blastx_gbnr_files/CcruzaQ_1846_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CcruzaQ_1846
        (364 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|e334163      (Y14554) pSI-7 protein [Cladospor... +2    89  0.023     1
A gnl|PID|e1289127     (AJ005562) SPR2D protein [Mus mus... +2    70  0.14      1
A sp|P35321|CORA_HUMAN CORNIFIN A (SMALL PROLINE-RICH PR... +2    67  0.26      1
A pir||S50754          hypothetical protein WP6 - Chlamy... +2    81  0.55      1
A pir||S41627          probable anti-mullerian hormone r... +2    81  0.77      1
A pir||S24194          dopamine receptor D4 - human (fra... +2    53  0.82      2
A gi|1492050           (U60315) MC107L [Molluscum contag... +2    79  0.87      1
A pir||S37650          high-sulfur keratin - human >bbs|... +2    74  0.92      1
A gi|194118            (J00425) interferon beta [Mus mus... -1    59  0.93      1
A sp|P51902|MT_GADMO   METALLOTHIONEIN (MT) >gi|471773 (... +2    59  0.93      1
A gnl|PID|e300083      (Z68220) T20D3.2 [Caenorhabditis ... +2    74  0.99      1
A sp|P14612|NXLH_PSEAU LONG NEUROTOXIN HOMOLOG PA ID >pi... +2    57  0.99      1
A sp|P52726|MT_OREMO   METALLOTHIONEIN (MT) >pir||JC2420... +2    57  0.99      1
A gnl|PID|e286635      (Z83743) variant-specific surface... +2    78  0.996     1
A bbs|138342           ENOD12 protein=nodule-specific pr... +3    56  0.997     1
A sp|P39549|YAJ9_YEAST HYPOTHETICAL 8.9 KD PROTEIN IN CD... -3    56  0.997     1
A sp|P26371|KRUC_HUMAN KERATIN, ULTRA HIGH-SULFUR MATRIX... +2    71  0.998     1
A pir||S18946          high-sulfur keratin - human >gi|3... +2    71  0.998     1
A gi|458137            (U03563) 26kDa protein [pea enati... +3    73  0.998     1
A pir||S09269          Ig alpha chain C region - rabbit ... +2    75  0.998     1
A gi|1147779           (U42427) MIS type II receptor [Ra... +2    76  0.9996    1
A gnl|PID|e236456      (Z71177) unnamed protein product ... +2    75  0.9997    1



>gnl|PID|e334163 (Y14554) pSI-7 protein [Cladosporium fulvum]
            Length = 661

  Plus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 0.023, P = 0.023
 Identities = 30/102 (29%), Positives = 44/102 (43%), Frame = +2

Query:    29 TNKTHTHHRTNTYETRTDHCKMPVRWGCC----WSFPQTRATRSTCNKENMEACSKASPN 196
             T+K  T   T T  TRT+ CK P  WGC      S P T +T ++ +  +   C      
Sbjct:   463 TSKASTATSTTT-RTRTETCKTPGWWGCLDESTTSAPTT-STSTSSSTSSTRTCETPGWF 520

Query:   197 AQKKGSCLTSSCTALCPFPAAPAASVAPCGC-PDPSCTSLVPAP 325
               K  +  TSS +++    A PA ++      P  + TS    P
Sbjct:   521 GCKDETTTTSSSSSISSPSATPAPTITTTSSLPTSTSTSTCKTP 564


>gnl|PID|e1289127 (AJ005562) SPR2D protein [Mus musculus]
            Length = 85

  Plus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 0.15, P = 0.14
 Identities = 17/52 (32%), Positives = 20/52 (38%), Frame = +2

Query:   176 CSKASPNAQKKGSCLTSSCTALCPFPAAPAASVAPCGCPDPSCTSLVPAPSQ 331
             C +  P  +    C    C   CP P  P     PC  P PSC    P P+Q
Sbjct:    23 CPEPCPPLKCPEPCPPPKCPEPCPPPKCPEPCPEPC--PPPSCQQKCP-PAQ 71


>sp|P35321|CORA_HUMAN CORNIFIN A (SMALL PROLINE-RICH PROTEIN IA) (SPR-IA)
            (SPRK) >pir||I54187 small proline-rich protein 1A - human
            >bbs|155417 SPRK=small proline-rich protein [human, odontogenic
            keratocysts, Peptide Partial, 89 aa] >gi|385225 (L05187) small
            proline-rich protein 1 [Homo sapiens]
            Length = 89

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 0.31, P = 0.26
 Identities = 20/71 (28%), Positives = 30/71 (42%), Frame = +2

Query:   125 PQTRATRSTCNKENMEAC-SKASPNAQKKGSCLTSSCTALCPFPAAPAASVAPCG--CPD 295
             PQ +  +  C     E C  K     Q K   +   C    P P  P     PC    P+
Sbjct:    16 PQQQQVKQPCQPPPQEPCIPKTKEPCQPK---VPEPCHPKVPEPCQPKIP-EPCQPKVPE 71

Query:   296 PSCTSLVPAPSQKQ 337
             P  +++ PAP+Q++
Sbjct:    72 PCPSTVTPAPAQQK 85


>pir||S50754 hypothetical protein WP6 - Chlamydomonas eugametos >gi|530878
            (L29028) amino acid feature: N-glycosylation sites, aa 41 .. 43, 46
            .. 48, 51 .. 53, 72 .. 74, 107 .. 109, 128 .. 130, 132 .. 134, 158
            .. 160, 163 .. 165; amino acid feature: Rod protein domain, aa 169
            .. 340; amino acid feature: globular pro...
            Length = 351

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.80, P = 0.55
 Identities = 28/78 (35%), Positives = 36/78 (46%), Frame = +2

Query:   125 PQTRATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALCPFP-AAPAASV--APCGCPD 295
             P  +A+ S   K +     KASP+   K S   S   +  P P A+P AS   +P   P 
Sbjct:   188 PSPKASPSPSPKASPSPSPKASPSPSPKASPAPSPQPSPTPSPKASPVASPQQSPTPSPR 247

Query:   296 PSCT-SLVPAPSQKQQGP 346
             PS T S  P+PS K   P
Sbjct:   248 PSPTPSPTPSPSPKASPP 265


>pir||S41627 probable anti-mullerian hormone receptor - rat >gi|453178 (X71916)
            put. anti-mullerian hormone receptor [Rattus norvegicus]
            >prf||2205263A MIS receptor:ISOTYPE=II [Rattus norvegicus]
            Length = 557

  Plus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 1.5, P = 0.77
 Identities = 23/64 (35%), Positives = 31/64 (48%), Frame = +2

Query:   113 CWSF-PQTRATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALCP--FPAAPAASVAPC 283
             CW   P+ R T + C ++ + A   A P      S    SC   CP  +PAAPA++  PC
Sbjct:   485 CWDADPEARLT-AECVQQRLAAL--AYPQV---ASSFPESCPQGCPENYPAAPASAAFPC 538

Query:   284 GCPDPSC 304
                  SC
Sbjct:   539 RPQQSSC 545


>pir||S24194 dopamine receptor D4 - human (fragment)
            Length = 117

  Plus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 1.7, Sum P(2) = 0.82
 Identities = 16/39 (41%), Positives = 17/39 (43%), Frame = +2

Query:   230 CTALCPFPAAPAASVAPCGCPD--PSCTSLVPAPSQKQQGP 346
             C   C  PAAP+    PCG PD  P    L P P      P
Sbjct:    76 CGPDCA-PAAPSLPQDPCG-PDCAPPAPGLPPDPCGSNCAP 114

 Score = 50 (17.6 bits), Expect = 1.7, Sum P(2) = 0.82
 Identities = 12/20 (60%), Positives = 13/20 (65%), Frame = +3

Query:    90 RCP*GGDVAGPFPRRVPQDP 149
             R P G D A P PR +PQDP
Sbjct:    25 RGPCGPDCAPPAPR-LPQDP 43

 Score = 48 (16.9 bits), Expect = 2.7, Sum P(2) = 0.93
 Identities = 11/18 (61%), Positives = 12/18 (66%), Frame = +3

Query:    96 P*GGDVAGPFPRRVPQDP 149
             P G D A P PR +PQDP
Sbjct:    43 PCGPDCAPPAPR-LPQDP 59

 Score = 48 (16.9 bits), Expect = 2.7, Sum P(2) = 0.93
 Identities = 11/18 (61%), Positives = 12/18 (66%), Frame = +3

Query:    96 P*GGDVAGPFPRRVPQDP 149
             P G D A P PR +PQDP
Sbjct:    59 PCGPDCAPPAPR-LPQDP 75


>gi|1492050 (U60315) MC107L [Molluscum contagiosum virus subtype 1]
            Length = 421

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 2.0, P = 0.87
 Identities = 27/84 (32%), Positives = 32/84 (38%), Frame = +2

Query:    77 TDHCKMPVRWGCCWSFPQTRATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALCPFPA 256
             TD C  P     C   P   AT   C      A + A P      +C   +    CP PA
Sbjct:   211 TDTCPAPATAPAC---PAP-ATSPACPAP---ATAPACPAPATAPACPAPATAPACPAPA 263

Query:   257 APAASVAPCGCPDPSCTSLVPAPS 328
                A  AP  CP P+C    PAP+
Sbjct:   264 TAPACPAPA-CPTPAC----PAPA 282

 Score = 79 (27.8 bits), Expect = 2.0, P = 0.87
 Identities = 29/88 (32%), Positives = 36/88 (40%), Frame = +2

Query:    77 TDHCKMPVRWGCCWSFPQTRATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALCPFPA 256
             TD C  P     C   P   AT   C      A + A P      +C   +    CP PA
Sbjct:   211 TDTCPAPATAPAC---PAP-ATSPACPAP---ATAPACPAPATAPACPAPATAPACPAPA 263

Query:   257 APAASVAPCGCPDPSCTS--LVPA---PSQKQQ 340
                A  AP  CP P+C +    PA   PS +Q+
Sbjct:   264 TAPACPAPA-CPTPACPAPATAPACAVPSVRQE 295


>pir||S37650 high-sulfur keratin - human >bbs|117301 (S47243) high-sulfur
            keratin B2A [human, Peptide, 177 aa] [Homo sapiens] >gi|311880
            (X63337) high sulfur keratin [Homo sapiens]
            Length = 177

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 2.5, P = 0.92
 Identities = 21/73 (28%), Positives = 29/73 (39%), Frame = +2

Query:   110 CCWS----FPQTRATRSTCNKENME-ACSKAS---PNAQKKGSCLTSSC-TALCPFPAAP 262
             CC +    FP   +T  TC     + +C + S   P   +   C  S C T+ C FP+  
Sbjct:     3 CCQTSFCGFPSC-STSGTCGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFS 61

Query:   263 AASVAPCGCPDPSC 304
                     C  PSC
Sbjct:    62 TGGTCDSSCCQPSC 75


>gi|194118 (J00425) interferon beta [Mus musculus] >gi|817965 (V00755) reading
           frame IF (1 is 2nd base in codon) [Mus musculus]
           Length = 38

  Minus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 2.7, P = 0.93
 Identities = 13/28 (46%), Positives = 15/28 (53%), Frame = -1

Query:   256 GRKRAQSSTTTCEAASLFLCVWRCLGAR 173
             G +  QS    C   +L LC WR LGAR
Sbjct:    11 GSEDYQSRHFACLPRNLGLCTWRSLGAR 38


>sp|P51902|MT_GADMO METALLOTHIONEIN (MT) >gi|471773 (U08105) metallothionein
            [Gadus morhua]
            Length = 60

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 2.7, P = 0.93
 Identities = 18/56 (32%), Positives = 21/56 (37%), Frame = +2

Query:   137 ATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALCPFPAAPAASVAPCGCPDPSC 304
             A   TCN      C+  S    KK  C    C   CP   +  AS   C C D +C
Sbjct:     7 AKTGTCNCGTSCTCANCSCTKCKKSCC---EC---CPSGCSKCAS--GCACKDKTC 54


>gnl|PID|e300083 (Z68220) T20D3.2 [Caenorhabditis elegans]
            Length = 234

  Plus Strand HSPs:

 Score = 74 (26.0 bits), Expect = 4.4, P = 0.99
 Identities = 16/49 (32%), Positives = 21/49 (42%), Frame = +2

Query:   101 RWGCCWSFPQTRATRSTCNKENME-ACSKASPNAQKKGSCLTSSCTALC 244
             +W C  +FP T A  S     N   +     P  Q+ GSCL  +  A C
Sbjct:   154 QWDCLGTFPTTNAYNSCIQNFNQTVSAGNFCPAVQQTGSCLNDAYNAAC 202


>sp|P14612|NXLH_PSEAU LONG NEUROTOXIN HOMOLOG PA ID >pir||JU0034 long
            neurotoxin homolog PaID - mulga snake >prf||1510255A neurotoxin
            PaID [Pseudechis australis]
            Length = 68

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 4.5, P = 0.99
 Identities = 19/60 (31%), Positives = 24/60 (40%), Frame = +2

Query:   149 TCNKENMEACSKASPN--AQKKGSCLTSSCTALCPFPAAPAASVAPCGCPDPSCTSLVPA 322
             TC  E    C+K   +   Q +G  L   CTA CP    P      C C   +C    P 
Sbjct:    13 TCRSEQELCCTKTWCDQWCQDRGPRLEMGCTATCP-RRMPGLDFT-C-CTTDNCN---PV 66

Query:   323 PS 328
             P+
Sbjct:    67 PT 68


>sp|P52726|MT_OREMO METALLOTHIONEIN (MT) >pir||JC2420 metallothionein -
            Mozambique tilapia >bbs|159703 (S75042) metallothionein, MT
            [Tilapia mossambica=tilapia, liver, Peptide, 60 aa] [Tilapia
            mossambica]
            Length = 60

  Plus Strand HSPs:

 Score = 57 (20.1 bits), Expect = 4.5, P = 0.99
 Identities = 18/56 (32%), Positives = 23/56 (41%), Frame = +2

Query:   137 ATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALCPFPAAPAASVAPCGCPDPSC 304
             A   TCN     +C+K S  + KK  C    C   CP   +  AS   C C   +C
Sbjct:     7 AKTGTCNCGGSCSCTKCSCKSCKKSCC---DC---CPSGCSKCAS--GCVCKGKTC 54


>gnl|PID|e286635 (Z83743) variant-specific surface protein VSP4A1 [Giardia
            intestinalis]
            Length = 686

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 5.5, P = 1.0
 Identities = 18/49 (36%), Positives = 26/49 (53%), Frame = +2

Query:   167 MEACSKAS-PNAQKKGSCLTSSCTALCPFPAAPAASVAPC-GCPDPSCTS 310
             +E CS+ + P+A+  G    ++CTA C     P  S   C  CPD +C S
Sbjct:   574 VEGCSQCTAPDARADGGMAVATCTA-CEDGKKPGKSGTGCVACPDANCKS 622


>bbs|138342 ENOD12 protein=nodule-specific proline-rich protein {clone
            VfNDS-X7} [Vicia faba=broadbeans, root nodules, Peptide Partial, 57
            aa]
            Length = 57

  Plus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 5.9, P = 1.0
 Identities = 13/33 (39%), Positives = 17/33 (51%), Frame = +3

Query:   111 VAGPFPRRVPQ-DPPATKKIWRRAPRHRQTHKK 206
             V GP   + PQ + P  K   +  PRH+  HKK
Sbjct:     3 VNGPPVNKPPQKETPVHKPPQKEPPRHKPPHKK 35


>sp|P39549|YAJ9_YEAST HYPOTHETICAL 8.9 KD PROTEIN IN CDC15-YAT1 INTERGENIC
            REGION >pir||S53481 FUN57 protein - yeast (Saccharomyces
            cerevisiae) >gi|456134 (L28920) Yar029wp [Saccharomyces cerevisiae]
            Length = 74

  Minus Strand HSPs:

 Score = 56 (19.7 bits), Expect = 5.9, P = 1.0
 Identities = 17/33 (51%), Positives = 17/33 (51%), Frame = -3

Query:   182 WSTPPYFLC---C-RWILWHASGERTSNIPTSRA 93
             WSTP YF C   C R  L    G RT   PTS A
Sbjct:    11 WSTPYYFYCEEDCHRLFLSFIEG-RTFEKPTSNA 43


>sp|P26371|KRUC_HUMAN KERATIN, ULTRA HIGH-SULFUR MATRIX PROTEIN (UHS KERATIN)
            >pir||B36686 ultra-high-sulfur keratin - human >gi|34079 (X55293)
            ultra high-sulphur keratin protein [Homo sapiens] >gnl|PID|e1299394
            (AJ006693) ultra high sulfer keratin [Homo sapiens] >prf||1704255A
            Cys rich protein [Homo sapiens]
            Length = 169

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 6.0, P = 1.0
 Identities = 19/69 (27%), Positives = 25/69 (36%), Frame = +2

Query:   110 CCWSFPQTRATRSTCNKENMEACSKASPNAQKKG---SCLTSSCTALCPFPAAPAASVAP 280
             CC S   +   + +C K     CS   P     G   SC  SSC   C   +   +S   
Sbjct:    87 CCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGCGSSCCQ 146

Query:   281 CGCPDPSCT 307
               C  P C+
Sbjct:   147 SSCCKPCCS 155


>pir||S18946 high-sulfur keratin - human >gi|32472 (X63755) high-sulpher
            keratin [Homo sapiens]
            Length = 169

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 6.0, P = 1.0
 Identities = 19/69 (27%), Positives = 25/69 (36%), Frame = +2

Query:   110 CCWSFPQTRATRSTCNKENMEACSKASPNAQKKG---SCLTSSCTALCPFPAAPAASVAP 280
             CC S   +   + +C K     CS   P     G   SC  SSC   C   +   +S   
Sbjct:    87 CCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGCGSSCCQ 146

Query:   281 CGCPDPSCT 307
               C  P C+
Sbjct:   147 SSCCKPCCS 155


>gi|458137 (U03563) 26kDa protein [pea enation mosaic virus]
           Length = 236

  Plus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 6.1, P = 1.0
 Identities = 34/94 (36%), Positives = 44/94 (46%), Frame = +3

Query:    57 QTHTKQGLTTARCP*GGDVAGPFPRR--------VP-QDPPATKKIWRRAPRHRQTHKKR 209
             Q H K G T  R   GG V    PRR         P Q PP  ++  RR     Q  ++ 
Sbjct:    76 QEHPKHGGTAFRRESGGSVHPSHPRRRARRGGDMAPRQHPPPPRE--RRTKTETQAERRA 133

Query:   210 EAASQVVVLL-CALFLPLLPPQWRHADVLIRHVHHSFRHRRR 332
             +A S +  LL C   L L P     A+VL+ H H + R + R
Sbjct:   134 QALSVLPTLLDCIGGLDLGP-----AEVLL-HCHRAVRRQLR 169


>pir||S09269 Ig alpha chain C region - rabbit (fragment)
            Length = 357

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 6.3, P = 1.0
 Identities = 20/57 (35%), Positives = 23/57 (40%), Frame = +2

Query:   134 RATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALC--PFPAAPAASVAPCGCPDPSC 304
             R     C +EN  AC     N  K G  +T      C  P P     +  PC CP PSC
Sbjct:    68 RLLAEQCPEENSVACH-VEHNYDK-GQHVTVPSPPECQPPTPGPSDTTTCPCPCPSPSC 124


>gi|1147779 (U42427) MIS type II receptor [Rattus norvegicus]
            Length = 557

  Plus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 7.9, P = 1.0
 Identities = 23/64 (35%), Positives = 30/64 (46%), Frame = +2

Query:   113 CWSF-PQTRATRSTCNKENMEACSKASPNAQKKGSCLTSSCTALCP--FPAAPAASVAPC 283
             CW   P+ R T + C ++ + A   A P      S    SC   CP   PAAPA++  PC
Sbjct:   485 CWDADPEARLT-AECVQQRLAAL--AYPQV---ASSFPESCPQGCPENCPAAPASAAFPC 538

Query:   284 GCPDPSC 304
                  SC
Sbjct:   539 RPQQSSC 545


>gnl|PID|e236456 (Z71177) unnamed protein product [Caenorhabditis elegans]
            Length = 425

  Plus Strand HSPs:

 Score = 75 (26.4 bits), Expect = 8.0, P = 1.0
 Identities = 30/118 (25%), Positives = 47/118 (39%), Frame = +2

Query:    11 PRLTPQTN-KTHTHHRTNTYETRTDHCKMPVRWGCCWSFP------QTRATRST--CNKE 163
             PR+ P  + +  T+ +   Y     +   PV+  C  + P      Q +A++    C + 
Sbjct:    33 PRVQPSCSCQRTTYTQPQQYSCSCQNTA-PVQKSCSCAQPVQQQTYQIQASQCAPACQQS 91

Query:   164 NMEACSKASPNAQKKGSCLTSSCTALCPFPAAPAASVAPCGC-P--DPSCTSLVPAPSQ 331
                 C  A   +Q + +C  S  T+ C  P  PA       C P  + SC    PAP Q
Sbjct:    92 CQNQCQSAPSVSQCQSTCQQSCQTSSCYTPTTPAPVQCQPSCMPACEQSCVVQTPAPVQ 150


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.98
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.341   0.148   0.527  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.322   0.129   0.447  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.338   0.145   0.467  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.350   0.154   0.582  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.335   0.146   0.513  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.331   0.140   0.478  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      120       120       10.  69 3 1000 22  0.097   33
                                                     29  0.11    35
   +2      0      121       121       10.  69 3 1000 22  0.098   33
                                                     29  0.11    35
   +1      0      121       121       10.  69 3 1000 22  0.098   33
                                                     29  0.11    35
   -1      0      121       121       10.  69 3 1000 22  0.098   33
                                                     29  0.11    35
   -2      0      121       121       10.  69 3 1000 22  0.098   33
                                                     29  0.11    35
   -3      0      120       120       10.  69 3 1000 22  0.097   33
                                                     29  0.11    35


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  22
  No. of states in DFA:  302 (30 KB)
  Total size of DFA:  38 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  28.57u 1.28s 29.85t  Elapsed: 00:00:06
  Total cpu time:  28.62u 2.95s 31.57t  Elapsed: 00:00:08
  Start:  Thu Sep 24 16:02:06 1998   End:  Thu Sep 24 16:02:14 1998

Date: 17:24:30 on Mon 18 Dec 117.