGGDITHG-NGTGGYSIYGRTFDDENLALKHKKPYLLSMANRGP 116

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             DTN S F+IT + +  ++G++  FG VI G+ VV+AI +++  +   P  ++ I+ CG
Sbjct:   117 DTNGSQFFITSEEVPHLDGKHCVFGEVIKGVEVVKAIENLETGNEDKPVCKVEITHCG 174


>sp|P30415|NKCR_MOUSE NK-TUMOR RECOGNITION PROTEIN (NATURAL-KILLER CELLS
            CYCLOPHILIN-RELATED PROTEIN) (NK-TR PROTEIN)
            Length = 1466

  Plus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 1.4e-20, P = 1.4e-20
 Identities = 52/135 (38%), Positives = 80/135 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R+++   + GGD S + NG GG S YG YF + ++ + HD   ++ M N  
Sbjct:    70 LCYKGSTFHRVVKNFMIQGGDFS-EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRG 128

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             + TN S F+IT K    ++G +V FG VI G  V+E I ++       P  ++ + DCGV
Sbjct:   129 KHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 188

Query:   363 I--DLTDD*YEKRRER 404
             +   LT D +EK+R++
Sbjct:   189 LATKLTKDVFEKKRKK 204


>pir||B47328 natural killer cell tumor-recognition protein - mouse
            Length = 1507

  Plus Strand HSPs:

 Score = 264 (92.9 bits), Expect = 1.4e-20, P = 1.4e-20
 Identities = 52/135 (38%), Positives = 80/135 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R+++   + GGD S + NG GG S YG YF + ++ + HD   ++ M N  
Sbjct:   111 LCYKGSTFHRVVKNFMIQGGDFS-EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRG 169

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             + TN S F+IT K    ++G +V FG VI G  V+E I ++       P  ++ + DCGV
Sbjct:   170 KHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 229

Query:   363 I--DLTDD*YEKRRER 404
             +   LT D +EK+R++
Sbjct:   230 LATKLTKDVFEKKRKK 245


>sp|P34887|CYPH_ALLCE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >gi|289118 (L13365)
            cyclophilin [Allium cepa]
            Length = 150

  Plus Strand HSPs:

 Score = 249 (87.7 bits), Expect = 1.6e-20, P = 1.6e-20
 Identities = 48/119 (40%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS+F R++ G    GGD +   NG GG S YG  F + ++   H  PGV+ M N  
Sbjct:    31 LHYKGSSFHRVIPGFMCQGGDFTAG-NGTGGESIYGAKFKDENFIKKHTGPGVLSMANAG 89

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               TN S F+I  +  +W++G++V FG+V++GM+VV AI  V  +  Q+  K + I+DCG
Sbjct:    90 PGTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGQTK-KPVKIADCG 147


>sp|P28517|CYPR_CALVI PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, RHODOPSIN SPECIFIC
            ISOZYME PRECURSOR (PPIASE) (ROTAMASE)
            Length = 234

  Plus Strand HSPs:

 Score = 249 (87.7 bits), Expect = 1.6e-20, P = 1.6e-20
 Identities = 49/128 (38%), Positives = 73/128 (57%), Frame = +3

Query:     6 TYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNE 185
             TY GS F R++    + GGDI  +++G G  S YG +F + +  + H  PG +GM N   
Sbjct:    70 TYVGSEFHRVISRFLIQGGDIV-NNDGTGSTSIYGDFFQDEALDVEHLRPGYLGMANRGP 128

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             DTN   FY+T  A  W+NG++  FG+VI+GM+ V AI DV    +  P   + I +CG  
Sbjct:   129 DTNGCQFYVTTVAAQWLNGKHTVFGKVIEGMDTVYAIEDVKTDTDDHPIDPVIIVNCG-- 186

Query:   366 DLTDD*YE 389
             ++  + YE
Sbjct:   187 EMPTEPYE 194


>sp|P30405|CYPM_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, MITOCHONDRIAL
            PRECURSOR (PPIASE) (ROTAMASE) (CYCLOPHILIN) >pir||A41581
            peptidylprolyl isomerase (EC 5.2.1.8) 3 precursor - human
            >gi|181274 (M80254) cyclophilin 3 protein [Homo sapiens]
            Length = 207

  Plus Strand HSPs:

 Score = 248 (87.3 bits), Expect = 2.0e-20, P = 2.0e-20
 Identities = 47/117 (40%), Positives = 70/117 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GSTF R++       GD + +HNG GG S YG  FP+ ++ + H  PGV+ M N   +
Sbjct:    90 YKGSTFHRVIPSFMCQAGDFT-NHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPN 148

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I      W++G++V FG V +GM+VV+ I     K  ++  K+I I+DCG
Sbjct:   149 TNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTS-KKIVITDCG 204


>gi|1209511 (U33869) cyclophilin [Plasmodium falciparum]
            Length = 171

  Plus Strand HSPs:

 Score = 248 (87.3 bits), Expect = 2.0e-20, P = 2.0e-20
 Identities = 48/119 (40%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+ S F RI+      GGDI+   NG+GG S YGR F + ++ + HD PG++ M N  
Sbjct:    53 LHYKNSIFHRIIPQFMCQGGDITNG-NGSGGESIYGRSFTDENFNMKHDQPGLLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN+S F+IT+    W++G++V FG+VI+GMNVV  +     K      + + I+DCG
Sbjct:   112 PNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAKSGYVK-RSVVITDCG 169


>sp|P29117|CYPM_RAT PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, MITOCHONDRIAL
            PRECURSOR (PPIASE) (ROTAMASE) (CYCLOPHILIN) >gi|1549271 (U68544)
            cyclophilin D [Rattus norvegicus]
            Length = 206

  Plus Strand HSPs:

 Score = 248 (87.3 bits), Expect = 2.0e-20, P = 2.0e-20
 Identities = 47/117 (40%), Positives = 70/117 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GSTF R++       GD + +HNG GG S YG  FP+ ++ + H  PGV+ M N   +
Sbjct:    89 YKGSTFHRVIPAFMCQAGDFT-NHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPN 147

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I      W++G++V FG V +GM+VV+ I     K  ++  K+I I+DCG
Sbjct:   148 TNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTS-KKIVITDCG 203


>gi|1480465 (U47812) cyclophilin Ovcyp-2 [Onchocerca volvulus]
            Length = 171

  Plus Strand HSPs:

 Score = 247 (86.9 bits), Expect = 2.6e-20, P = 2.6e-20
 Identities = 46/119 (38%), Positives = 71/119 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++      GGD +R  NG GG S YG  F + ++   H  PGV+ M N  
Sbjct:    53 LHYKGSKFHRVIPNFMCQGGDFTRG-NGTGGESIYGEKFEDENFKEKHTGPGVLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              DTN S F++      W++G++V FGRV+DGM+VV+ I  V  +  ++  K++ +++CG
Sbjct:   112 PDTNGSQFFLCTVKTDWLDGKHVVFGRVVDGMDVVQKIEAVGSQSGKTS-KDVVVANCG 169


>gi|1480461 (U47811) cyclophilin Bmcyp-2 [Brugia malayi]
            Length = 171

  Plus Strand HSPs:

 Score = 245 (86.2 bits), Expect = 4.2e-20, P = 4.2e-20
 Identities = 47/119 (39%), Positives = 70/119 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++    + GGD +R  NG GG S YG  FP+ ++   H   GV+ M N  
Sbjct:    53 LHYKGSKFHRVIPNFMLQGGDFTRG-NGTGGQSIYGEKFPDENFQEKHTGLGVLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I      W++G++V F RV++GMNVV+A+     +  ++   +I ISDCG
Sbjct:   112 PNTNGSQFFICTAKTEWLDGKHVVFNRVVEGMNVVKAVESKGSQSGRTSA-DIVISDCG 169


>gnl|PID|e267365 (Y08273) cyclophilin [Digitalis lanata]
            Length = 172

  Plus Strand HSPs:

 Score = 245 (86.2 bits), Expect = 4.2e-20, P = 4.2e-20
 Identities = 45/119 (37%), Positives = 71/119 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++ G    GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKGSAFHRVIPGFMCQGGDFTAG-NGTGGESIYGAKFADENFVKKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               TN S F+I  +  +W++G++V FG+V++GM+VV AI  V  +  ++  K + ++DCG
Sbjct:   112 PGTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGKT-AKPVVVADCG 169


>sp|P54985|CYPH_BLAGE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >pir||S63995
            peptidylprolyl isomerase (EC 5.2.1.8) - German cockroach
            >gnl|PID|e290267 (X87418) peptidyl-prolyl cis-trans isomerase.
            [Blattella germanica]
            Length = 164

  Plus Strand HSPs:

 Score = 245 (86.2 bits), Expect = 4.2e-20, P = 4.2e-20
 Identities = 45/119 (37%), Positives = 72/119 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R++      GGD + +HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSRFHRVIPNFMCQGGDFT-NHNGTGGKSIYGTKFEDENFQLKHTGPGILWMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT    SW++ R+V FG V++GM+VV+ +  +  +  ++  K+I + DCG I
Sbjct:   107 TNGSQFFITTAKTSWLDNRHVVFGSVVEGMDVVKKLESLGSQSGKTN-KKIAVVDCGQI 164


>sp|P18253|CYPH_SCHPO PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) (CPH) >pir||CSZPA
            peptidylprolyl isomerase (EC 5.2.1.8) A - fission yeast
            (Schizosaccharomyces pombe) >gi|5016 (X53223) cyclophilin (AA
            1-162) [Schizosaccharomyces pombe] >gnl|PID|d1012858 (D83992)
            peptidyl-prolyl cis-trans isomerase [Schizosaccharomyces pombe]
            Length = 162

  Plus Strand HSPs:

 Score = 244 (85.9 bits), Expect = 5.4e-20, P = 5.4e-20
 Identities = 45/119 (37%), Positives = 70/119 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GSTF R++    + GGD +R  NG GG S YG  FP+ ++A+ H+ PG++ M N   +
Sbjct:    46 YAGSTFHRVIPQFMLQGGDFTRG-NGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPN 104

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT     W++G++V FG V +GM+VV+ +  +      +  + I I  CG +
Sbjct:   105 TNGSQFFITTVVTPWLDGKHVVFGEVTEGMDVVKKVESLGSNSGATRAR-IVIDKCGTV 162


>pir||S48018 peptidylprolyl isomerase (EC 5.2.1.8) Cyp1 - rice >gi|600765
            (L29471) cyclophilin 1 [Oryza sativa]
            Length = 179

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 8.8e-20, P = 8.8e-20
 Identities = 49/126 (38%), Positives = 70/126 (55%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F RI+      GGD +R  NG GG S YG  F + ++ + H  PGV+ M N  
Sbjct:    55 LHYKGSAFHRIIPNFMCQGGDFTRG-NGTGGESIYGDRFADENFKLRHTGPGVLSMANAG 113

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F+I     +W++G++V FG+V+DG  VVE +  V    +    + + I DCG 
Sbjct:   114 PNTNGSQFFICTTRTTWLDGKHVVFGKVVDGYTVVEKMEQVG-SGSGGTAERVLIEDCG- 171

Query:   363 IDLTDD 380
               L DD
Sbjct:   172 -QLADD 176


>pir||A53422 peptidylprolyl isomerase (EC 5.2.1.8) ROC1 - Arabidopsis thaliana
            Length = 173

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 8.8e-20, P = 8.8e-20
 Identities = 43/119 (36%), Positives = 70/119 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHFKGSKFHRVIPNFMCQGGDFTAG-NGTGGESIYGSKFEDENFERKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I      W++G++V FG+V++G++VV+AI  V  + +  P K + ++DCG
Sbjct:   112 ANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSRSSGKPTKPVVVADCG 170


>sp|Q09637|CYP9_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 9 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-9) >gi|1185450 (U36581) cyclophilin isoform 9
            [Caenorhabditis elegans] >gi|2262220 (U95074) cyclophilin isoform 9
            [Caenorhabditis elegans]
            Length = 309

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 8.8e-20, P = 8.8e-20
 Identities = 45/119 (37%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+ + F RI++   + GGDI+ + +G GG+S YGRYF +  + + H  P ++ M N  
Sbjct:    55 LHYKQNEFHRIVKKFMIQGGDIT-EGDGRGGFSIYGRYFDDEKFKLKHSRPYLLSMANKG 113

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              ++N+S F+IT  A    NG++V FG V+ G NVV+ I ++ V     P  ++ IS+CG
Sbjct:   114 PNSNSSQFFITTAAAPHCNGKHVVFGEVVKGQNVVDYIDNLAVDDKSKPLAKVLISNCG 172


>gnl|PID|e284969 (Z48245) T27D1.1 [Caenorhabditis elegans]
            Length = 271

  Plus Strand HSPs:

 Score = 242 (85.2 bits), Expect = 8.8e-20, P = 8.8e-20
 Identities = 45/119 (37%), Positives = 72/119 (60%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+ + F RI++   + GGDI+ + +G GG+S YGRYF +  + + H  P ++ M N  
Sbjct:    17 LHYKQNEFHRIVKKFMIQGGDIT-EGDGRGGFSIYGRYFDDEKFKLKHSRPYLLSMANKG 75

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              ++N+S F+IT  A    NG++V FG V+ G NVV+ I ++ V     P  ++ IS+CG
Sbjct:    76 PNSNSSQFFITTAAAPHCNGKHVVFGEVVKGQNVVDYIDNLAVDDKSKPLAKVLISNCG 134


>sp|P30412|CYPC_MOUSE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C (PPIASE) (ROTAMASE)
            (CYCLOPHILIN C) >pir||A40047 peptidylprolyl isomerase (EC 5.2.1.8)
            (cyclophilin C) - mouse >gi|192899 (M74227) cyclophilin C [Mus
            musculus]
            Length = 212

  Plus Strand HSPs:

 Score = 241 (84.8 bits), Expect = 1.1e-19, P = 1.1e-19
 Identities = 45/121 (37%), Positives = 71/121 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R+++   + GGD +   +G GG S YG  FP+ ++ + H   G + M N   D
Sbjct:    82 YKGSIFHRVIKDFMIQGGDFTA-RDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPD 140

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT+   +W++G++V FG+V+DGM VV +I       +  P  + TI + G ID
Sbjct:   141 TNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKID 200

Query:   369 L 371
             +
Sbjct:   201 V 201


>pdb|2RMC|A Mus musculus >pdb|2RMC|C Mus musculus >pdb|2RMC|E Mus musculus
            >pdb|2RMC|G Mus musculus
            Length = 182

  Plus Strand HSPs:

 Score = 241 (84.8 bits), Expect = 1.1e-19, P = 1.1e-19
 Identities = 45/121 (37%), Positives = 71/121 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R+++   + GGD +   +G GG S YG  FP+ ++ + H   G + M N   D
Sbjct:    52 YKGSIFHRVIKDFMIQGGDFTA-RDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPD 110

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT+   +W++G++V FG+V+DGM VV +I       +  P  + TI + G ID
Sbjct:   111 TNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKID 170

Query:   369 L 371
             +
Sbjct:   171 V 171


>pir||S62327 cyclophilin-like protein wis2 - fission yeast (Schizosaccharomyces
            pombe) >gnl|PID|e205292 (X91981) wis2 gene product
            [Schizosaccharomyces pombe] >gnl|PID|e334342 (Z98598) heat shock
            element [Schizosaccharomyces pombe]
            Length = 356

  Plus Strand HSPs:

 Score = 241 (84.8 bits), Expect = 1.1e-19, P = 1.1e-19
 Identities = 45/119 (37%), Positives = 70/119 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             LTY+GS F R+++   + GGD +R  NG GG S YG  F + ++ + HD P ++ M N  
Sbjct:    49 LTYKGSRFHRVIKNFMLQGGDFTRG-NGTGGESIYGEKFEDENFELKHDKPFLLSMANAG 107

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+IT      ++G++V FG+VI G + V  I +++ K N  P   + I +CG
Sbjct:   108 PNTNGSQFFITTVPTPHLDGKHVVFGKVIQGKSTVRTIENLETK-NDDPVVPVVIEECG 165


>sp|P45877|CYPC_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C (PPIASE) (ROTAMASE)
            (CYCLOPHILIN C) >pir||A54204 peptidylprolyl isomerase (EC 5.2.1.8)
            C precursor - human >bbs|149388 (S71018) cyclophilin C, Cyp-C
            [human, kidney, Peptide, 212 aa] [Homo sapiens]
            Length = 212

  Plus Strand HSPs:

 Score = 240 (84.5 bits), Expect = 1.4e-19, P = 1.4e-19
 Identities = 46/121 (38%), Positives = 71/121 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R+++   + GGDI+   +G GG S YG  FP+ ++ + H   G + M N   D
Sbjct:    82 YKGSKFHRVIKDFMIQGGDITTG-DGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD 140

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT+   +W++G++V FG+VIDGM VV +I       +  P    +I + G ID
Sbjct:   141 TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKID 200

Query:   369 L 371
             +
Sbjct:   201 V 201


>gi|1045518 (U36797) cyclophilin-A [Hirudo medicinalis] >prf||2207414A
            cyclophilin [Hirudo medicinalis]
            Length = 143

  Plus Strand HSPs:

 Score = 240 (84.5 bits), Expect = 1.4e-19, P = 1.4e-19
 Identities = 42/117 (35%), Positives = 71/117 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F R++      GGD +R  +G GG S YG  F + ++ + H  PG++ M N  ++
Sbjct:    27 YKGSSFHRVIPNFMCQGGDFTRG-DGTGGKSIYGNKFEDENFKLKHTGPGILSMANAGKN 85

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I      W++G++V FGRV++G++VV+ +     + + SP    +I+DCG
Sbjct:    86 TNGSQFFICTTKTEWLDGKHVVFGRVVEGLDVVKEVETFGTQ-SASPSSRSSIADCG 141


>sp|P52014|CYP6_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 6 PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN-6) >gi|485120 (U00051) coded for by C.
            elegans cDNA yk89e10.5; coded for by C. elegans cDNA yk89e10.3;
            highly similar to peptidyl-prolyl cis-trans isomerase B precursor
            [Caenorhabditis elegans] >gi|863010 (U27354) cyclophilin
            [Caenorhabditis elegans]
            Length = 201

  Plus Strand HSPs:

 Score = 239 (84.1 bits), Expect = 1.8e-19, P = 1.8e-19
 Identities = 44/119 (36%), Positives = 69/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS F R++    + GGD +R  +G GG S YG  F + ++ + H  PG + M N  ED
Sbjct:    70 YVGSKFHRVIENFMIQGGDFTRG-DGTGGRSIYGERFEDENFKLQHYGPGWLSMANAGED 128

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT    SW++G++V FG++++GM+VV  I          P +++ I++ G I
Sbjct:   129 TNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREIEATPKGAGDRPIEDVVIANAGHI 187


>gi|2443757 (AF020434) cyclophilin [Arabidopsis thaliana]
            Length = 174

  Plus Strand HSPs:

 Score = 239 (84.1 bits), Expect = 1.8e-19, P = 1.8e-19
 Identities = 43/121 (35%), Positives = 72/121 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS+F R++      GGD ++  NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    54 LHFKGSSFHRVIPNFMCQGGDFTKG-NGTGGESIYGAKFEDENFERKHTGPGILSMANAG 112

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F+I      W++G++V FG+V++G++VV+AI  +     + P K + ++DCG 
Sbjct:   113 ANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGK-PTKPVVVADCGE 171

Query:   363 I 365
             I
Sbjct:   172 I 172


>sp|P30414|NKCR_HUMAN NK-TUMOR RECOGNITION PROTEIN (NATURAL-KILLER CELLS
            CYCLOPHILIN-RELATED PROTEIN) (NK-TR PROTEIN) >pir||A47328 natural
            killer cell tumor-recognition protein - human >gi|181252 (L04288)
            cyclophilin-related protein [Homo sapiens]
            Length = 1403

  Plus Strand HSPs:

 Score = 253 (89.1 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 50/135 (37%), Positives = 78/135 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R+++   + GGD S + NG GG S YG YF + ++ + HD   ++ M N  
Sbjct:   111 LCYKGSTFHRVVKNFMIQGGDFS-EGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRG 169

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             + TN S F+IT K    ++G +V FG VI G  V+E I ++       P  ++ + DCGV
Sbjct:   170 KHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 229

Query:   363 IDLTD--D*YEKRRER 404
             +      D +EK+R++
Sbjct:   230 LATKSIKDVFEKKRKK 245


>sp|P52015|CYP7_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 7 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-7) >gi|863016 (U27559) cyclophilin [Caenorhabditis
            elegans]
            Length = 171

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 2.3e-19, P = 2.3e-19
 Identities = 44/119 (36%), Positives = 71/119 (59%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F RI+    + GGD +R  NG GG S YG  FP+ ++   H  PGV+ M N  
Sbjct:    53 LHFKGSKFHRIIPEFMIQGGDFTRG-NGTGGESIYGEKFPDENFKEKHTGPGVLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F++     +W++G++V FGRV++G+++V  +   +   + +P  E  I+DCG
Sbjct:   112 PNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEG-NGSSSGTPKSECLIADCG 169


>sp|Q39613|CYPH_CATRO PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >gnl|PID|e140536
            (X85185) cyclophilin [Catharanthus roseus]
            Length = 172

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 2.3e-19, P = 2.3e-19
 Identities = 44/119 (36%), Positives = 70/119 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+ S+F R++ G    GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKDSSFHRVIPGFMCQGGDFTAG-NGTGGESIYGAKFADENFIKKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I      W++G++V FG+V++GM+VV+AI  V     ++  K++ + DCG
Sbjct:   112 PNTNGSQFFICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRT-AKKVVVEDCG 169


>pir||S71219 cytosolic cyclophilin ROC3 - Arabidopsis thaliana >gi|1305455
            (U40399) cytosolic cyclophilin [Arabidopsis thaliana]
            Length = 173

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 2.3e-19, P = 2.3e-19
 Identities = 46/121 (38%), Positives = 71/121 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS+F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    54 LHYKGSSFHRVIPKFMCQGGDFTAG-NGTGGESIYGSKFKDENFIKKHTGPGILSMANAG 112

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F+I  +  SW++G++V FG+V++G+NVV  I  V     ++  K + I+DCG 
Sbjct:   113 ANTNGSQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTS-KPVVIADCGQ 171

Query:   363 I 365
             I
Sbjct:   172 I 172


>gnl|PID|d1018574 (D90909) peptidyl-prolyl cis-trans isomerase [Synechocystis
            sp.]
            Length = 171

  Plus Strand HSPs:

 Score = 238 (83.8 bits), Expect = 2.3e-19, P = 2.3e-19
 Identities = 44/121 (36%), Positives = 71/121 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F R++      GGD +R  NG GG S YG  F + ++ + HD PG++ M N  
Sbjct:    52 LHFKGSHFHRVITDFMAQGGDFTRG-NGTGGESIYGEKFADENFQLKHDRPGLLSMANAG 110

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F++T     W++G++V FG V++G+ ++E +     +  Q+  + I ISDCG 
Sbjct:   111 PNTNGSQFFLTFVPCPWLDGKHVVFGEVVEGLEILEQLEANGSQSGQTK-QAIVISDCGE 169

Query:   363 I 365
             I
Sbjct:   170 I 170


>sp|P21568|CYPH_LYCES PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >gi|170440 (M55019)
            cyclophilin [Lycopersicon esculentum]
            Length = 171

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 3.0e-19, P = 3.0e-19
 Identities = 45/119 (37%), Positives = 67/119 (56%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R++ G    GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKGSTFHRVIPGFMCQGGDFTAG-NGTGGESIYGAKFNDENFVKKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               TN S F+I      W+NG++V FG+V++GM+V++    V     +   K + I+DCG
Sbjct:   112 PGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCS-KPVVIADCG 169


>pir||CSTO peptidylprolyl isomerase (EC 5.2.1.8) - tomato
           Length = 171

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 3.0e-19, P = 3.0e-19
 Identities = 45/119 (37%), Positives = 67/119 (56%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R++ G    GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKGSTFHRVIPGFMCQGGDFTAG-NGTGGESIYGAKFNDENFVKKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               TN S F+I      W+NG++V FG+V++GM+V++    V     +   K + I+DCG
Sbjct:   112 PGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCS-KPVVIADCG 169


>gi|1532210 (U68268) cyclophilin A [Trypanosoma congolense]
            Length = 177

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 3.0e-19, P = 3.0e-19
 Identities = 51/118 (43%), Positives = 68/118 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIP---HDAPGVIGMCND 179
             Y GS F RI+      GGD +R HNG GG S YG  FP+ S+A     H  PG + M N 
Sbjct:    58 YSGSGFHRIIPNFMCQGGDFTR-HNGTGGKSIYGEKFPDESFAGKAGKHFGPGTLSMANA 116

Query:   180 NEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               +TN S F+I     +W++G++V FG+V+DGMNVVE +  V      S  K + IS+ G
Sbjct:   117 GPNTNGSQFFICTARTAWLDGKHVVFGQVLDGMNVVEGMEAVG-SQTGSTDKPVMISESG 175


>pir||S66681 peptidylprolyl isomerase (EC 5.2.1.8) A - human
            Length = 301

  Plus Strand HSPs:

 Score = 236 (83.1 bits), Expect = 3.8e-19, P = 3.8e-19
 Identities = 42/117 (35%), Positives = 71/117 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++GS+F RI+      GGD + +HNG GG S YG+ F + ++ + H  PG++ M N   +
Sbjct:   184 FKGSSFHRIIPQFMCQGGDFT-NHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPN 242

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F++T     W++G++V FG V +G++V+  I     K  + P +++ I+DCG
Sbjct:   243 TNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGK-PKQKVIIADCG 298


>gi|2828149 (AF042385) cyclophilin-33A [Homo sapiens]
            Length = 301

  Plus Strand HSPs:

 Score = 236 (83.1 bits), Expect = 3.8e-19, P = 3.8e-19
 Identities = 42/117 (35%), Positives = 71/117 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++GS+F RI+      GGD + +HNG GG S YG+ F + ++ + H  PG++ M N   +
Sbjct:   184 FKGSSFHRIIPQFMCQGGDFT-NHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPN 242

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F++T     W++G++V FG V +G++V+  I     K   +P +++ I+DCG
Sbjct:   243 TNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDG-NPKQKVIIADCG 298


>sp|P26882|CYP4_BOVIN 40 KD PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE)
            (ROTAMASE) (CYCLOPHILIN-40) (CYP-40) (CYCLOPHILIN-RELATED PROTEIN)
            (ESTROGEN RECEPTOR BINDING CYCLOPHILIN) >pir||A46579 estrogen
            receptor-binding cyclophilin - bovine >gnl|PID|d1003666 (D14074)
            cyclophilin [Bos taurus]
            Length = 370

  Plus Strand HSPs:

 Score = 237 (83.4 bits), Expect = 4.3e-19, P = 4.3e-19
 Identities = 47/126 (37%), Positives = 73/126 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++G  F RI++   + GGD S + NG GG S YG  F + ++   HD  G++ M N  
Sbjct:    66 LHFKGCPFHRIIKKFMIQGGDFS-NQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAG 124

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F+IT      ++G++V FG+VI GM V + + +V+VK  + P K   I++CG 
Sbjct:   125 SNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK-GEKPAKLCVIAECGE 183

Query:   363 IDLTDD 380
             +   DD
Sbjct:   184 LKEGDD 189


>pir||JT0686 peptidylprolyl isomerase (EC 5.2.1.8) a, cytosolic - fungus
            (Fusarium sporotrichioides)
            Length = 179

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.8e-19, P = 4.8e-19
 Identities = 50/119 (42%), Positives = 72/119 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F RI+    + GGD +R  NG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    59 YKGSSFHRIIPDFMLQGGDFTRG-NGTGGKSIYGEKFADENFKLEHSKPGLLSMANAGPN 117

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAIHDVD-----VKHNQSPCKEITI 347
             TN S F++T    SW++GR+V FG V D   MNVV+A+         +K+N    K+ TI
Sbjct:   118 TNGSQFFVTTVVTSWLDGRHVVFGEVADEESMNVVKALEATGSGSGAIKYN----KKATI 173

Query:   348 SDCG 359
              DCG
Sbjct:   174 VDCG 177


>gnl|PID|e1226445 (Y16088) cytosolic form of cyclophilin [Lupinus luteus]
            Length = 172

  Plus Strand HSPs:

 Score = 235 (82.7 bits), Expect = 4.8e-19, P = 4.8e-19
 Identities = 46/119 (38%), Positives = 68/119 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R++      GGD +   NG G  S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKGSTFHRVIPNFMCQGGDFTAG-NGTGAESIYGAKFADENFIKRHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               TN S F+I  +   W++G++V FG+VI+GMNVV  I  V     ++  + +TI+DCG
Sbjct:   112 AGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSGKTS-RPVTIADCG 169


>sp|P34791|CYP4_ARATH PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CHLOROPLAST
            PRECURSOR (PPIASE) (ROTAMASE) (CYCLOPHILIN) (CYCLOSPORIN A-BINDING
            PROTEIN) >pir||B53422 peptidylprolyl isomerase (EC 5.2.1.8) ROC4 -
            Arabidopsis thaliana >gi|405131 (L14845) cyclophilin [Arabidopsis
            thaliana] >gi|1322278 (U42724) cyclophilin [Arabidopsis thaliana]
            Length = 260

  Plus Strand HSPs:

 Score = 234 (82.4 bits), Expect = 6.2e-19, P = 6.2e-19
 Identities = 43/121 (35%), Positives = 69/121 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F RI++   + GGD + + NG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:   139 YKGSSFHRIIKDFMIQGGDFT-EGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPN 197

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+I     SW++ ++V FG+VI+GM +V  +   + +    P K   I  CG + 
Sbjct:   198 TNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELP 257

Query:   369 L 371
             L
Sbjct:   258 L 258


>pir||S50141 peptidylprolyl isomerase (EC 5.2.1.8) - Arabidopsis thaliana
            >gi|460968 (U07276) peptidyl-prolyl cis-trans isomerase
            [Arabidopsis thaliana] >gi|992643 (U32186) cyclophilin [Arabidopsis
            thaliana] >prf||2021266A peptidyl-Pro cis-trans isomerase
            [Arabidopsis thaliana]
            Length = 172

  Plus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 7.9e-19, P = 7.9e-19
 Identities = 45/119 (37%), Positives = 70/119 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F R++ G    GGD +   NG GG S YG  F + ++   H   G++ M N  
Sbjct:    53 LHFKGSIFHRVIPGFMCQGGDFTAK-NGTGGESIYGAKFKDENFIKKHTGAGILSMANSG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I     SW++G++V FG+V+ G++VV+AI  V     ++  K +TI+DCG
Sbjct:   112 PNTNGSQFFICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTS-KVVTITDCG 169


>sp|P34790|CYP1_ARATH PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >gi|405129 (L14844)
            cyclophilin [Arabidopsis thaliana]
            Length = 172

  Plus Strand HSPs:

 Score = 233 (82.0 bits), Expect = 7.9e-19, P = 7.9e-19
 Identities = 43/119 (36%), Positives = 69/119 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHFKGSKFHRVIPNFMCQGGDFTAG-NGTGGESIYGSKFEDENFERKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I      W++G++V FG+V++G++VV+AI  V     + P K + ++DCG
Sbjct:   112 ANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGK-PTKPVVVADCG 169


>gi|348725 (L11668) cyclophilin-40 [Bos taurus]
           Length = 309

  Plus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 1.0e-18, P = 1.0e-18
 Identities = 46/126 (36%), Positives = 72/126 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++G  F RI++   + GGD S + NG GG S YG  F + ++   HD  G++ M N  
Sbjct:    30 LHFKGCPFHRIIKKFMIQGGDFS-NQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAG 88

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F+IT      ++G++V FG+V  GM V + + +V+VK  + P K   I++CG 
Sbjct:    89 SNTNGSQFFITTVPTPHLDGKHVVFGQVXKGMGVAKILENVEVK-GEKPAKLCVIAECGE 147

Query:   363 IDLTDD 380
             +   DD
Sbjct:   148 LKEGDD 153


>gnl|PID|d1025140 (AB002414) cyclophilin-type peptidyl-prolyl cis-trans
            isomerase [Halobacterium cutirubrum]
            Length = 180

  Plus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 1.0e-18, P = 1.0e-18
 Identities = 47/113 (41%), Positives = 63/113 (55%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y G +F RI+ G  + GGD +    G  GY     +  +    + HD PGV+ M N   D
Sbjct:    65 YAGVSFHRIIEGFMIQGGDPTGTGRGGPGYEFADEFHDD----LTHDGPGVLSMANSGPD 120

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITI 347
             TN S F+IT+ A   ++GR+  FG V DGM+VVE I DV+   N +P  EITI
Sbjct:   121 TNGSQFFITLDAQPHLDGRHAVFGAVTDGMDVVETIGDVETDANDAPASEITI 173


>sp|P35176|CYPD_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERASE D PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN D) >pir||S38324 peptidylprolyl isomerase
            (EC 5.2.1.8) D precursor - yeast (Saccharomyces cerevisiae)
            >gi|402654 (X73142) CYPD gene product [Saccharomyces cerevisiae]
            >gi|849221 (U28374) Cyp5p: peptidyl-prolyl cis-trans isomerase D
            (Swiss Prot. accession number P35176 [Saccharomyces cerevisiae]
            Length = 225

  Plus Strand HSPs:

 Score = 231 (81.3 bits), Expect = 1.3e-18, P = 1.3e-18
 Identities = 43/120 (35%), Positives = 68/120 (56%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y  S F R++    + GGD +   +G GG S +G  F + ++ + HD PG + M N  ++
Sbjct:    79 YLNSIFHRVIPNFMIQGGDFTH-RSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKN 137

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT     W++G++V FG V+DGM+VV  I +V       P KE+ I + G ++
Sbjct:   138 TNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVIIVESGELE 197


>sp|P35627|CYP2_ARATH PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >pir||S22496
            peptidylprolyl isomerase (EC 5.2.1.8) - Arabidopsis thaliana
            >gi|16248 (X63616) cyclophorin-like protein [Arabidopsis thaliana]
            Length = 169

  Plus Strand HSPs:

 Score = 231 (81.3 bits), Expect = 1.3e-18, P = 1.3e-18
 Identities = 44/119 (36%), Positives = 65/119 (54%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             +TY GS F R++    + GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    50 MTYEGSVFHRVIPKFMLQGGDFTLG-NGRGGESIYGAKFADENFIHKHTTPGLLSMANAG 108

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               TN S F+IT  A   ++G++V FG+V++GM+VV  I          P  E+ I+ CG
Sbjct:   109 PGTNGSQFFITTVATPHLDGKHVVFGKVVEGMDVVRKIEATQTDRGDKPLSEVKIAKCG 167


>sp|Q08752|CYP4_HUMAN 40 KD PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE)
            (ROTAMASE) (CYCLOPHILIN-40) (CYP-40) (CYCLOPHILIN-RELATED PROTEIN)
            >pir||A45981 peptidylprolyl isomerase (EC 5.2.1.8) CyP-40 - human
            >gi|348910 (L11667) cyclophilin-40 [Homo sapiens] >gnl|PID|d1010571
            (D63861) cyclophilin 40 [Homo sapiens]
            Length = 370

  Plus Strand HSPs:

 Score = 232 (81.7 bits), Expect = 1.7e-18, P = 1.7e-18
 Identities = 46/126 (36%), Positives = 72/126 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++G  F RI++   + GGD S + NG GG S YG  F + ++   HD  G++ M N  
Sbjct:    66 LHFKGCPFHRIIKKFMIQGGDFS-NQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAG 124

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              +TN S F+IT      ++G++V FG+VI G+ V   + +V+VK  + P K   I++CG 
Sbjct:   125 RNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVK-GEKPAKLCVIAECGE 183

Query:   363 IDLTDD 380
             +   DD
Sbjct:   184 LKEGDD 189


>gi|2708309 (AF016371) U-snRNP-associated cyclophilin [Homo sapiens]
            Length = 177

  Plus Strand HSPs:

 Score = 229 (80.6 bits), Expect = 2.1e-18, P = 2.1e-18
 Identities = 42/117 (35%), Positives = 65/117 (55%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GSTF R+++   + GGD     +G G  S Y   F + ++ + H APG++ M N    
Sbjct:    60 YKGSTFHRVIKDFMIQGGDFVNG-DGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPS 118

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN   F+IT     W++G++V FG++IDG+ V+  I +V    N  P   + IS CG
Sbjct:   119 TNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCG 175


>gi|167138 (M55018) cyclophilin [Brassica napus]
           Length = 168

  Plus Strand HSPs:

 Score = 227 (79.9 bits), Expect = 3.4e-18, P = 3.4e-18
 Identities = 45/119 (37%), Positives = 68/119 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    50 LHYKGSAFHRVIPKFMCQGGDFTAG-NGTGGESIYGMKFKDENFVKKHTGPGILSMRNAG 108

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I  +  SW++G++V FG+V++GM+VV  I  V     ++  K +T  DCG
Sbjct:   109 SNTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTSKKVVTC-DCG 166


>pir||CSRP peptidylprolyl isomerase (EC 5.2.1.8) - rape
           Length = 171

  Plus Strand HSPs:

 Score = 227 (79.9 bits), Expect = 3.4e-18, P = 3.4e-18
 Identities = 45/119 (37%), Positives = 68/119 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKGSAFHRVIPKFMCQGGDFTAG-NGTGGESIYGMKFKDENFVKKHTGPGILSMRNAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I  +  SW++G++V FG+V++GM+VV  I  V     ++  K +T  DCG
Sbjct:   112 SNTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTSKKVVTC-DCG 169


>sp|P24525|CYPH_BRANA PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN)
            Length = 171

  Plus Strand HSPs:

 Score = 227 (79.9 bits), Expect = 3.4e-18, P = 3.4e-18
 Identities = 45/119 (37%), Positives = 68/119 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GS F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHYKGSAFHRVIPKFMCQGGDFTAG-NGTGGESIYGMKFKDENFVKKHTGPGILSMRNAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I  +  SW++G++V FG+V++GM+VV  I  V     ++  K +T  DCG
Sbjct:   112 SNTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTSKKVVTC-DCG 169


>gnl|PID|e1188506 (Z92822) ZK520.5 [Caenorhabditis elegans]
            Length = 172

  Plus Strand HSPs:

 Score = 226 (79.6 bits), Expect = 4.3e-18, P = 4.3e-18
 Identities = 44/119 (36%), Positives = 70/119 (58%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS F RI+    + GGD + + NG GG S +G  F + ++   H  PGV+ M N  
Sbjct:    53 LHFKGSKFHRIIPEFMIQGGDFT-EGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F++     +W++G++V FG+VI+GM+VV+AI       + +P     I+DCG
Sbjct:   112 ANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKG-SEDGAPSAPCVIADCG 169


>gnl|PID|d1026688 (AB012947) GC-CyP [Vicia faba]
            Length = 171

  Plus Strand HSPs:

 Score = 224 (78.9 bits), Expect = 7.1e-18, P = 7.1e-18
 Identities = 43/119 (36%), Positives = 67/119 (56%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GS+F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N  
Sbjct:    53 LHFKGSSFHRVIPNFMCQGGDFTAG-NGTGGESIYGSKFADENFIKKHTGPGILSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               TN S F+I      W++G++V FG+V+DG+NVV  I  V     ++  K + I++CG
Sbjct:   112 PGTNGSQFFICTAKTDWLDGKHVVFGQVVDGLNVVRDIEKVGSGSGKTS-KPVVIANCG 169


>gi|499693 (L32095) cyclophilin [Vicia faba]
           Length = 248

  Plus Strand HSPs:

 Score = 223 (78.5 bits), Expect = 9.0e-18, P = 9.0e-18
 Identities = 46/121 (38%), Positives = 69/121 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+    + GGD + + NG GG S YG  F + S+ + H  PGV+ M N   +
Sbjct:   126 YQGSFFHRIIPNFMIQGGDFT-EGNGTGGVSIYGSKFEDESFDLKHVGPGVLSMANAGPN 184

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDV-KHNQSPCKEITISDCGVI 365
             TN S F+I      W++ R+V FG VI+G++VV+ +   +  K + SP K   I+  G +
Sbjct:   185 TNGSQFFICTVPTPWLDNRHVVFGHVIEGLDVVKQLESQETSKLDNSPKKPCKIAKSGEL 244

Query:   366 DL 371
              L
Sbjct:   245 PL 246


>pdb|1A58|  Cyclophilin From Brugia Malayi Isomerase, Ppiase Mol_id: 1;
            Molecule: Cyclophilin; Chain: Null; Fragment: Cyclophilin Domain;
            Engineered: Mbp Fusion >pdb|1A33|  Peptidylprolyl Isomerase,
            Cyclophilin-Like Domain From Brugia Malayi Isomerase,
            Peptidyl-Prolyl Cis-Trans, Peptidylprolyl Isomerase Mol_id: 1;
            Molecule: Peptidylprolyl Isomerase; Chain: Null; Fragment:
            Cyclophilin-Like Domain; Ec:...
            Length = 177

  Plus Strand HSPs:

 Score = 223 (78.5 bits), Expect = 9.0e-18, P = 9.0e-18
 Identities = 42/119 (35%), Positives = 64/119 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R+++   + GGD ++  +G GG S YG  F +  + + HD P V+ M N  
Sbjct:    57 LHYKGSTFHRVIKNFMIQGGDFTKG-DGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKG 115

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+IT      +N  +V FG+V+ G  VV  I  +       P  ++ I +CG
Sbjct:   116 PNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCG 174


>sp|P10255|CYPH_NEUCR PEPTIDYL-PROLYL CIS-TRANS ISOMERASE PRECURSOR (PPIASE)
            (ROTAMASE) (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) (CPH)
            >pir||CSNCM peptidylprolyl isomerase (EC 5.2.1.8) precursor,
            mitochondrial - Neurospora crassa >gi|168806 (J03963) cyclophilin
            precursor [Neurospora crassa] >gi|295926 (X17692) cyclophilin
            (mitochondrial precursor) [Neurospora crassa]
            Length = 223

  Plus Strand HSPs:

 Score = 222 (78.1 bits), Expect = 1.2e-17, P = 1.2e-17
 Identities = 48/121 (39%), Positives = 68/121 (56%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F RI+    + GGD +R  NG GG S YG  F + ++A  H  PG++ M N   +
Sbjct:   103 YKGSSFHRIIPEFMLQGGDFTRG-NGTGGKSIYGEKFADENFAKKHVRPGLLSMANAGPN 161

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAIHDVDVKHNQSP-CKEITISDCG 359
             TN S F++T    SW++GR+V FG V D   M VV+A+             K+ TI DCG
Sbjct:   162 TNGSQFFVTTVPTSWLDGRHVVFGEVADDESMKVVKALEATGSSSGAIRYSKKPTIVDCG 221

Query:   360 VI 365
              +
Sbjct:   222 AL 223


>gi|295927 (X17692) cyclophilin (cytosolic form) [Neurospora crassa]
           Length = 180

  Plus Strand HSPs:

 Score = 222 (78.1 bits), Expect = 1.2e-17, P = 1.2e-17
 Identities = 48/121 (39%), Positives = 68/121 (56%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS+F RI+    + GGD +R  NG GG S YG  F + ++A  H  PG++ M N   +
Sbjct:    60 YKGSSFHRIIPEFMLQGGDFTRG-NGTGGKSIYGEKFADENFAKKHVRPGLLSMANAGPN 118

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAIHDVDVKHNQSP-CKEITISDCG 359
             TN S F++T    SW++GR+V FG V D   M VV+A+             K+ TI DCG
Sbjct:   119 TNGSQFFVTTVPTSWLDGRHVVFGEVADDESMKVVKALEATGSSSGAIRYSKKPTIVDCG 178

Query:   360 VI 365
              +
Sbjct:   179 AL 180


>sp|P52013|CYP5_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 5 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-5) >gi|1155221 (U31948) cyclophilin isoform 5
            [Caenorhabditis elegans]
            Length = 204

  Plus Strand HSPs:

 Score = 221 (77.8 bits), Expect = 1.5e-17, P = 1.5e-17
 Identities = 45/131 (34%), Positives = 71/131 (54%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS F R++    + GGD +R  +G GG S YG  F + ++ + H   G + M N   D
Sbjct:    73 YPGSKFHRVIADFMIQGGDFTRG-DGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGAD 131

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT     W++GR+V FG++++GM+VV  I   +      P +++ I+  G I 
Sbjct:   132 TNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAASGHIA 191

Query:   369 LTDD*YEKRRE 401
             + D  +   RE
Sbjct:   192 V-DTPFSVERE 201


>gnl|PID|e1254653 (AL022023) cyclophilin - like protein [Arabidopsis thaliana]
            Length = 224

  Plus Strand HSPs:

 Score = 221 (77.8 bits), Expect = 1.5e-17, P = 1.5e-17
 Identities = 47/132 (35%), Positives = 73/132 (55%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+G+ F RI+ G  + GGDI    +G    S YG  FP+ ++ I H   G++ M N  
Sbjct:    96 LHYKGTPFHRIISGFVIQGGDIIHG-DGKSSDSIYGGTFPDENFKIQHSHAGMVAMANTG 154

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
              D+N S F+IT    SW+ G +V  G+VI GM+ V AI      ++  P K++ I+D G 
Sbjct:   155 PDSNGSQFFITTVKASWLEGEHVVLGKVIQGMDNVFAIEGGAGTYSGKPRKKVVIADSG- 213

Query:   363 IDLTDD*YEKRR 398
              ++  D +++ R
Sbjct:   214 -EIPKDKWDEER 224


>gnl|PID|e1297816 (Z92784) F31C3.1 [Caenorhabditis elegans]
            Length = 204

  Plus Strand HSPs:

 Score = 221 (77.8 bits), Expect = 1.5e-17, P = 1.5e-17
 Identities = 45/131 (34%), Positives = 71/131 (54%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS F R++    + GGD +R  +G GG S YG  F + ++ + H   G + M N   D
Sbjct:    73 YPGSKFHRVIADFMIQGGDFTRG-DGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGAD 131

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVID 368
             TN S F+IT     W++GR+V FG++++GM+VV  I   +      P +++ I+  G I 
Sbjct:   132 TNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAASGHIA 191

Query:   369 LTDD*YEKRRE 401
             + D  +   RE
Sbjct:   192 V-DTPFSVERE 201


>sp|P25007|CYPH_DROME PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >pir||B38388
            peptidylprolyl isomerase (EC 5.2.1.8) (cyclophilin) cyp-1 - fruit
            fly (Drosophila melanogaster) >gi|157164 (M62398) CYP-1 [Drosophila
            melanogaster]
            Length = 165

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.4e-17, P = 2.4e-17
 Identities = 39/117 (33%), Positives = 69/117 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R++      GGD + +HNG GG S YG  FP+ ++ + H   G++ M N   +
Sbjct:    49 YKGSIFHRVIPNFMCQGGDFT-NHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGAN 107

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I     +W++ ++V FG V++G++VV+ I     +  ++  K+I +++ G
Sbjct:   108 TNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTS-KKIIVANSG 163


>gi|160945 (M93420) cyclophilin [Schistosoma japonicum]
           Length = 179

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.4e-17, P = 2.4e-17
 Identities = 45/117 (38%), Positives = 66/117 (56%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y    F R++      GGD  +  +G GG S YGR F + ++ + H+  GV+ M N   +
Sbjct:    62 YHNCCFHRVIPQFMCQGGDFVKG-DGTGGKSIYGRKFDDENFQLRHEGFGVLSMANSGPN 120

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKE-ITISDCG 359
             TN S F+I      W++G++V FGRV+DG NVV+ +  V  K  +   KE +TIS CG
Sbjct:   121 TNGSQFFICTTKCDWLDGKHVVFGRVVDGQNVVKKMESVGSKSGK--VKEPVTISRCG 176


>gi|1532212 (U68269) cyclophilin A [Trypanosoma vivax]
            Length = 177

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.4e-17, P = 2.4e-17
 Identities = 46/118 (38%), Positives = 66/118 (55%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIP---HDAPGVIGMCND 179
             +  S F RI+      GGD + +HNG GG S YG  F + S+A     H  PG + M N 
Sbjct:    58 FANSGFHRIIPNFMCQGGDFT-NHNGTGGKSIYGAKFEDESFAGKAGKHFGPGTLSMANA 116

Query:   180 NEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               +TN S F+I      W++G++V FG+V++GMNVV+A+  V    + S  K + I  CG
Sbjct:   117 GPNTNGSQFFICTARTQWLDGKHVVFGQVLEGMNVVKAVEGVG-SQSGSTTKAVKIDSCG 175


>gi|2959712 (AF052206) cyclophilin 1 [Chlamydomonas reinhardtii]
            Length = 172

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.4e-17, P = 2.4e-17
 Identities = 42/118 (35%), Positives = 66/118 (55%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L ++GSTF R++      GGD +R  NG GG S YG  FP+ ++   H  PGV+ M N  
Sbjct:    53 LHFKGSTFHRVIPNFMCQGGDFTRG-NGTGGESIYGEKFPDENFKHRHTGPGVLSMANAG 111

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDC 356
              +TN S F++     +W++G++V FG+V  GM+VV+ +        ++      I+DC
Sbjct:   112 PNTNGSQFFLCTVETAWLDGKHVVFGKVCKGMDVVKKVEGYGSSSGKTRAT-FAIADC 168


>pir||A53522 18.5k cyclophilin precursor - Toxoplasma gondii
            Length = 179

  Plus Strand HSPs:

 Score = 218 (76.7 bits), Expect = 3.1e-17, P = 3.1e-17
 Identities = 45/120 (37%), Positives = 70/120 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+    + GGD   +HNG GG+S YGR F + ++ + H+  GVI M N   +
Sbjct:    62 YKGSVFHRIIPDFMIQGGDFE-NHNGTGGHSIYGRRFDDENFDLKHER-GVISMANAGPN 119

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVI-DGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT     W++GR+V FG++  +    V+AI  +     + P K   I+D G++
Sbjct:   120 TNGSQFFITTVKTEWLDGRHVVFGKITTESWPTVQAIEALGGSGGR-PSKVAKITDIGLL 178

Query:   366 D 368
             +
Sbjct:   179 E 179


>gi|2828710 (AF043642) matrin cyclophilin [Rattus norvegicus]
            Length = 752

  Plus Strand HSPs:

 Score = 228 (80.3 bits), Expect = 3.5e-17, P = 3.5e-17
 Identities = 49/135 (36%), Positives = 72/135 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+   F R+++   V GGD S + NG GG S YG +F + S+A+ H+   ++ M N  
Sbjct:    58 LHYKSCLFHRVVKDFMVQGGDFS-EGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRG 116

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             +DTN S F+IT K    ++G +V FG+VI G  VV  I +        P  E+ I  CG 
Sbjct:   117 KDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCG- 175

Query:   363 IDLTDD*YEKRRERK 407
              +L      K+ E+K
Sbjct:   176 -ELVPKSKVKKEEKK 189


>sp|P14088|CYPH_ECHGR PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) >pir||A45000
            cyclophilin - tapeworm (Echinococcus granulosus) (fragment)
            >gi|158844 (J04664) antigen ORF (cyclophilin) [Echinococcus
            granulosus]
            Length = 161

  Plus Strand HSPs:

 Score = 217 (76.4 bits), Expect = 3.9e-17, P = 3.9e-17
 Identities = 44/117 (37%), Positives = 67/117 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +   NG GG S YG  F + ++   H  P ++ M N  ++
Sbjct:    45 YKGSKFHRIIPGFMCQGGDFTAG-NGTGGKSIYGSKFEDENFNHKHSKPMMLSMANAGKN 103

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+IT    SW++G++V FG V  G +VV+ +  V     ++  +E+ I+DCG
Sbjct:   104 TNGSQFFITTAVTSWLDGKHVVFGEVESGEDVVKDMEAVGSSSGKTS-QEVLITDCG 159


>gi|1117968 (U40763) CARS-Cyp [Homo sapiens] >gnl|PID|e268465 (X99717) SRcyp
            protein [Homo sapiens]
            Length = 754

  Plus Strand HSPs:

 Score = 227 (79.9 bits), Expect = 4.6e-17, P = 4.6e-17
 Identities = 49/135 (36%), Positives = 72/135 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+   F R+++   V GGD S + NG GG S YG +F + S+A+ H+   ++ M N  
Sbjct:    58 LHYKSCLFHRVVKDFMVQGGDFS-EGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRG 116

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             +DTN S F+IT K    ++G +V FG+VI G  VV  I +        P  E+ I  CG 
Sbjct:   117 KDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCG- 175

Query:   363 IDLTDD*YEKRRERK 407
              +L      K+ E+K
Sbjct:   176 -ELIPKSKVKKEEKK 189


>sp|P22011|CYPH_CANAL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) (CPH) >pir||CSCK
            peptidylprolyl isomerase (EC 5.2.1.8) - yeast (Candida albicans)
            >gi|170851 (M60628) peptidyl-prolyl cis-trans isomerase [Candida
            albicans]
            Length = 162

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 5.0e-17, P = 5.0e-17
 Identities = 42/117 (35%), Positives = 67/117 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R++    + GGD + + NG GG S YG  F + ++   HD PG++ M N   +
Sbjct:    46 YKGSIFHRVIPQFMLQGGDFT-NFNGTGGKSIYGTKFADENFVKRHDRPGLLSMANAGPN 104

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+IT     W++G++V FG V DG+++V+ I       + +  K+I I + G
Sbjct:   105 TNGSQFFITTVPCPWLDGKHVVFGEVTDGLDIVKKIESFG-SGSGATSKKIVIEESG 160


>pir||S54833 peptidylprolyl isomerase (EC 5.2.1.8) Cyp - kidney bean >gi|829119
            (X74403) cyclophilin [Phaseolus vulgaris]
            Length = 172

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 5.0e-17, P = 5.0e-17
 Identities = 40/117 (34%), Positives = 66/117 (56%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++GS F R++      GGD +   NG GG S YG  F + ++   H  PG++ M N    
Sbjct:    55 FKGSIFHRVIPNFMCQGGDFTAG-NGTGGESIYGAKFADENFVKKHTGPGILSMANAGPG 113

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+I      W++G++V FG+V++G++VV+ I  V     ++  + + I+DCG
Sbjct:   114 TNGSQFFICTTKTEWLDGKHVVFGQVVEGLDVVKDIEKVGSGSGKT-ARPVAIADCG 169


>gi|972781 (L46884) cyclophilin [Schistosoma mansoni]
           Length = 161

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 5.0e-17, P = 5.0e-17
 Identities = 44/117 (37%), Positives = 68/117 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +   +G GG S YG  F + ++   H+A   + M N   +
Sbjct:    46 YKGSVFHRIIPGFMCQGGDFTNG-DGTGGKSIYGNKFKDENFNHKHEAFS-LSMANAGPN 103

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN S F+IT    SW++G++V FG+V+ G++VV+ +  +     + P K+I I DCG
Sbjct:   104 TNGSQFFITTVPCSWLDGKHVVFGKVVSGIDVVKKMESLGSTSGK-PSKKIIIEDCG 159


>pir||S51497 peptidylprolyl isomerase (EC 5.2.1.8) A - cyclosporin fungus
            (SGC3) >prf||2113249A cyclophilin [Tolypocladium inflatum]
            Length = 180

  Plus Strand HSPs:

 Score = 216 (76.0 bits), Expect = 5.0e-17, P = 5.0e-17
 Identities = 41/97 (42%), Positives = 60/97 (61%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS+F RI+    + GGD +R  NG GG S YG  F + ++ + HD PG++ M N   +
Sbjct:    60 YEGSSFHRIIPEFMLQGGDFTRG-NGTGGKSIYGEKFADENFQLKHDRPGLLSMANAGPN 118

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAI 296
             TN S F++T    SW+NG +V FG V D   ++VV+A+
Sbjct:   119 TNGSQFFVTTVVTSWLNGHHVVFGEVADQESLDVVKAL 156


>pir||S71849 peptidylprolyl isomerase (EC 5.2.1.8) A precursor, mitochondrial -
            cyclosporin fungus (SGC3) >gi|642359 (Z48002) cyclophilin,
            mitochondrial form [Tolypocladium inflatum]
            Length = 227

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 6.4e-17, P = 6.4e-17
 Identities = 42/97 (43%), Positives = 60/97 (61%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS+F RI+    + GGD +R  NG GG S YG  F + +  + HD PG++ M N   +
Sbjct:   107 YEGSSFHRIIPEFMLQGGDFTRG-NGTGGKSIYGEKFADENGQLKHDRPGLLSMANAGPN 165

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAI 296
             TN S F++T    SW+NGR+V FG V D   ++VV+A+
Sbjct:   166 TNGSQFFVTTVVTSWLNGRHVVFGEVADQESLDVVKAL 203


>gi|642360 (Z48002) cyclophilin, cytosolic form [Tolypocladium inflatum]
           Length = 180

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 6.4e-17, P = 6.4e-17
 Identities = 42/97 (43%), Positives = 60/97 (61%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS+F RI+    + GGD +R  NG GG S YG  F + +  + HD PG++ M N   +
Sbjct:    60 YEGSSFHRIIPEFMLQGGDFTRG-NGTGGKSIYGEKFADENGQLKHDRPGLLSMANAGPN 118

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAI 296
             TN S F++T    SW+NGR+V FG V D   ++VV+A+
Sbjct:   119 TNGSQFFVTTVVTSWLNGRHVVFGEVADQESLDVVKAL 156


>gi|1532214 (U68270) cyclophilin A [Trypanosoma brucei brucei]
            Length = 177

  Plus Strand HSPs:

 Score = 214 (75.3 bits), Expect = 8.1e-17, P = 8.1e-17
 Identities = 47/118 (39%), Positives = 65/118 (55%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIP---HDAPGVIGMCND 179
             Y GS F RI+      GGD +R HNG  G S YG  FP+ S+A     H   G + M N 
Sbjct:    58 YAGSGFHRIIPQFMCQGGDFTR-HNGTCGKSIYGEKFPDESFAGKAGKHFGAGTLSMANA 116

Query:   180 NEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               +TN S F+I      W++G++V FG+V++GM+VV+A+  V      S  K + I  CG
Sbjct:   117 GPNTNGSQFFICTAPTQWLDGKHVVFGQVLEGMDVVKAMEAVG-SQGGSTSKPVKIDSCG 175


>gnl|PID|e316521 (Y13117) peptidylprolyl isomerase [Paramecium primaurelia]
            Length = 162

  Plus Strand HSPs:

 Score = 214 (75.3 bits), Expect = 8.1e-17, P = 8.1e-17
 Identities = 41/119 (34%), Positives = 64/119 (53%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R++      GGD + + NG GG S YG  F + ++ + H  P ++ M N   +
Sbjct:    46 YKGSVFHRVITDFMAQGGDFT-NFNGTGGKSIYGEKFADENFKLKHTKPALLSMANAGPN 104

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT     W++G++V FG V+DG + +E +   +      P   I I D GV+
Sbjct:   105 TNGSQFFITFVPCPWLDGKHVVFGEVVDGFDTLE-LFKKNSSQQGKPKTTIKIVDSGVV 162


>sp|P14832|CYPH_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN) (CYCLOSPORIN A-BINDING PROTEIN) (CPH) (PPI-II)
            >pir||CSBY peptidylprolyl isomerase (EC 5.2.1.8), cytosolic - yeast
            (Saccharomyces cerevisiae) >gi|3618 (X17505) cyclophilin (AA 1-162)
            [Saccharomyces cerevisiae] >gi|171314 (M30513) cyclophilin
            [Saccharomyces cerevisiae] >gi|899403 (Z50046) Cpr1p [Saccharomyces
            cerevisiae]
            Length = 162

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 1.0e-16, P = 1.0e-16
 Identities = 38/99 (38%), Positives = 59/99 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS F R++    + GGD +   NG GG S YG  FP+ ++   HD PG++ M N   +
Sbjct:    46 YAGSPFHRVIPDFMLQGGDFTAG-NGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPN 104

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDV 305
             TN S F+IT     W++G++V FG V+DG ++V+ +  +
Sbjct:   105 TNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESL 143


>sp|P52010|CYP2_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 2 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-2) >gi|1109674 (U34354) cyclophilin isoform 2 (cyp-2)
            [Caenorhabditis elegans]
            Length = 171

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 1.0e-16, P = 1.0e-16
 Identities = 44/119 (36%), Positives = 69/119 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNG-GYSCYGRYFPNXSYAIPHDAPGVIGMCND 179
             L ++GS F RI+    + GGD +    GNG G S +G  F + ++   H  PGV+ M N 
Sbjct:    53 LHFKGSKFHRIIPEFMIQGGDFTE---GNGTGESIHGEKFDDENFKEKHTGPGVLSMANC 109

Query:   180 NEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
               +TN S F++     +W++G++V FG+VI+GM+VV+AI       + +P     I+DCG
Sbjct:   110 GANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKG-SEDGAPSAPCVIADCG 168


>gi|2190533 (U30265) similar to Schistosoma japonicum cyclophylin, encoded by
            GenBank Accession Number M93420;  Method: conceptual translation
            supplied by author
            Length = 273

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 1.0e-16, P = 1.0e-16
 Identities = 44/117 (37%), Positives = 65/117 (55%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y    F R++      GGD  +  +G GG S YGR F + ++ + H+  GV+ M N   +
Sbjct:   156 YHNCCFHRVIPQFMCQGGDFVKG-DGTGGKSIYGRKFDDENFQLRHEGFGVLSMANSGPN 214

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKE-ITISDCG 359
             TN S F+I      W++G++V FGRV+DG NVV+ +  V  K  +   KE + IS CG
Sbjct:   215 TNGSQFFICTTKCDWLDGKHVVFGRVVDGQNVVKKMESVGSKSGK--VKEPVIISRCG 270


>gi|2828151 (AF042386) cyclophilin-33B [Homo sapiens]
            Length = 296

  Plus Strand HSPs:

 Score = 213 (75.0 bits), Expect = 1.0e-16, P = 1.0e-16
 Identities = 36/96 (37%), Positives = 60/96 (62%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++GS+F RI+      GGD + +HNG GG S YG+ F + ++ + H  PG++ M N   +
Sbjct:   184 FKGSSFHRIIPQFMCQGGDFT-NHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPN 242

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAI 296
             TN S F++T     W++G++V FG V +G++V+  I
Sbjct:   243 TNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQI 278


>gi|436957 (U04633) 18 kDa cyclophilin [Toxoplasma gondii]
           Length = 179

  Plus Strand HSPs:

 Score = 212 (74.6 bits), Expect = 1.3e-16, P = 1.3e-16
 Identities = 44/120 (36%), Positives = 69/120 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+    + GGD   +HNG GG+S YGR F + ++ + H+  GVI M N   +
Sbjct:    62 YKGSVFHRIIPDFMIQGGDFE-NHNGTGGHSIYGRRFDDENFDLKHER-GVISMANAGPN 119

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVI-DGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT     W++ R+V FG++  +    V+AI  +     + P K   I+D G++
Sbjct:   120 TNGSQFFITTVKTEWLDARHVVFGKITTESWPTVQAIEALGGSGGR-PSKVAKITDIGLL 178

Query:   366 D 368
             +
Sbjct:   179 E 179


>prf||1713247A cyclophilin [Dictyostelium discoideum]
            Length = 179

  Plus Strand HSPs:

 Score = 212 (74.6 bits), Expect = 1.3e-16, P = 1.3e-16
 Identities = 40/119 (33%), Positives = 68/119 (57%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L+Y+GS+F R++      GGD +   NG GG S YG  F + ++ + H   G + M N  
Sbjct:    61 LSYKGSSFHRVITNFMCQGGDFTMG-NGTGGESIYGNKFADENFKLKHFGQGTLSMANAG 119

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+I +    W++G++V FG V +GM+VV+ +     +  ++  K + I++CG
Sbjct:   120 ANTNGSQFFICVAPTDWLDGKHVVFGFVTEGMDVVKKMEAAGSQSGKTT-KPVVIANCG 177


>pir||B53522 20k cyclophilin - Toxoplasma gondii (fragment) >gi|436959 (U04634)
            20 kDa cyclophilin precursor [Toxoplasma gondii]
            Length = 347

  Plus Strand HSPs:

 Score = 214 (75.3 bits), Expect = 1.4e-16, P = 1.4e-16
 Identities = 43/119 (36%), Positives = 66/119 (55%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+G  F RI+      GGD +R  NG GG S YG  F + +++  H  P ++ M N  
Sbjct:   228 LYYKGCPFHRIIPQFMCQGGDFTR-MNGTGGESIYGEKFADENFSYKHSEPFLLSMANAG 286

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+IT     W++G++V FG+V+ G  VV+ + + + + N  P   + IS CG
Sbjct:   287 PNTNGSQFFITTVPCPWLDGKHVVFGKVVAGQEVVKMM-EAEGRSNGQPKCAVEISSCG 344


>sp|Q27450|CYP1_BRUMA PEPTIDYLPROLYL ISOMERASE CYP-1 (PEPTIDYLPROLYL CIS-TRANS
            ISOMERASE) (CYCLOPHILIN) (PPIASE) >gi|984562 (L37292)
            peptidylprolyl isomerase [Brugia malayi] >prf||2121248A cyclophilin
            [Brugia malayi]
            Length = 843

  Plus Strand HSPs:

 Score = 223 (78.5 bits), Expect = 1.5e-16, P = 1.5e-16
 Identities = 42/119 (35%), Positives = 64/119 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+GSTF R+++   + GGD ++  +G GG S YG  F +  + + HD P V+ M N  
Sbjct:    57 LHYKGSTFHRVIKNFMIQGGDFTKG-DGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKG 115

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
              +TN S F+IT      +N  +V FG+V+ G  VV  I  +       P  ++ I +CG
Sbjct:   116 PNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCG 174


>sp|P53691|CYP6_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERASE CYP6 (PPIASE)
            (ROTAMASE) >pir||S48567 hypothetical protein YLR216c - yeast
            (Saccharomyces cerevisiae) >gi|544520 (U14913) Cpr6p: cyclophilin
            related to the mammalian CyP-40 [Saccharomyces cerevisiae]
            >gi|1515348 (U48867) Cpr6p [Saccharomyces cerevisiae]
            Length = 371

  Plus Strand HSPs:

 Score = 215 (75.7 bits), Expect = 1.5e-16, P = 1.5e-16
 Identities = 44/126 (34%), Positives = 69/126 (54%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L+Y+GS F R+++      GD + + NG GG S Y   F + ++ + HD P ++ M N  
Sbjct:    55 LSYKGSIFHRVIKDFMCQFGDFT-NFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAG 113

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDV-KHNQSPCKEITISDCG 359
              +TN S  +IT      ++G++V FG VI G  +V  I +    + N  P +++ I DCG
Sbjct:   114 PNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCG 173

Query:   360 VIDLTDD 380
             V  L DD
Sbjct:   174 V--LPDD 178


>gi|2655157 (AF025803) cyclophilin 1 [Drosophila pseudoobscura]
            Length = 157

  Plus Strand HSPs:

 Score = 211 (74.3 bits), Expect = 1.7e-16, P = 1.7e-16
 Identities = 35/96 (36%), Positives = 59/96 (61%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R++      GGD + +HNG GG S YG  FP+ ++ + H   G++ M N   +
Sbjct:    49 YKGSIFHRVIPNFMCQGGDFT-NHNGTGGKSIYGNKFPDENFLLKHTGTGILSMANAGAN 107

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAI 296
             TN S F+I     +W++ ++V FG V++G+++V+ I
Sbjct:   108 TNGSQFFICTVKTAWLDNKHVVFGEVVEGLDIVKKI 143


>gi|1245402 (U50388) cyclophilin A [Schistosoma mansoni]
            Length = 172

  Plus Strand HSPs:

 Score = 209 (73.6 bits), Expect = 2.7e-16, P = 2.7e-16
 Identities = 44/117 (37%), Positives = 64/117 (54%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y    F R++      GGD  +  +G GG S YGR F + +  + H+  GV+ M N   +
Sbjct:    55 YHNCCFHRVIPQFMCQGGDFVKG-DGTGGKSIYGRKFDDENIQLRHEGFGVLSMANSGPN 113

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKE-ITISDCG 359
             TN S F+I      W++G++V FGRV+DG NVV+ +  V  K  +   KE + IS CG
Sbjct:   114 TNGSQFFICTTKCDWLDGKHVVFGRVVDGQNVVKKMESVGSKSGK--VKEPVIISRCG 169


>pir||S52760 peptidylprolyl isomerase (EC 5.2.1.8) - Plasmodium falciparum
            >pir||S68357 peptidylprolyl isomerase (EC 5.2.1.8) precursor -
            Plasmodium falciparum >gi|758222 (X85956) peptidylprolyl isomerase
            [Plasmodium falciparum]
            Length = 195

  Plus Strand HSPs:

 Score = 208 (73.2 bits), Expect = 3.5e-16, P = 3.5e-16
 Identities = 41/123 (33%), Positives = 67/123 (54%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y  S F RI+      GGDI+ + NG GG S YG+ F + ++ + H   G++ M N  
Sbjct:    75 LHYTNSIFHRIIPNFMAQGGDIT-NFNGTGGLSIYGKKFEDENFKVNHSKRGLLSMANAG 133

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             ++TN S F+I      W++GR+V FG V++G++ +  I  V     + P K + + + G 
Sbjct:   134 KNTNGSQFFILFIPTPWLDGRHVVFGEVVEGLDKLVHIEAVGTDSGE-PLKRVLVKESGE 192

Query:   363 IDL 371
             + L
Sbjct:   193 LPL 195


>gi|1000521 (U10322) cyclophilin [Plasmodium falciparum]
            Length = 210

  Plus Strand HSPs:

 Score = 208 (73.2 bits), Expect = 3.5e-16, P = 3.5e-16
 Identities = 41/119 (34%), Positives = 69/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ +TF R+++   + GGD   ++NG+G  S YG +F + ++ I HD  G++ M N   +
Sbjct:    90 YKNTTFHRVIKDFMIQGGDFV-NYNGSGCISIYGEHFDDENFDIKHDKEGLLSMANTGPN 148

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVV--EAIHDVDVK-HNQSPCKEITISDCG 359
             TN   F+I  K   W++G+ V FGR+ID  +++  + I +V V  +   P   I I +CG
Sbjct:   149 TNGCQFFIITKKCEWLDGKNVVFGRIIDNDSLILLKKIENVSVTPYIYKPKIAINIVECG 208


>sp|P48820|CYPR_BOVIN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, RETINAL-SPECIFIC
            ISOZYME >gi|1004092 (L41692) retina-specific cyclophilin [Bos
            taurus]
            Length = 252

  Plus Strand HSPs:

 Score = 208 (73.2 bits), Expect = 3.5e-16, P = 3.5e-16
 Identities = 43/119 (36%), Positives = 68/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++ S F R++      GGDI++ H+G GG S YG  F + ++ + H  PG++ M N  +D
Sbjct:   136 FKSSIFHRVIPDFVCQGGDITK-HDGTGGRSIYGDKFEDENFDVKHTGPGLLSMANRGQD 194

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT+K    ++ ++V FG V DGM+ V+ I         S  + I I++CG I
Sbjct:   195 TNNSQFFITLKKAERLDFKHVVFGFVKDGMDTVKKIESFGSPKG-SVSRRIIITECGQI 252


>sp|P52018|CYPB_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 11 (PPIASE)
            (ROTAMASE) (CYCLOPHILIN-11) >gi|1041370 (Z66499) T01B7.4
            [Caenorhabditis elegans] >gi|1155227 (U34955) cyclophilin isoform
            11 (CYP-11) [Caenorhabditis elegans]
            Length = 183

  Plus Strand HSPs:

 Score = 208 (73.2 bits), Expect = 3.5e-16, P = 3.5e-16
 Identities = 40/117 (34%), Positives = 61/117 (52%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+  TF R+++   + GGD     +G G  S YG  F + ++ + H  PG++ M N   D
Sbjct:    66 YKNCTFHRVIKDFMIQGGDFCNG-DGTGLMSIYGSKFRDENFELKHIGPGMLSMANAGSD 124

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             TN   F+IT     +++ ++V FGRV+DGM  V  I +V    N  P   I +  CG
Sbjct:   125 TNGCQFFITCAKTDFLDNKHVVFGRVLDGMLTVRKIENVPTGANNKPKLPIVVVQCG 181


>gnl|PID|e280557 (Y09143) cyclophilin [Lumbricus rubellus]
            Length = 223

  Plus Strand HSPs:

 Score = 205 (72.2 bits), Expect = 7.3e-16, P = 7.3e-16
 Identities = 42/126 (33%), Positives = 68/126 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDN 182
             L Y+ S F R +    + GGD +   NG GG S YG+YF + ++ + H   G +GM N  
Sbjct:    84 LAYKSSIFHRTINNFMIQGGDFT-SQNGYGGLSIYGKYFNDENFKLCHHGFGWLGMANCG 142

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQS----PCKEITIS 350
              +TN + +YI+     W++G +  FG V++G  VV AI        ++    P   + I+
Sbjct:   143 PNTNGAQYYISTVDTPWLDGLHNIFGIVLEGAFVVRAIEKNPTSKGENIKDRPILAVVIT 202

Query:   351 DCGVIDL 371
             DCG+++L
Sbjct:   203 DCGMLEL 209


>sp|Q06118|CYPH_STRCH PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE) (ROTAMASE)
            (CYCLOPHILIN HOMOLOG) >pir||S28020 peptidylprolyl isomerase (EC
            5.2.1.8) - Streptomyces chrysomallus >gi|46836 (Z15137)
            cyclosporin-A binding protein [Streptomyces chrysomallus]
            Length = 165

  Plus Strand HSPs:

 Score = 203 (71.5 bits), Expect = 1.2e-15, P = 1.2e-15
 Identities = 41/119 (34%), Positives = 68/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y GS+F R++    + GGD +R  +G GG S YG  F + ++ + HD  G++ M N  ++
Sbjct:    47 YAGSSFHRVITDFMLQGGDFTRG-DGTGGKSIYGEKFADENFQLKHDRVGLLSMANAGKN 105

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             TN S F+IT     W++G++V FG V D   M +V  I  +     ++  K +TI++ G 
Sbjct:   106 TNGSQFFITTVLTPWLDGKHVVFGEVADDDSMALVRKIEALGSSSGRTSAK-VTIAESGA 164

Query:   363 I 365
             +
Sbjct:   165 L 165


>gi|2655159 (AF025804) cyclophilin 1 [Drosophila subobscura]
            Length = 157

  Plus Strand HSPs:

 Score = 203 (71.5 bits), Expect = 1.2e-15, P = 1.2e-15
 Identities = 34/96 (35%), Positives = 58/96 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F R++      GGD + +HNG GG S YG  F + ++ + H   G++ M N   +
Sbjct:    49 YKGSIFHRVIPNFMCQGGDFT-NHNGTGGKSIYGNKFADENFQLKHTGTGILSMANAGAN 107

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAI 296
             TN S F+I     +W++ ++V FG V++G+++V+ I
Sbjct:   108 TNGSQFFICTVKTAWLDNKHVVFGEVVEGLDIVKKI 143


>sp|P49792|N358_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP358 (NUCLEOPORIN NUP358)
            (358 KD NUCLEOPORIN) (P270) >pir||A57545 nucleoporin Nup358 - human
            >gi|857368 (L41840) nucleoporin [Homo sapiens] >prf||2115329A
            nucleoprotein Nup358 [Homo sapiens]
            Length = 3224

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.1e-15, P = 2.1e-15
 Identities = 44/119 (36%), Positives = 69/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++ S F R++      GGDI++ H+G GG S YG  F + ++ + H  PG++ M N  ++
Sbjct:  3108 FKNSIFHRVIPDFVCQGGDITK-HDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQN 3166

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F IT+K    ++ ++V FG V DGM+ V+ I         S C+ ITI++CG I
Sbjct:  3167 TNNSQFVITLKKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKG-SVCRRITITECGQI 3224


>pir||S58884 Ran-binding protein 2 - human >gnl|PID|d1008244 (D42063) RanBP2
            (Ran-binding protein 2) [Homo sapiens]
            Length = 3224

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.1e-15, P = 2.1e-15
 Identities = 44/119 (36%), Positives = 69/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++ S F R++      GGDI++ H+G GG S YG  F + ++ + H  PG++ M N  ++
Sbjct:  3108 FKNSIFHRVIPDFVCQGGDITK-HDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQN 3166

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F IT+K    ++ ++V FG V DGM+ V+ I         S C+ ITI++CG I
Sbjct:  3167 TNNSQFVITLKKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKG-SVCRRITITECGQI 3224


>prf||2115390A Ran/TC4-binding nucleopore protein [Homo sapiens]
            Length = 3224

  Plus Strand HSPs:

 Score = 219 (77.1 bits), Expect = 2.1e-15, P = 2.1e-15
 Identities = 44/119 (36%), Positives = 69/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++ S F R++      GGDI++ H+G GG S YG  F + ++ + H  PG++ M N  ++
Sbjct:  3108 FKNSIFHRVIPDFVCQGGDITK-HDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQN 3166

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F IT+K    ++ ++V FG V DGM+ V+ I         S C+ ITI++CG I
Sbjct:  3167 TNNSQFVITLKKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKG-SVCRRITITECGQI 3224


>gi|1928939 (U92087) stress responsive cyclophilin [Solanum commersonii]
            Length = 172

  Plus Strand HSPs:

 Score = 200 (70.4 bits), Expect = 2.5e-15, P = 2.5e-15
 Identities = 40/119 (33%), Positives = 64/119 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGY-SCYGRYFPNXSYAIPHDAPGVIGMCND 179
             L Y+GSTF R++ G    GGD +   NG G   S YG  F + ++   H   G++ M N 
Sbjct:    53 LHYKGSTFHRVIPGFMCQGGDFTAG-NGTGEEKSIYGAKFKDENFVKKHTGAGILSMANA 111

Query:   180 NEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
                TN S F I      W++G++V FG+V++G++V++    V     +   K + ++DCG
Sbjct:   112 GPGTNGSQFLICSAKTEWLDGKHVVFGQVVEGLDVIKKAEAVGSSSGRCS-KPVVVADCG 170


>gi|2988417 (U97573) peptidyl-prolyl cis-trans isomerase [Treponema pallidum]
            >gi|3323269 (AE001263) peptidyl-prolyl cis-trans isomerase,
            cyclophilin-binding (cyp) [Treponema pallidum]
            Length = 215

  Plus Strand HSPs:

 Score = 198 (69.7 bits), Expect = 4.0e-15, P = 4.0e-15
 Identities = 41/96 (42%), Positives = 58/96 (60%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNX-SYAIPHDAPGVIGMCNDNE 185
             Y+G TF R+++   + GGD     NG GG    G  FP+    A+ HD+PGV+ M N   
Sbjct:    84 YQGLTFHRVIKDFMIQGGD--PQGNGTGGP---GYQFPDECDPALRHDSPGVLSMANAGP 138

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAI 296
              TN S F+IT  A  W++G++  FG+V++GM VV AI
Sbjct:   139 GTNGSQFFITHVATPWLDGKHTVFGKVVEGMEVVHAI 175


>gi|1764137 (U81792) PIG28 [Uromyces fabae]
            Length = 163

  Plus Strand HSPs:

 Score = 196 (69.0 bits), Expect = 6.6e-15, P = 6.6e-15
 Identities = 39/119 (32%), Positives = 68/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++ S F R++    + GGD +   NG GG S YG+ F + ++   H   G++ M N   +
Sbjct:    46 FKHSIFHRVIPDFMIQGGDFTNG-NGTGGESIYGKKFEDENFQKKHVERGMLSMANAGPN 104

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMN-VVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT+    W++G++V FG+VI+G + VV+A+     +  ++    + I DCG +
Sbjct:   105 TNGSQFFITVTKTPWLDGKHVVFGKVIEGYDQVVKAMEKTGSQSGKTS-SVLKIEDCGTL 163


>gi|1004090 (L41691) spliced variant with Ran-binding and cyclophilin domains
            [Bos taurus]
            Length = 1085

  Plus Strand HSPs:

 Score = 208 (73.2 bits), Expect = 8.5e-15, P = 8.5e-15
 Identities = 43/119 (36%), Positives = 68/119 (57%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++ S F R++      GGDI++ H+G GG S YG  F + ++ + H  PG++ M N  +D
Sbjct:   969 FKSSIFHRVIPDFVCQGGDITK-HDGTGGRSIYGDKFEDENFDVKHTGPGLLSMANRGQD 1027

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             TN S F+IT+K    ++ ++V FG V DGM+ V+ I         S  + I I++CG I
Sbjct:  1028 TNNSQFFITLKKAERLDFKHVVFGFVKDGMDTVKKIESFGSPKG-SVSRRIIITECGQI 1085


>pir||S52758 adenosine kinase (EC 2.7.1.20) - Leishmania donovani
            Length = 366

  Plus Strand HSPs:

 Score = 195 (68.6 bits), Expect = 2.5e-14, P = 2.5e-14
 Identities = 38/107 (35%), Positives = 58/107 (54%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+ S F R++    + GGD + + +G GG S YG  F + +  + H   G + M N   +
Sbjct:   210 YKDSIFHRVIPNFMIQGGDFT-NFDGTGGKSIYGEKFADENLKVKHFV-GALSMANAGPN 267

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSP 329
             TN S F+IT     W++GR+V FG+V+DGM+VV  I       +  P
Sbjct:   268 TNGSQFFITTAPTPWLDGRHVVFGKVLDGMDVVVRIEKTKTNSHDQP 314


>gi|972047 (F14571) cyclophilin A [Sus scrofa]
           Length = 127

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 5.9e-14, P = 5.9e-14
 Identities = 33/81 (40%), Positives = 48/81 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y+GS F RI+ G    GGD +R HNG GG S YG  F + ++ + H  PG++ M N   +
Sbjct:    48 YKGSCFHRIIPGFMXQGGDFTR-HNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPN 106

Query:   189 TNASSFYITMKAMSWMNGRYV 251
             TN S F+I      W++G++V
Sbjct:   107 TNGSQFFICTAKTEWLDGKHV 127


>gi|1314810 (U55771) cyclophilin homolog Ta cyp [Theileria annulata]
            Length = 196

  Plus Strand HSPs:

 Score = 187 (65.8 bits), Expect = 5.9e-14, P = 5.9e-14
 Identities = 42/119 (35%), Positives = 60/119 (50%), Frame = +3

Query:     6 TYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNE 185
             +Y  S F R++    V  GDI    NG G  S YG  F + ++   H   GVI M N   
Sbjct:    78 SYVDSFFHRVIPNFMVQAGDIVNG-NGTGSISIYGDMFEDENFTAKHKK-GVIAMANRGP 135

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV 362
             +TN S FYIT  A +W++GR+V FG +++G   ++AI        + P  +  I  C V
Sbjct:   136 NTNGSQFYITTVATNWLDGRHVVFGELLEGEYTLQAIEATGTDSGK-PSVQTVIKSCKV 193


>gnl|PID|d1008136 (D38552) The ha1539 protein is related to cyclophilin. [Homo
            sapiens]
            Length = 645

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 8.8e-13, P = 8.8e-13
 Identities = 40/113 (35%), Positives = 63/113 (55%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y G TF RI++G  +  GD +    G GG S +G  F +  ++ + HD P  + M N   
Sbjct:   527 YNGHTFHRIIKGFMIQTGDPTG--TGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGS 584

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVK-HNQSPCKEITI 347
             +TN S F+IT+    W++ ++  FGRV  GM VV+ I +V V      P ++++I
Sbjct:   585 NTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSI 639


>gi|1330343 (U58755) C34D4.12 gene product [Caenorhabditis elegans]
            Length = 169

  Plus Strand HSPs:

 Score = 173 (60.9 bits), Expect = 1.8e-12, P = 1.8e-12
 Identities = 39/113 (34%), Positives = 58/113 (51%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNX-SYAIPHDAPGVIGMCNDNE 185
             Y G+ F RI+    + GGD +    G GG S YG  F +     + H   G++ M N   
Sbjct:    46 YNGTIFHRIIADFMIQGGDPTG--TGRGGASIYGDKFSDEIDERLKHTGAGILSMANAGP 103

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITI 347
             +TN S F+IT+     ++G++  FGRV  GM V+  +  VD  ++  P  EI I
Sbjct:   104 NTNGSQFFITLAPTQHLDGKHTIFGRVAAGMKVIANMGRVDTDNHDRPKIEIRI 157


>sp|P52017|CYPA_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 10 (PPIASE)
            (ROTAMASE) (CYCLOPHILIN-10) >gi|733577 (U23453) similar to
            peptidyl-prolyl cis-trans isomerase (PPIASE) (CYCLOPHILIN)
            [Caenorhabditis elegans] >gi|1155225 (U34954) cyclophilin isoform
            10 [Caenorhabditis elegans]
            Length = 147

  Plus Strand HSPs:

 Score = 172 (60.5 bits), Expect = 2.3e-12, P = 2.3e-12
 Identities = 37/107 (34%), Positives = 58/107 (54%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSY-AIPHDAPGVIGMCNDNE 185
             Y G  F R ++   V  GD +  H+G GG S +G  F +    A+ HD+ G + M N+  
Sbjct:    37 YNGCIFHRNIKDFMVQTGDPT--HSGKGGESIWGGPFEDEFVSALKHDSRGCVSMANNGP 94

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSP 329
             D+N S F+IT    + ++ +Y  FG+VIDG + +E I  + V +   P
Sbjct:    95 DSNRSQFFITYAKQAHLDMKYTLFGKVIDGFDTLEEIETIKVDNKYRP 142


>gi|3057040 (AF000668) cyclophilin Dicyp-3 [Dirofilaria immitis]
            Length = 527

  Plus Strand HSPs:

 Score = 177 (62.3 bits), Expect = 5.8e-12, P = 5.8e-12
 Identities = 39/133 (29%), Positives = 69/133 (51%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNX-SYAIPHDAPGVIGMCNDNE 185
             Y  + F RI+R   + GGD +    G GG S +G+ F +       HD  GV+ M N   
Sbjct:   317 YNNTKFHRIIRNFMMQGGDPTG--TGKGGDSIWGKPFKDEFKSTFSHDRRGVLSMANQGT 374

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGV- 362
             DTN S F+IT ++ S+++G++  FG V+ G   +  I  ++   +  P  ++   +  + 
Sbjct:   375 DTNKSQFFITFRSCSYLDGKHTIFGHVVGGTGTLNTIEKIETDESGRPIVDVIFLNAEIF 434

Query:   363 IDLTDD*YEKRRERK 407
             +D  ++  EK  E++
Sbjct:   435 VDPFEE-AEKAVEKE 448


>sp|Q09928|YAL5_SCHPO PROBABLE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C21E11.05C
            >pir||S62590 hypothetical protein SPAC21E11.05c - fission yeast
            (Schizosaccharomyces pombe) >gi|1067221 (Z67999) peptidyl-prolyl
            cis-trans isomerase [Schizosaccharomyces pombe]
            Length = 471

  Plus Strand HSPs:

 Score = 176 (62.0 bits), Expect = 6.0e-12, P = 6.0e-12
 Identities = 44/133 (33%), Positives = 68/133 (51%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNX-SYAIPHDAPGVIGMCNDNE 185
             YR + F R +    + GGD S    G GG S +G+ F +     + HD  G+I M N  +
Sbjct:   267 YRNTIFHRNIARFMIQGGDPSG--TGRGGQSIWGKPFKDEFCNPLKHDDRGIISMANRGK 324

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             +TN S F+I       ++ ++  FGRV+ G+NV++A+  V    N  P   I + D  +I
Sbjct:   325 NTNGSQFFILYGPAKHLDNKHTIFGRVVGGLNVLDALEKVPTNSNDHPKLPIKLED--II 382

Query:   366 DLTDD*YE-KRRERK 407
                D   E K+ ER+
Sbjct:   383 IFVDPFEEWKKDERE 397


>sp|P87051|YDJ3_SCHPO PROBABLE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C57A10.03
            >gnl|PID|e313994 (Z94864) unknown [Schizosaccharomyces pombe]
            Length = 155

  Plus Strand HSPs:

 Score = 168 (59.1 bits), Expect = 6.1e-12, P = 6.1e-12
 Identities = 34/113 (30%), Positives = 61/113 (53%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y G  F R++    + GGD +    G GG S YG  F +  ++ + H   G++ M N   
Sbjct:    38 YDGVIFHRVIPDFVIQGGDPTG--TGRGGTSIYGDKFDDEIHSDLHHTGAGILSMANAGP 95

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITI 347
             +TN+S F+IT+    W++G++  FGRV+ G++V + +  +    +  P + + I
Sbjct:    96 NTNSSQFFITLAPTPWLDGKHTIFGRVVSGLSVCKRMGLIRTDSSDRPIEPLKI 149


>sp|P47103|CYP7_YEAST PEPTIDYL-PROLYL CIS-TRANS ISOMERASE CYP7 (PPIASE)
            (ROTAMASE) >pir||S57050 hypothetical protein YJR032w - yeast
            (Saccharomyces cerevisiae) >gi|1015677 (Z49532) ORF YJR032w
            [Saccharomyces cerevisiae] >gi|1129166 (X87297) J1585 gene product
            [Saccharomyces cerevisiae]
            Length = 393

  Plus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 1.9e-11, Sum P(2) = 1.9e-11
 Identities = 33/91 (36%), Positives = 50/91 (54%), Frame = +3

Query:   102 CYGRYFPNXSYAIPHDAPGVIGMCN-DNEDTNASSFYITMKAMSWMNGRYVAFGRVIDGM 278
             CYG  F + +       P  +GM N  + +TN S F+IT  A   +NG++  FG+V+ G 
Sbjct:   111 CYGN-FEDENLG-EFVEPFTLGMANLGSPNTNNSQFFITTYAAPHLNGKHSIFGQVVHGK 168

Query:   279 NVVEAIHDVDVKHNQSPCKEITISDCGVIDLT 374
             +VV  I +  V  +  P  ++ ISDCGV + T
Sbjct:   169 SVVRTIENCRVDSDGVPESDVRISDCGVWEKT 200

 Score = 55 (19.4 bits), Expect = 1.9e-11, Sum P(2) = 1.9e-11
 Identities = 14/43 (32%), Positives = 23/43 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDI----SRDHN----GNGGYSCY 107
             L+Y+G+ F R+++   +  GDI     +D +    G GG S Y
Sbjct:    55 LSYKGNGFHRVVKNFMIQAGDIVFGTQKDSSSSSVGKGGCSIY 97


>gi|1515350 (U48868) Cpr7p [Saccharomyces cerevisiae]
            Length = 393

  Plus Strand HSPs:

 Score = 136 (47.9 bits), Expect = 1.9e-11, Sum P(2) = 1.9e-11
 Identities = 33/91 (36%), Positives = 50/91 (54%), Frame = +3

Query:   102 CYGRYFPNXSYAIPHDAPGVIGMCN-DNEDTNASSFYITMKAMSWMNGRYVAFGRVIDGM 278
             CYG  F + +       P  +GM N  + +TN S F+IT  A   +NG++  FG+V+ G 
Sbjct:   111 CYGN-FEDENLG-EFVEPFTLGMANLGSPNTNNSQFFITTYAAPHLNGKHSIFGQVVHGK 168

Query:   279 NVVEAIHDVDVKHNQSPCKEITISDCGVIDLT 374
             +VV  I +  V  +  P  ++ ISDCGV + T
Sbjct:   169 SVVRTIENCRVDSDGVPESDVRISDCGVWEKT 200

 Score = 55 (19.4 bits), Expect = 1.9e-11, Sum P(2) = 1.9e-11
 Identities = 14/43 (32%), Positives = 23/43 (53%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDI----SRDHN----GNGGYSCY 107
             L+Y+G+ F R+++   +  GDI     +D +    G GG S Y
Sbjct:    55 LSYKGNGFHRVVKNFMIQAGDIVFGTQKDSSSSSVGKGGCSIY 97


>gi|972055 (F14628) cyclophilin B [Sus scrofa]
           Length = 87

  Plus Strand HSPs:

 Score = 161 (56.7 bits), Expect = 3.4e-11, P = 3.4e-11
 Identities = 28/78 (35%), Positives = 45/78 (57%), Frame = +3

Query:   138 IPHDAPGVIGMCNDNEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKH 317
             + H  PG +   N  +DTN S  +IT     W++G++V FG+V++GM VV  +       
Sbjct:     1 LKHYGPGWVEHGNAGKDTNGSQSFITTVKTPWLDGKHVVFGKVLEGMEVVRKVESTKTDG 60

Query:   318 NQSPCKEITISDCGVIDL 371
                P K++TI+DCG I++
Sbjct:    61 RDKPLKDVTIADCGKIEV 78


>sp|P71578|CYPI_MYCTU PROBABLE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (PPIASE)
            (ROTAMASE) >gnl|PID|e266928 (Z80233) ppiA [Mycobacterium
            tuberculosis]
            Length = 182

  Plus Strand HSPs:

 Score = 156 (54.9 bits), Expect = 1.1e-10, P = 1.1e-10
 Identities = 37/113 (32%), Positives = 52/113 (46%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y G+ F R+++G  + GGD +    G  GY     + P   +    D P ++ M N    
Sbjct:    66 YDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPELQF----DKPYLLAMANAGPG 121

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDG--MNVVEAIHDVDVKHNQSPCKEITI 347
             TN S F+IT+     +N R+  FG VID     VVEAI       N  P   + I
Sbjct:   122 TNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVI 176


>gi|1199600 (U37220) cyclophilin-like protein [Homo sapiens]
            Length = 282

  Plus Strand HSPs:

 Score = 158 (55.6 bits), Expect = 1.4e-10, P = 1.4e-10
 Identities = 37/113 (32%), Positives = 66/113 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y G+ F R +R   + GGD +    G GG S +G+ F +     + H   G++ M N   
Sbjct:    78 YDGTIFHRSIRNFVIQGGDPTG--TGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGP 135

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDV--DVKHNQSPCKEITI 347
             ++N S F+IT ++ ++++ ++  FGRV+ G +V+ A+ +V  D K ++ P +EI I
Sbjct:   136 NSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDR-PKEEIRI 190


>gi|1199602 (U37221) cyclophilin-like protein [Homo sapiens]
            Length = 311

  Plus Strand HSPs:

 Score = 158 (55.6 bits), Expect = 2.0e-10, P = 2.0e-10
 Identities = 37/113 (32%), Positives = 66/113 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y G+ F R +R   + GGD +    G GG S +G+ F +     + H   G++ M N   
Sbjct:   107 YDGTIFHRSIRNFVIQGGDPTG--TGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGP 164

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDV--DVKHNQSPCKEITI 347
             ++N S F+IT ++ ++++ ++  FGRV+ G +V+ A+ +V  D K ++ P +EI I
Sbjct:   165 NSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDR-PKEEIRI 219


>pir||S64705 cyclophilin-like protein CyP-60 - human >gi|1199598 (U37219)
            cyclophilin-like protein CyP-60 [Homo sapiens] >prf||2207180A
            cyclophilin:ISOTYPE=CyP-60 [Homo sapiens]
            Length = 520

  Plus Strand HSPs:

 Score = 158 (55.6 bits), Expect = 6.4e-10, P = 6.4e-10
 Identities = 37/113 (32%), Positives = 66/113 (58%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y G+ F R +R   + GGD +    G GG S +G+ F +     + H   G++ M N   
Sbjct:   316 YDGTIFHRSIRNFVIQGGDPTG--TGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGP 373

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDV--DVKHNQSPCKEITI 347
             ++N S F+IT ++ ++++ ++  FGRV+ G +V+ A+ +V  D K ++ P +EI I
Sbjct:   374 NSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDR-PKEEIRI 428


>sp|P52012|CYP4_CAEEL PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 4 (PPIASE) (ROTAMASE)
            (CYCLOPHILIN-4)
            Length = 269

  Plus Strand HSPs:

 Score = 150 (52.8 bits), Expect = 9.6e-10, P = 9.6e-10
 Identities = 31/113 (27%), Positives = 59/113 (52%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y  + F R+++   + GGD +    G+GG S + + F +   +   HDA GV+ M N   
Sbjct:    62 YNNTKFHRLIKNFMLQGGDPTG--TGHGGESIWDKPFSDEFISGFSHDARGVLSMANKGS 119

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQS-PCKEITI 347
             +TN S F+IT +   +++ ++  FGR++ G + +  I  ++ +     P   + I
Sbjct:   120 NTNGSQFFITFRPCKYLDRKHTIFGRLVGGQDTLTTIEKLETEEGTDVPMVSVVI 174


>gi|1575509 (U64692) cyclophilin ScCypB [Streptomyces chrysomallus]
            Length = 175

  Plus Strand HSPs:

 Score = 145 (51.0 bits), Expect = 1.7e-09, P = 1.7e-09
 Identities = 32/113 (28%), Positives = 53/113 (46%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y G+ F R++ G  + GGD   +  G  GY     + P   +  P+    ++ M N    
Sbjct:    56 YDGTVFHRVISGFMIQGGDPLGNGTGGPGYKFADEFHPELGFTQPY----LLAMANAGPG 111

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAIHDVDVK-HNQSPCKEITI 347
             TN S F++T+   +W+ G++  FG V    G  VV+AI           P +++ I
Sbjct:   112 TNGSQFFLTVSPTAWLTGKHTIFGEVSGEAGRKVVDAIAATPTNPRTDRPLEDVVI 167


>gi|972057 (F14629) NK-tumor recognition protein [Sus scrofa]
           Length = 142

  Plus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 3.5e-09, P = 3.5e-09
 Identities = 29/98 (29%), Positives = 51/98 (52%), Frame = +3

Query:   117 FPNXSYAIPHDAPGVIGMCNDNEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAI 296
             F + ++ + HD   ++ M    + TN   F+IT K    ++G +V FG VI G  V+E I
Sbjct:     1 FKDETFXLKHDRAFLLXMAXRGKHTNGPQFFITTKPXPHLDGVHVVFGLVISGFEVIEQI 60

Query:   297 HDVDVKHNQSPCKEITISDCGVIDL--TDD*YEKRRER 404
              ++       P  ++ + DCGV+    T D +EK++ +
Sbjct:    61 ENLKTDAASRPYADVRVIDCGVLATKSTKDVFEKKKXK 98


>gi|2981639 (U36187) cyclophilin isoform 4 [Caenorhabditis elegans]
            Length = 523

  Plus Strand HSPs:

 Score = 150 (52.8 bits), Expect = 4.7e-09, P = 4.7e-09
 Identities = 31/113 (27%), Positives = 59/113 (52%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y  + F R+++   + GGD +    G+GG S + + F +   +   HDA GV+ M N   
Sbjct:   316 YNNTKFHRLIKNFMLQGGDPTG--TGHGGESIWDKPFSDEFISGFSHDARGVLSMANKGS 373

Query:   186 DTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQS-PCKEITI 347
             +TN S F+IT +   +++ ++  FGR++ G + +  I  ++ +     P   + I
Sbjct:   374 NTNGSQFFITFRPCKYLDRKHTIFGRLVGGQDTLTTIEKLETEEGTDVPMVSVVI 428


>gnl|PID|e236568 (X97255) cyclophilin [Digitalis lanata]
            Length = 62

  Plus Strand HSPs:

 Score = 134 (47.2 bits), Expect = 2.4e-08, P = 2.4e-08
 Identities = 25/58 (43%), Positives = 36/58 (62%), Frame = +3

Query:     3 LTYRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCN 176
             L Y+GS+F RI++G    GGD S+  NG GG S YG  F + ++ + H  PG++ M N
Sbjct:     4 LHYKGSSFHRIIKGFMAQGGDFSKG-NGTGGESIYGGKFADETFKLDHSEPGLLSMAN 60


>gi|2622445 (AE000897) peptidyl-prolyl cis-trans isomerase B [Methanobacterium
            thermoautotrophicum]
            Length = 141

  Plus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 4.0e-08, P = 4.0e-08
 Identities = 33/100 (33%), Positives = 48/100 (48%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             Y G TF R++    + GG    D  G  GY+      PN      H   G + M +   D
Sbjct:    38 YDGLTFHRVIPDFVIQGGCPVGDGTGGPGYTIKCEINPNR-----H-VKGALSMAHAGRD 91

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVD 308
             T  S F+IT+     ++G +  FG+V+ GM+VVE+I   D
Sbjct:    92 TGGSQFFITLSPQPHLDGVHTVFGKVVRGMDVVESIERGD 131


>gnl|PID|e1263915 (AL022104) peptidyl-prolyl cis-trans isomerase
            [Schizosaccharomyces pombe]
            Length = 463

  Plus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 3.4e-07, P = 3.4e-07
 Identities = 47/137 (34%), Positives = 67/137 (48%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGM-CNDN 182
             Y G+   R++    + GGD +    G GG S YG  F   ++  +     G++GM C +N
Sbjct:    49 YDGTIVHRVVPEFLIQGGDPTG--TGMGGESIYGEPFAVETHPRLRFIRRGLVGMACTEN 106

Query:   183 EDTNASSFYITMKAMSWMNGRYVAFGRVI-DGMNVVEAIHDVDVKHNQSPCKEITISDCG 359
             E  N S F+IT+      NG+   FGRV+ D +  V  I ++++  NQ P     I    
Sbjct:   107 EGNN-SQFFITLGPTPEWNGKQTLFGRVVGDTIYNVVRISELELDANQRPVFPPKIISTE 165

Query:   360 VID--LTDD*YEKRRERKGGRE 419
             VID   TD    K R  K  RE
Sbjct:   166 VIDNYFTDI---KPRSTKEERE 184


>gi|16994 (Z17785) peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana]
          Length = 53

  Plus Strand HSPs:

 Score = 107 (37.7 bits), Expect = 1.8e-05, P = 1.8e-05
 Identities = 20/53 (37%), Positives = 34/53 (64%), Frame = +3

Query:   207 YITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITISDCGVI 365
             +I  +  SW++G++V FG+V++G+NVV  I  V     ++  K + I+DCG I
Sbjct:     1 FICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTS-KPVVIADCGQI 52


>pir||CSRT31 protein P31 - rat >prf||1112143A protein P31 [Rattus norvegicus]
            Length = 121

  Plus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 2.3e-05, P = 2.3e-05
 Identities = 18/43 (41%), Positives = 29/43 (67%), Frame = +3

Query:   168 MCNDNEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAI 296
             M N   +TN S F+I      W++G++V FG+V +GM++VEA+
Sbjct:     1 MANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEAM 43


>gnl|PID|e1245738 (AL021411) peptidylprolyl isomerase [Streptomyces coelicolor]
            Length = 157

  Plus Strand HSPs:

 Score = 111 (39.1 bits), Expect = 2.5e-05, P = 2.5e-05
 Identities = 30/94 (31%), Positives = 45/94 (47%), Frame = +3

Query:    15 GSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNEDTN 194
             G+ F R + G  V GGD     +G+ GY       P+  +    + P  + M N   D+ 
Sbjct:    28 GTVFHRRVPGFVVRGGDRLGTGHGSAGYRIPDEIRPDQGF----EQPFPLAMANLGRDST 83

Query:   195 ASSFYITMKAMSWMNGRYVAFGRVID--GMNVVEAI 296
                F+IT+     +NG+Y  FG+V D    +VV AI
Sbjct:    84 GPQFFITLAPAPRLNGQYTIFGQVADERSQDVVRAI 119


>gi|602789 (Z46935) F59E10.2 [Caenorhabditis elegans]
           Length = 179

  Plus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 5.5e-05, P = 5.5e-05
 Identities = 20/69 (28%), Positives = 37/69 (53%), Frame = +3

Query:   144 HDAPGVIGMCNDNEDTNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQ 323
             HDA GV+ M N   +TN S F+IT +   +++ ++  FGR++ G + +  I  ++ +   
Sbjct:    16 HDARGVLSMANKGSNTNGSQFFITFRPCKYLDRKHTIFGRLVGGQDTLTTIEKLETEEGT 75

Query:   324 S-PCKEITI 347
               P   + I
Sbjct:    76 DVPMVSVVI 84


>gi|971608 (F14780) peptidyl-prolyl cis-trans isomerase [Sus scrofa]
           Length = 85

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.0013, P = 0.0013
 Identities = 19/37 (51%), Positives = 22/37 (59%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYF 119
             Y+GS F RI+ G    GG  +R HNG GG S YG  F
Sbjct:    45 YKGSCFHRIIPGFMCQGGAFTR-HNGTGGKSIYGEEF 80


>gi|2327017 (U82823) putative peptidyl-prolyl cis-trans isomerase
            [Saccharopolyspora erythraea]
            Length = 157

  Plus Strand HSPs:

 Score = 92 (32.4 bits), Expect = 0.031, P = 0.031
 Identities = 25/79 (31%), Positives = 37/79 (46%), Frame = +3

Query:    60 GDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNEDTNASSFYITMKAMSWMN 239
             GDI     G  GY    R+    + A  +   G + M N   DTN S F++     + + 
Sbjct:    55 GDIFSVEKGGPGY----RFADEVTGAETYPR-GTVAMGNQGPDTNGSQFFVVHSHAN-IK 108

Query:   240 GRYVAFGRVIDGMNVVEAI 296
               Y   GRV++GM V++AI
Sbjct:   109 PAYTVLGRVVEGMEVLDAI 127


>gnl|PID|e244458 (Z71698) ATPase subunit 6 [unidentified]
            Length = 82

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 0.15, Sum P(2) = 0.14
 Identities = 12/37 (32%), Positives = 20/37 (54%), Frame = -3

Query:   394 LFSYQSSVRSMTPQSLMVISLQGLWLCFTSTSWMAST 284
             LFS     RSM   S M + +  L++ +TS  W +++
Sbjct:     5 LFSSMDGARSMYYDSSMCLEMISLYVLYTSYMWNSTS 41

 Score = 49 (17.2 bits), Expect = 0.15, Sum P(2) = 0.14
 Identities = 6/28 (21%), Positives = 14/28 (50%), Frame = -2

Query:   158 ARRVVWNGVRXVWKISTIARVTPVSVVV 75
             +   VWN +  +W    I R   +++++
Sbjct:    41 SNNAVWNKISALWSAKNITRYNSMNIMI 68


>gi|1066992 (Z36949) F59E10.2 [Caenorhabditis elegans]
            Length = 378

  Plus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.32, P = 0.27
 Identities = 21/64 (32%), Positives = 34/64 (53%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYA-IPHDAPGVIGMCNDNE 185
             Y  + F R+++   + GGD +    G+GG S + + F +   +   HDA GV+ M N   
Sbjct:   316 YNNTKFHRLIKNFMLQGGDPTG--TGHGGESIWDKPFSDEFISGFSHDARGVLSMANKGS 373

Query:   186 DTNAS 200
             +TN S
Sbjct:   374 NTNGS 378


>gi|1399828 (U59235) unknown [Synechococcus PCC7942]
            Length = 376

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.56, P = 0.43
 Identities = 24/74 (32%), Positives = 40/74 (54%), Frame = +3

Query:   108 GRYFPNXSYAIPHDAPGVIGMC--NDNEDTNASSFY-------ITMKAMSWMNGRYVAFG 260
             GRY  N    +P  A G +G    +DN +  +S F+       +T   ++ ++GRY AFG
Sbjct:   285 GRYTDNP--VLPFSAFGTLGWARPSDNLNGGSSQFFFFLFEPELTPAGLNLIDGRYAAFG 342

Query:   261 RVIDGMNVVEAIHDVD 308
              ++DG +V+E +   D
Sbjct:   343 YLVDGKDVLEKLRPED 358


>gi|1911396 (U75930) unknown [Orgyia pseudotsugata nuclear polyhedrosis virus]
            Length = 76

  Minus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 0.97, P = 0.62
 Identities = 17/52 (32%), Positives = 25/52 (48%), Frame = -1

Query:   309 HLHRGWPPRHS--CRLSLGQTQRS-VHSS-TTWPSL*YKRTTHSCPRCRCTS 166
             HL+  WPP H   C        R  +HS+ +T+  L Y  + H C R + T+
Sbjct:    23 HLYTRWPPHHQLFCTAKKHAFARGPIHSTNSTFRRLFYINSLHRCIRSKYTT 74


>gnl|PID|e1301253 (AJ006854) gamma-glutamyltransferase 1 [Homo sapiens]
            Length = 72

  Minus Strand HSPs:

 Score = 63 (22.2 bits), Expect = 2.1, P = 0.88
 Identities = 17/38 (44%), Positives = 20/38 (52%), Frame = -1

Query:   333 CRGFGCVLHLHRGWP-PRHSCRLSLGQTQRSVHSSTT--WP 220
             C    C  H HRGWP P H   L    T++ + SST   WP
Sbjct:    19 CGAHECPQHGHRGWPLPHH---LQQHHTEK-LRSSTPARWP 55


>gnl|PID|d1010901 (D64001) hypothetical protein [Synechocystis sp.]
            Length = 402

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 2.4, P = 0.91
 Identities = 23/74 (31%), Positives = 36/74 (48%), Frame = +3

Query:   108 GRYFPNXSYAIPHDAPGVIGMCNDNEDTN--ASSFY-------ITMKAMSWMNGRYVAFG 260
             G Y P    A+P +A G I +     + N  +S F+       +T    + M+GRY  FG
Sbjct:   310 GMYLPEL--ALPFNAYGAIALARPETEPNGGSSQFFFFKFDTELTPPGFNLMDGRYSVFG 367

Query:   261 RVIDGMNVVEAIHDVD 308
              V+DG   +E + + D
Sbjct:   368 YVVDGKETLEQLSEGD 383


>gi|4517 (X02156) URF 2 [Saccharomyces cerevisiae]
         Length = 71

  Minus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 2.7, P = 0.93
 Identities = 12/20 (60%), Positives = 15/20 (75%), Frame = -3

Query:   463 KRNKERKRGIKDGSYSLPPF 404
             KR KE+KR  KD + +LPPF
Sbjct:     5 KRKKEKKRTEKDNTTNLPPF 24


>gi|2275210 (AC002337) peptidyl-prolyl cis-trans isomerase isolog [Arabidopsis
            thaliana]
            Length = 230

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 3.8, P = 0.98
 Identities = 24/113 (21%), Positives = 49/113 (43%), Frame = +3

Query:     9 YRGSTFFRILRGAWVMGGDISRDHNGNGGYSCYGRYFPNXSYAIPHDAPGVIGMCNDNED 188
             ++G  F R+++   +  GD S + +    ++   +   N   ++ H+   ++G      +
Sbjct:   114 FKGFLFSRVVKHFVIQAGD-SAEFDAVKDWALDRK---NIDTSLKHEE-FMVGTPKAKNE 168

Query:   189 TNASSFYITMKAMSWMNGRYVAFGRVIDGMNVVEAIHDVDVKHNQSPCKEITI 347
                  F+I    +  +N +   FGRV  G +VV+ I +V+      P   I I
Sbjct:   169 QGGFEFFIVSAQIKDLNEKLTVFGRVSKGQDVVQEIEEVETDDQYQPKSPIEI 221


>gi|3414821 (AF064214) globulin-1 [Zea mays subsp. mays]
            Length = 242

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 9.6, P = 1.0
 Identities = 20/52 (38%), Positives = 26/52 (50%), Frame = +2

Query:   257 WPSDRRHECRGGHPRCRC--KTQPKPLQGDYHQRLRCH*PHGRLIREKKREEGR 412
             W  D  H   GGH   RC  + + +P    +HQR RC        REK++E GR
Sbjct:    24 WEDDNHHH-HGGHKSGRCVRRCEDRP----WHQRPRCLEQCREKEREKRQERGR 72


>gi|3414843 (AF064225) globulin-1 [Zea mays subsp. parviglumis]
            Length = 242

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 9.6, P = 1.0
 Identities = 20/52 (38%), Positives = 26/52 (50%), Frame = +2

Query:   257 WPSDRRHECRGGHPRCRC--KTQPKPLQGDYHQRLRCH*PHGRLIREKKREEGR 412
             W  D  H   GGH   RC  + + +P    +HQR RC        REK++E GR
Sbjct:    24 WEDDNHHH-HGGHKSGRCVRRCEDRP----WHQRPRCLEQCREKEREKRQERGR 72


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.98
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.332   0.147   0.490  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.333   0.149   0.532  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.353   0.151   0.521  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.346   0.149   0.568  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.325   0.139   0.431  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.337   0.144   0.479  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      173       172       10.  73 3 1000 22  0.11    34
                                                     31  0.11    37
   +2      0      173       172       10.  73 3 1000 22  0.11    34
                                                     31  0.11    37
   +1      0      174       173       10.  73 3 1000 22  0.11    34
                                                     31  0.11    37
   -1      0      174       173       10.  73 3 1000 22  0.11    34
                                                     31  0.11    37
   -2      0      173       172       10.  73 3 1000 22  0.11    34
                                                     31  0.11    37
   -3      0      173       172       10.  73 3 1000 22  0.11    34
                                                     31  0.11    37


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  181
  No. of states in DFA:  369 (37 KB)
  Total size of DFA:  48 KB (64 KB)
  Time to generate neighborhood:  0.01u 0.00s 0.01t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  39.60u 1.32s 40.92t  Elapsed: 00:00:08
  Total cpu time:  39.86u 10.76s 50.62t  Elapsed: 00:00:18
  Start:  Thu Sep 24 13:10:13 1998   End:  Thu Sep 24 13:10:31 1998

Date: 14:57:26 on Sun 17 Dec 117.