blastx_gbnr_files/CcruzaQ_2211_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CcruzaQ_2211
        (303 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A sp|P24834|VE5_RHPV1  PROBABLE E5 PROTEIN                  +3    77  0.041     1
A pir||W5WLR1          E5 protein - rhesus papillomaviru... +3    77  0.041     1
A sp|P14329|RL19_DICDI 60S RIBOSOMAL PROTEIN L19 (VEGETA... -1    78  0.049     1
A gi|473219            (X78109) capsid protein [Semliki ... -3    80  0.059     1
A prf||0907186A        protein,core [Semliki Forest virus]  -3    79  0.075     1
A pir||S51907          cryptogene protein G1(ND8) - Saur... +3    71  0.15      1
A pir||S42462          structural polyprotein - Semliki ... -3    80  0.22      1
A gnl|PID|e1246950     (Z83230) F56A8.2 [Caenorhabditis ... -3    73  0.24      1
A gi|3025857           (AF055719) splicing factor SRp54 ... -1    76  0.25      1
A prf||0801290A        protein,core [Semliki Forest virus]  -3    72  0.37      1
A pir||G54024          protein kinase (EC 2.7.1.37) cdc2... -2    77  0.41      1
A pir||H54024          protein kinase (EC 2.7.1.37) cdc2... -2    77  0.41      1
A pir||B54024          protein kinase (EC 2.7.1.37) cdc2... -2    77  0.41      1
A pir||F54024          protein kinase (EC 2.7.1.37) cdc2... -2    77  0.41      1
A pir||E54024          protein kinase (EC 2.7.1.37) cdc2... -2    77  0.41      1
A gnl|PID|e286122      (Y09830) amphiregulin [Ovis aries]   -1    64  0.47      1
A sp|Q02752|PHPA_PLACH ACIDIC PHOSPHOPROTEIN PRECURSOR (... -3    73  0.51      1
A gi|2444428           (AF020657) ErpX protein [Borrelia... -3    71  0.57      1
A sp|P03315|POLS_SFV   STRUCTURAL POLYPROTEIN (CONTAINS:... -3    77  0.60      1
A gi|501027            (U01849) ORF2 [Trypanosoma brucei]   +3    68  0.64      1
A sp|Q13428|TCOF_HUMAN TREACLE PROTEIN (TREACHER COLLINS... -2    77  0.65      1
A gi|1778432           (U79660) Treacher Collins syndrom... -2    77  0.65      1
A gi|3335336           (AC004512) Contains similarity to... -1    73  0.66      1
A sp|P36043|YKU1_YEAST 64.6 KD PROTEIN IN TOR2-PAS1 INTE... -3    72  0.70      1
A gnl|PID|e234794      (Z70684) F28D1.8 [Caenorhabditis ... -1    71  0.70      1
A gnl|PID|e325351      (Z97210) hypothetical protein [Sc... -3    71  0.73      1
A gnl|PID|e1283519     (Z28201) ORF YKL201c [Saccharomyc... -3    72  0.78      1
A pir||S02708          troponin T - fruit fly (Drosophil... -2    69  0.81      1
A gi|1049086           (U30829) SRp55-3 [Homo sapiens]      -1    70  0.88      1
A pir||PS0009          glycinin A1aB1b precursor - soybe... +3    59  0.88      1
A pir||S59043          spliling factor SRp55 - human >gi... -1    70  0.89      1
A gi|1685095           (U46781) orf2 [Pasteurella haemol... -3    69  0.90      1
A gnl|PID|d1012343     (D83006) gene required for phosph... -3    72  0.95      1
A sp|Q01005|UL24_HSVSA GENE 20 PROTEIN >pir||WZBEM6 gene... -1    69  0.97      1
A gi|3135473           (AF039081) Cre binding protein-li... -1    65  0.97      1
A pir||B26696          hypothetical protein 1 (CYb-COII ... +2    69  0.98      1
A gi|310432            (L05111) envelope glycoprotein [S... -2    35  0.98      2
A gi|954775            (L06352) This CDS feature is incl... -2    35  0.98      2
A gnl|PID|e312877      (Z72587) ORF YGL066w [Saccharomyc... -1    70  0.98      1
A gnl|PID|e329895      (AJ000496) cyclic nucleotide-gate... -2    71  0.99      1
A pir||S51364          sperm tail-specific protein mst10... -3    71  0.99      1
A sp|Q08696|MST2_DROHY AXONEME-ASSOCIATED PROTEIN MST101... -3    71  0.99      1
A sp|P53165|YGG6_YEAST HYPOTHETICAL 72.9 KD PROTEIN IN R... -1    70  0.993     1
A sp|Q28092|CYL2_BOVIN CYLICIN II (MULTIPLE-BAND POLYPEP... -3    70  0.994     1
A pir||S40923          hypothetical protein ZK1098.1 - C... -1    70  0.995     1
A sp|P34600|YO61_CAEEL HYPOTHETICAL 84.7 KD PROTEIN ZK10... -1    70  0.996     1
A sp|P10431|YIM8_BPPH1 HYPOTHETICAL IMMUNITY REGION PROT... +2    55  0.997     1
A gi|954773            (L06351) This CDS feature is incl... -2    55  0.997     1
A gi|954789            (L06359) This CDS feature is incl... -2    55  0.997     1
A sp|P50565|H2B1_CHLRE HISTONE H2B-I >pir||S59125 histon... -2    65  0.997     1
A gi|3253105           (AF000196) strong similarity to t... -2    69  0.9992    1
A sp|Q03525|YM8H_YEAST HYPOTHETICAL 16.2 KD PROTEIN IN P... -3    65  0.9992    1
A pir||S60811          M protein precursor - Streptococc... -1    61  0.9992    1
A sp|P36042|YKU2_YEAST HYPOTHETICAL 21.2 KD PROTEIN IN T... +1    66  0.9993    1
A pir||I49627          testosterone 16a-hydroxylase type... +2    54  0.9993    1
A bbs|164350           cytochrome P450HPB-1 {N-terminal}... +2    54  0.9993    1
A gnl|PID|e352081      (Y13586) parathymosin [Homo sapiens] -1    54  0.9993    1
A gi|2895190           (AF019049) 3-oxo-5-alpha-steroid ... +3    54  0.9993    1
A gi|533560            (U11941) emml gene product [Strep... -1    61  0.9996    1
A sp|P36935|YSV_BPP2   HYPOTHETICAL 30.4 KD PROTEIN IN S... +1    67  0.9996    1
A sp|P36099|YKD0_YEAST HYPOTHETICAL 23.0 KD PROTEIN IN I... +3    66  0.9996    1
A gi|2565011           (AC002983) putative mudrA-like re... -3    70  0.9998    1
A gnl|PID|d1026409     (AB011125) KIAA0553 protein [Homo... -1    70  0.9998    1
A pir||A34259          cytochrome P450mt4, phenobarbital... +2    53  0.99990   1
A sp|Q26377|CORZ_DROME CORAZONIN PRECURSOR (CONTAINS: CO... +1    53  0.99990   1
A pir||S58143          gene 14 protein - phage SPP1 >gi|... -1    53  0.99990   1
A gi|3377809           (AF075597) contains similarity to... -2    65  0.99993   1



>sp|P24834|VE5_RHPV1 PROBABLE E5 PROTEIN
            Length = 157

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.041, P = 0.041
 Identities = 19/48 (39%), Positives = 24/48 (50%), Frame = +3

Query:    99 PHCFLFFC-CCCFFFFCSFVPLVAVG*AFRVFFLCLSWPGIRVALSPHA 242
             P C  + C CCCF     FV L++    F VF +CLS     V L  H+
Sbjct:    38 PFCCFWLCFCCCFCLALCFVHLLSR--CFCVFPVCLSVAAYAVVLGVHS 84


>pir||W5WLR1 E5 protein - rhesus papillomavirus (type 1)
            Length = 157

  Plus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.041, P = 0.041
 Identities = 19/48 (39%), Positives = 24/48 (50%), Frame = +3

Query:    99 PHCFLFFC-CCCFFFFCSFVPLVAVG*AFRVFFLCLSWPGIRVALSPHA 242
             P C  + C CCCF     FV L++    F VF +CLS     V L  H+
Sbjct:    38 PFCCFWLCFCCCFCLALCFVHLLSR--CFCVFPVCLSVAAYAVVLGVHS 84


>sp|P14329|RL19_DICDI 60S RIBOSOMAL PROTEIN L19 (VEGETATIVE SPECIFIC PROTEIN
            V14) (22 KD CALMODULIN-BINDING PROTEIN) >pir||R5DO9E ribosomal
            protein L19.e - slime mold (Dictyostelium discoideum) >gi|295737
            (X15383) V14 gene product [Dictyostelium discoideum] >gi|443591
            (L27657) ribosomal protein [Dictyostelium discoideum]
            Length = 186

  Minus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.050, P = 0.049
 Identities = 18/45 (40%), Positives = 26/45 (57%), Frame = -1

Query:   219 EYLAKTNIKKKREKLSQQQREGRTSKKKKSNNNRRTRSNEGKHIL 85
             EY+ K+  +K REKL Q Q + R +K K S  +RR   +  K I+
Sbjct:   140 EYIVKSKTEKLREKLIQDQAQARRNKNK-SIKDRRAAKSAAKEIV 183


>gi|473219 (X78109) capsid protein [Semliki Forest virus]
           Length = 267

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.060, P = 0.059
 Identities = 22/46 (47%), Positives = 28/46 (60%), Frame = -3

Query:   223 TRIPGQDKHKKKTR---KAQPTATRG-TNEQKKKKQQQQKNKKQ*GK 95
             TR P + K KK T+   K QP   +G T +QKKK +Q  K KK+ GK
Sbjct:    62 TR-PPKPKKKKTTKPKPKTQPKKIKGKTQQQKKKDKQADKKKKKPGK 107


>prf||0907186A protein,core [Semliki Forest virus]
            Length = 267

  Minus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.078, P = 0.075
 Identities = 20/44 (45%), Positives = 26/44 (59%), Frame = -3

Query:   214 PGQDKHKKKTR---KAQPTATRG-TNEQKKKKQQQQKNKKQ*GK 95
             P + K KK T+   K QP   +G T +QKKK +Q  K KK+ GK
Sbjct:    64 PPKPKKKKTTKPKPKTQPKKIKGKTQQQKKKDKQADKKKKKPGK 107


>pir||S51907 cryptogene protein G1(ND8) - Sauroleishmania tarentolae (strain
            LEM125)
            Length = 145

  Plus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.17, P = 0.15
 Identities = 14/33 (42%), Positives = 18/33 (54%), Frame = +3

Query:   105 CFLFFCCCCFFFFCSFVPLVAVG*AFRVF--FLC 200
             CFL FCCC   + C+    V  G  F +F  +LC
Sbjct:   111 CFLLFCCCIAMYLCA-PKFVLFGCCFMLFDFYLC 143


>pir||S42462 structural polyprotein - Semliki Forest virus (strain A774)
            (fragment)
            Length = 755

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 0.25, P = 0.22
 Identities = 22/46 (47%), Positives = 28/46 (60%), Frame = -3

Query:   223 TRIPGQDKHKKKTR---KAQPTATRG-TNEQKKKKQQQQKNKKQ*GK 95
             TR P + K KK T+   K QP   +G T +QKKK +Q  K KK+ GK
Sbjct:    62 TR-PPKPKKKKTTKPKPKTQPKKIKGKTQQQKKKDKQADKKKKKPGK 107


>gnl|PID|e1246950 (Z83230) F56A8.2 [Caenorhabditis elegans]
            Length = 230

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.28, P = 0.24
 Identities = 22/70 (31%), Positives = 34/70 (48%), Frame = -3

Query:   289 AKKQEAEVLGGRKREKAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQKNK 110
             A KQ  +V  G +++    L+A     + KHK K +KAQ       N++KK+K   +K  
Sbjct:   139 AAKQVVDVYMGEQKKAIDSLKAQ----EAKHKAKVQKAQEEERMKKNQEKKEKAAAKKGT 194

Query:   109 KQ*GKTYFVF 80
                 KT  +F
Sbjct:   195 FAGKKTIEIF 204


>gi|3025857 (AF055719) splicing factor SRp54 [Drosophila melanogaster]
            Length = 386

  Minus Strand HSPs:

 Score = 76 (26.8 bits), Expect = 0.29, P = 0.25
 Identities = 21/78 (26%), Positives = 41/78 (52%), Frame = -1

Query:   291 TPRNRRRKS*AGGKEKKHGD*GQHEYLAKTNIKKKREKLSQQQRE--GRTSKKKKSNNNR 118
             T R+R  +S +  + ++ G   +   ++++   + R K S + R    R+  ++ S+ +R
Sbjct:   297 TSRSRSHRSTSRRRSRRSGS-RERRSVSRSRRSRSRGKHSSRSRSKRSRSRHRRSSSRSR 355

Query:   117 RTRSNEGKHILCFTATRLL 61
             R+RS  GKH L   A + L
Sbjct:   356 RSRSRGGKHSLLKVAWQAL 374


>prf||0801290A protein,core [Semliki Forest virus]
            Length = 267

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 0.46, P = 0.37
 Identities = 19/44 (43%), Positives = 25/44 (56%), Frame = -3

Query:   214 PGQDKHKKKTR---KAQPTATRG-TNEQKKKKQQQQKNKKQ*GK 95
             P + K KK T+   K QP   +  T +QKKK +Q  K KK+ GK
Sbjct:    64 PPKPKKKKTTKPKPKTQPKKIKXKTQQQKKKDKQADKKKKKPGK 107


>pir||G54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE beta 2-2 - human
            Length = 766

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.53, P = 0.41
 Identities = 20/71 (28%), Positives = 39/71 (54%), Frame = -2

Query:   284 ETGGGSPRREEKRKSMGTEGNTNTWPRQT*KKNAKSS-ANSNERDERAKKK--KATTTEE 114
             E+GGGS   EE+ +    EG+T+    +  ++  + + +NS E  E++ ++  +   +E+
Sbjct:   272 ESGGGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED 331

Query:   113 QEAMRENIFCV 81
             +E   EN F V
Sbjct:   332 EERENENHFLV 342


>pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-3 -
            human
            Length = 768

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.53, P = 0.41
 Identities = 20/71 (28%), Positives = 39/71 (54%), Frame = -2

Query:   284 ETGGGSPRREEKRKSMGTEGNTNTWPRQT*KKNAKSS-ANSNERDERAKKK--KATTTEE 114
             E+GGGS   EE+ +    EG+T+    +  ++  + + +NS E  E++ ++  +   +E+
Sbjct:   274 ESGGGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED 333

Query:   113 QEAMRENIFCV 81
             +E   EN F V
Sbjct:   334 EERENENHFLV 344


>pir||B54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-2 -
            human
            Length = 777

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.53, P = 0.41
 Identities = 20/71 (28%), Positives = 39/71 (54%), Frame = -2

Query:   284 ETGGGSPRREEKRKSMGTEGNTNTWPRQT*KKNAKSS-ANSNERDERAKKK--KATTTEE 114
             E+GGGS   EE+ +    EG+T+    +  ++  + + +NS E  E++ ++  +   +E+
Sbjct:   283 ESGGGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED 342

Query:   113 QEAMRENIFCV 81
             +E   EN F V
Sbjct:   343 EERENENHFLV 353


>pir||F54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE beta 2-1 - human
            Length = 777

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.53, P = 0.41
 Identities = 20/71 (28%), Positives = 39/71 (54%), Frame = -2

Query:   284 ETGGGSPRREEKRKSMGTEGNTNTWPRQT*KKNAKSS-ANSNERDERAKKK--KATTTEE 114
             E+GGGS   EE+ +    EG+T+    +  ++  + + +NS E  E++ ++  +   +E+
Sbjct:   283 ESGGGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED 342

Query:   113 QEAMRENIFCV 81
             +E   EN F V
Sbjct:   343 EERENENHFLV 353


>pir||E54024 protein kinase (EC 2.7.1.37) cdc2-related PITSLRE alpha 2-1 -
            human
            Length = 779

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.54, P = 0.41
 Identities = 20/71 (28%), Positives = 39/71 (54%), Frame = -2

Query:   284 ETGGGSPRREEKRKSMGTEGNTNTWPRQT*KKNAKSS-ANSNERDERAKKK--KATTTEE 114
             E+GGGS   EE+ +    EG+T+    +  ++  + + +NS E  E++ ++  +   +E+
Sbjct:   285 ESGGGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED 344

Query:   113 QEAMRENIFCV 81
             +E   EN F V
Sbjct:   345 EERENENHFLV 355


>gnl|PID|e286122 (Y09830) amphiregulin [Ovis aries]
            Length = 77

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 0.63, P = 0.47
 Identities = 12/41 (29%), Positives = 20/41 (48%), Frame = -1

Query:   198 IKKKREKLSQQQREGRTSKKKKSNNNRRTRSNEGKHILCFT 76
             +K K+ K   ++   +  +KKK   N + R N  +  LC T
Sbjct:     1 VKPKKNKTESEKTSDKPKRKKKGGKNGKNRRNRKRKNLCDT 41


>sp|Q02752|PHPA_PLACH ACIDIC PHOSPHOPROTEIN PRECURSOR (50 KD ANTIGEN)
            >pir||A48455 acidic phosphoprotein PcEMA1q - Plasmodium chabaudi
            >gi|160603 (M95789) acidic phosphoprotein [Plasmodium chabaudi]
            Length = 441

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 0.72, P = 0.51
 Identities = 21/64 (32%), Positives = 37/64 (57%), Frame = -3

Query:   208 QDKHKKKTRKAQPTAT---RGTNEQKKKKQQQQKNKKQ*GKTYFVFHSYA----VVANMI 50
             ++K KKK  K +PT T   +   E+KKKK++++K K++  K   +   ++    ++ N I
Sbjct:   378 KEKSKKKV-KNKPTMTTKKKKKKEKKKKKKEKEKKKEKKVKVEVIMDHFSEMEKMMNNKI 436

Query:    49 KHLKK 35
             KH  K
Sbjct:   437 KHWNK 441


>gi|2444428 (AF020657) ErpX protein [Borrelia burgdorferi]
            Length = 345

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.85, P = 0.57
 Identities = 15/34 (44%), Positives = 23/34 (67%), Frame = -3

Query:   205 DKHKKKTRKAQPTATRGTNEQKKKKQQQQKNKKQ 104
             +K K++  KAQ    R   E+K+KKQ+QQ+ KK+
Sbjct:   157 EKQKQEVEKAQERKQR-QEEKKRKKQEQQEEKKR 189


>sp|P03315|POLS_SFV STRUCTURAL POLYPROTEIN (CONTAINS: COAT PROTEIN C ; SPIKE
            GLYCOPROTEINS E3, E2 AND E1; 6 KD PEPTIDE) >pir||VHWV structural
            polyprotein - Semliki Forest virus >gi|334038 (J02361) structural
            polyprotein [Semliki forest virus] >gnl|PID|e38307 (X04129) capsid
            protein [Semliki Forest virus]
            Length = 1253

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 0.91, P = 0.60
 Identities = 20/44 (45%), Positives = 25/44 (56%), Frame = -3

Query:   214 PGQDKHKKKTR---KAQPTATRG-TNEQKKKKQQQQKNKKQ*GK 95
             P + K KK T+   K QP    G T +QKKK +Q  K KK+ GK
Sbjct:    64 PPKPKKKKTTKPKPKTQPKKINGKTQQQKKKDKQADKKKKKPGK 107


>gi|501027 (U01849) ORF2 [Trypanosoma brucei]
           Length = 141

  Plus Strand HSPs:

 Score = 68 (23.9 bits), Expect = 1.0, P = 0.64
 Identities = 17/41 (41%), Positives = 23/41 (56%), Frame = +3

Query:    90 YVFPHCFLFFCC---CCFFFFCSFVPLVAVG*AFRVFFLC--LSW 209
             + F  CFL+ CC    C  FFC F  ++     F ++FLC  L W
Sbjct:    78 FYFVLCFLY-CCFYLVCLVFFCIFCCVLCY---FLIYFLCCFLFW 118


>sp|Q13428|TCOF_HUMAN TREACLE PROTEIN (TREACHER COLLINS SYNDROME PROTEIN)
            >gi|1685049 (U76366) TCOF1 [Homo sapiens] >gi|1736917 (U40847)
            Treacher Collins syndrome [Homo sapiens] >gi|1854952 (U84665)
            putative nucleolar trafficking phosphoprotein [Homo sapiens]
            Length = 1411

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 1.0, P = 0.65
 Identities = 20/60 (33%), Positives = 33/60 (55%), Frame = -2

Query:   278 GGGSPRREEKRKSMGT-EGNTNTWPRQT*KKNAKSSANSNERDERAKKKKA--TTTEEQE 108
             G      EE +K MGT EG   + P+   K+  KS     +++++ KKKKA   +T++ E
Sbjct:  1335 GAKDEPEEELQKGMGTVEGGDQSNPKSK-KEKKKSDKRKKDKEKKEKKKKAKKASTKDSE 1393

Query:   107 A 105
             +
Sbjct:  1394 S 1394


>gi|1778432 (U79660) Treacher Collins syndrome [Homo sapiens]
            Length = 1411

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 1.0, P = 0.65
 Identities = 20/60 (33%), Positives = 33/60 (55%), Frame = -2

Query:   278 GGGSPRREEKRKSMGT-EGNTNTWPRQT*KKNAKSSANSNERDERAKKKKA--TTTEEQE 108
             G      EE +K MGT EG   + P+   K+  KS     +++++ KKKKA   +T++ E
Sbjct:  1335 GAKDEPEEELQKGMGTVEGGDQSNPKSK-KEKKKSDKRKKDKEKKEKKKKAKKASTKDSE 1393

Query:   107 A 105
             +
Sbjct:  1394 S 1394


>gi|3335336 (AC004512) Contains similarity to DnaJ gene YM8520.10 gb|825566
            from from S. cerevisiae cosmid gb|Z49705.  ESTs gb|Z47720 and
            gb|Z29879 come from this gene. [Arabidopsis thaliana]
            Length = 605

  Minus Strand HSPs:

 Score = 73 (25.7 bits), Expect = 1.1, P = 0.66
 Identities = 17/52 (32%), Positives = 29/52 (55%), Frame = -1

Query:   252 KEKKHGD*GQHEY--LAKTNIKKKREKLSQQQREGRTSKKKKSNNNRRTRSN 103
             KE++  D G +E     K   ++KR+K+ +++R+ R  KKKK    R   S+
Sbjct:    43 KERRKSDGGSYEREKRRKREKERKRKKIERKERKRRDMKKKKKTKKREYESD 94


>sp|P36043|YKU1_YEAST 64.6 KD PROTEIN IN TOR2-PAS1 INTERGENIC REGION
            >pir||S38038 hypothetical protein YKL201c - yeast (Saccharomyces
            cerevisiae)
            Length = 539

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 1.2, P = 0.70
 Identities = 19/62 (30%), Positives = 34/62 (54%), Frame = -3

Query:   292 DAKKQEAEVLGGRKRE-KAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQK 116
             + KKQE E    ++ E K       ++  +D+  KK    +    +  NE+++KK+Q++K
Sbjct:   450 EKKKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEE----KKKNEEEEKKKQEEK 505

Query:   115 NKK 107
             NKK
Sbjct:   506 NKK 508

 Score = 70 (24.6 bits), Expect = 5.8, P = 1.0
 Identities = 18/64 (28%), Positives = 34/64 (53%), Frame = -3

Query:   286 KKQEAEVLGGRKREKAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQKNKK 107
             KK+E E     + EK       +   +++ KKK  K +    +   E+KKKK++++K K+
Sbjct:   413 KKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKK--KEEEEKKKQEEEEKKKKEEEEKKKQ 470

Query:   106 Q*GK 95
             + G+
Sbjct:   471 EEGE 474


>gnl|PID|e234794 (Z70684) F28D1.8 [Caenorhabditis elegans]
            Length = 443

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 1.2, P = 0.70
 Identities = 23/82 (28%), Positives = 45/82 (54%), Frame = -1

Query:   279 RRRKS*AGGKEKKHGD*GQHEYLAKTNIKKKRE---KLSQQQREGRTSKKKKSNN----- 124
             +++K+  GGK+KK G  G+ +   K+ + K+++   K+ +++   + +KKKK N      
Sbjct:   310 KKKKTKKGGKKKKSGA-GKGKGKKKSKVSKEKKGGKKVQKKKPASKPTKKKKKNKPFSEH 368

Query:   123 -NRRTRSNE---GKHIL--CFTA 73
               ++ R N    G  +L  CF+A
Sbjct:   369 FEKKRRKNHLPIGSSVLNSCFSA 391

 Score = 70 (24.6 bits), Expect = 4.6, P = 0.99
 Identities = 21/73 (28%), Positives = 41/73 (56%), Frame = -3

Query:   295 TD-AKKQEAEVLGGRKRE----KAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKK 131
             TD  KK++    GG+K++    K  G + +++  + K  KK +K +P A++ T ++KK K
Sbjct:   305 TDKGKKKKKTKKGGKKKKSGAGKGKGKKKSKVSKEKKGGKKVQKKKP-ASKPTKKKKKNK 363

Query:   130 QQQQKNKKQ*GKTY 89
                +  +K+  K +
Sbjct:   364 PFSEHFEKKRRKNH 377


>gnl|PID|e325351 (Z97210) hypothetical protein [Schizosaccharomyces pombe]
            Length = 474

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 1.3, P = 0.73
 Identities = 16/57 (28%), Positives = 32/57 (56%), Frame = -3

Query:   277 EAEVLGGRKREKAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQKNKK 107
             EAEV G    +K   + ++     +  KK+ ++ +  A +   E+K+KK++++K KK
Sbjct:   416 EAEVNGVEDSKKRKSVESSEKDEDEAAKKEEKRRKKEAKKEKKEKKEKKEKKEKKKK 472


>gnl|PID|e1283519 (Z28201) ORF YKL201c [Saccharomyces cerevisiae]
            Length = 660

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 1.5, P = 0.78
 Identities = 19/62 (30%), Positives = 34/62 (54%), Frame = -3

Query:   292 DAKKQEAEVLGGRKRE-KAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQK 116
             + KKQE E    ++ E K       ++  +D+  KK    +    +  NE+++KK+Q++K
Sbjct:   571 EKKKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEE----KKKNEEEEKKKQEEK 626

Query:   115 NKK 107
             NKK
Sbjct:   627 NKK 629

 Score = 70 (24.6 bits), Expect = 7.4, P = 1.0
 Identities = 18/64 (28%), Positives = 34/64 (53%), Frame = -3

Query:   286 KKQEAEVLGGRKREKAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQKNKK 107
             KK+E E     + EK       +   +++ KKK  K +    +   E+KKKK++++K K+
Sbjct:   534 KKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKK--KEEEEKKKQEEEEKKKKEEEEKKKQ 591

Query:   106 Q*GK 95
             + G+
Sbjct:   592 EEGE 595


>pir||S02708 troponin T - fruit fly (Drosophila melanogaster)
            Length = 387

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 1.6, P = 0.81
 Identities = 17/67 (25%), Positives = 35/67 (52%), Frame = -2

Query:   290 RQETGGGSP---RREEKRKSMGTEGNTNTWPRQT*KKNAKSSANSNERDERAKKKKATTT 120
             R+ETG G P   +R+++++S   +     +  +  K+ +K      +  E+  K+K T  
Sbjct:    19 REETGEGDPEFIKRQDQKRS-DLDDQLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRA 77

Query:   119 EEQEAMRE 96
             EE++ M +
Sbjct:    78 EEEQKMAQ 85


>gi|1049086 (U30829) SRp55-3 [Homo sapiens]
            Length = 335

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 2.1, P = 0.88
 Identities = 22/71 (30%), Positives = 35/71 (49%), Frame = -1

Query:   300 GSPTPRNRRRKS*AGGKEKKHGD*GQHEYL---AKTNIKKKREKL-SQQQRE-GRTSKKK 136
             G    R++ RKS +  K K   D G H +    +K   +K R +  S+  +E G+   K 
Sbjct:   232 GRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKS 291

Query:   135 KSNNNRRTRSN 103
             KS +  ++RSN
Sbjct:   292 KSRSRSQSRSN 302


>pir||PS0009 glycinin A1aB1b precursor - soybean (fragments)
            Length = 53

  Plus Strand HSPs:

 Score = 59 (20.8 bits), Expect = 2.1, P = 0.88
 Identities = 11/18 (61%), Positives = 11/18 (61%), Frame = +3

Query:    87 KYVFPHCFLFFCCCCFFF 140
             K VF  CFL F  CCF F
Sbjct:     3 KLVFSLCFLLFSGCCFAF 20


>pir||S59043 spliling factor SRp55 - human >gi|1049088 (U30883) SRp55-1 [Homo
            sapiens]
            Length = 344

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 2.2, P = 0.89
 Identities = 22/71 (30%), Positives = 35/71 (49%), Frame = -1

Query:   300 GSPTPRNRRRKS*AGGKEKKHGD*GQHEYL---AKTNIKKKREKL-SQQQRE-GRTSKKK 136
             G    R++ RKS +  K K   D G H +    +K   +K R +  S+  +E G+   K 
Sbjct:   232 GRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKS 291

Query:   135 KSNNNRRTRSN 103
             KS +  ++RSN
Sbjct:   292 KSRSRSQSRSN 302


>gi|1685095 (U46781) orf2 [Pasteurella haemolytica]
            Length = 195

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 2.3, P = 0.90
 Identities = 21/64 (32%), Positives = 30/64 (46%), Frame = -3

Query:   295 TDAKKQEAEVLGGRKREKAWGLRATRIPGQDKHKKKTRKAQPTATRGTN--EQKKKKQQQ 122
             TD  KQ    LGG K  K           ++K K+K  K  PT +R  +  EQKK   ++
Sbjct:    19 TDKPKQPMPKLGGGKNRKLTRYELDAQAREEKRKRK-HKGLPTGSRNADPAEQKKAVVKE 77

Query:   121 QKNKK 107
              K+ +
Sbjct:    78 VKDPR 82


>gnl|PID|d1012343 (D83006) gene required for phosphoylation of
            oligosaccharides/ has high homology with YJR061w [Saccharomyces
            cerevisiae]
            Length = 1178

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 2.9, P = 0.95
 Identities = 19/62 (30%), Positives = 34/62 (54%), Frame = -3

Query:   292 DAKKQEAEVLGGRKRE-KAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQK 116
             + KKQE E    ++ E K       ++  +D+  KK    +    +  NE+++KK+Q++K
Sbjct:  1089 EKKKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEE----KKKNEEEEKKKQEEK 1144

Query:   115 NKK 107
             NKK
Sbjct:  1145 NKK 1147


>sp|Q01005|UL24_HSVSA GENE 20 PROTEIN >pir||WZBEM6 gene 20 protein - saimiriine
            herpesvirus 1 (strain 11) >gi|60342 (X64346) ORF 20; sim. to other
            HV [Saimiriine herpesvirus 2]
            Length = 303

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 3.5, P = 0.97
 Identities = 17/39 (43%), Positives = 25/39 (64%), Frame = -1

Query:   207 KTNIKKKREKLSQQQREGRTSKKKKSNNNRRTRSNEGKH 91
             +TN KK  ++L  +Q   R  KKK+ +NN+R R+N  KH
Sbjct:   239 RTN-KKSNDQLRARQANARPCKKKQ-HNNKRLRNNR-KH 274


>gi|3135473 (AF039081) Cre binding protein-like 2 [Homo sapiens]
            Length = 120

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 3.7, P = 0.97
 Identities = 18/40 (45%), Positives = 22/40 (55%), Frame = -1

Query:   258 GGKEKKHGD*GQHEYLAKTNIKKKREKLSQQQREGRTSKK 139
             GGK KK G  G+    AK ++K K E+  Q  RE R  KK
Sbjct:     8 GGKVKKPGKRGRKP--AKIDLKAKLERSRQSARECRARKK 45


>pir||B26696 hypothetical protein 1 (CYb-COII intergenic region) -
            Sauroleishmania tarentolae mitochondrion (SGC6) (fragment)
            >gi|896286 (M10126) NH2 terminus uncertain [Leishmania tarentolae]
            Length = 443

  Plus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 3.9, P = 0.98
 Identities = 18/43 (41%), Positives = 26/43 (60%), Frame = +2

Query:    89 ICFPSLLLVLLLLLLFFFLLVRPSRCCWLSF-SRFFFMFVLARY 217
             ICF   + +LL L  FFFL       C+L+F +RF FM ++ +Y
Sbjct:    53 ICF---IFLLLFLFCFFFLF------CFLNFDTRFVFMIIIMQY 87


>gi|310432 (L05111) envelope glycoprotein [Simian immunodeficiency virus]
           Length = 49

  Minus Strand HSPs:

 Score = 35 (12.3 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 8/22 (36%), Positives = 11/22 (50%), Frame = -2

Query:   128 TTTEEQEAMRENIFCVSQLRGC 63
             TTTE    + E I  V++   C
Sbjct:    23 TTTEAPTPVSEKIDMVNETSSC 44

 Score = 33 (11.6 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 7/17 (41%), Positives = 10/17 (58%), Frame = -2

Query:   170 NSNERDERAKKKKATTT 120
             N +E D+    K +TTT
Sbjct:     2 NKSETDKWGLAKSSTTT 18


>gi|954775 (L06352) This CDS feature is included to show the translation of the
           corresponding V_region. Presently translation qualifiers on V_region
           features are illegal. [Simian immunodeficiency virus] >gi|954779
           (L06354) This CDS feature is included to show the translation of the
           corresponding V_region. Presently translation qualifiers on V_region
           features are illegal. [Simian immunodeficiency virus] >gi|954791
           (L06360) This CDS feature is included to show the translation of the
           corresponding V_region. Presently translation qualifiers on V_region
           features are illegal. [Simian immunodeficiency virus] >gi|954793
           (L06361) This CDS feature is included to show the translation of the
           corresponding V_region. Presently translation qualifiers on V_region
           features are illegal. [Simian immunodeficiency virus]
           Length = 49

  Minus Strand HSPs:

 Score = 35 (12.3 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 8/22 (36%), Positives = 11/22 (50%), Frame = -2

Query:   128 TTTEEQEAMRENIFCVSQLRGC 63
             TTTE    + E I  V++   C
Sbjct:    23 TTTEAPTPVSEKIDMVNETSSC 44

 Score = 33 (11.6 bits), Expect = 3.9, Sum P(2) = 0.98
 Identities = 7/17 (41%), Positives = 10/17 (58%), Frame = -2

Query:   170 NSNERDERAKKKKATTT 120
             N +E D+    K +TTT
Sbjct:     2 NKSETDKWGLTKSSTTT 18


>gnl|PID|e312877 (Z72587) ORF YGL066w [Saccharomyces cerevisiae]
            Length = 543

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 3.9, P = 0.98
 Identities = 18/63 (28%), Positives = 36/63 (57%), Frame = -1

Query:   282 NRRRKS*AGGKEKKHGD*GQHEYLAKTNIKKKREKLSQQQREGRTSKKKKSNNNRRTRSN 103
             +R  ++  G   +K     + + L K  I+K+++K +QQQ++G+ SK++  N  +  + N
Sbjct:   161 HREHQTKIGAAAEKRAKQQELQKLQK-QIQKEQKKHTQQQKQGQRSKQRNVNGGKSAK-N 218

Query:   102 EGK 94
              GK
Sbjct:   219 GGK 221


>gnl|PID|e329895 (AJ000496) cyclic nucleotide-gated channel beta subunit
            [Rattus norvegicus]
            Length = 1339

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 4.3, P = 0.99
 Identities = 17/66 (25%), Positives = 29/66 (43%), Frame = -2

Query:   293 RRQETGGGSPRREEKRKSMGTEGNTNTWPRQT*KKNAKSSANSNERDERAKKKKATTTEE 114
             + +E  G    +EEK +    EG      ++  +K  K      E++E  K++K    EE
Sbjct:   417 KEEEENGEEEEKEEKEEKEEEEGKEEKEEKE--EKEEKEEEEKEEKEEEEKEEKEEEEEE 474

Query:   113 QEAMRE 96
             +E   E
Sbjct:   475 EEEEEE 480


>pir||S51364 sperm tail-specific protein mst101(2) - fruit fly (Drosophila
            hydei)
            Length = 1390

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 4.4, P = 0.99
 Identities = 16/52 (30%), Positives = 29/52 (55%), Frame = -3

Query:   259 GRKREKAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQKNKKQ 104
             G+K+ K  G ++ R   + K  +  +K +  AT+   E++ KKQ++   KKQ
Sbjct:   963 GKKKCKKLGKKSKRAAEKKKCAEAAKKEKEAATKKKCEERAKKQKEAAEKKQ 1014


>sp|Q08696|MST2_DROHY AXONEME-ASSOCIATED PROTEIN MST101(2) >gi|313202 (X73481)
            mst101(2) gene product [Drosophila hydei]
            Length = 1391

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 4.4, P = 0.99
 Identities = 16/52 (30%), Positives = 29/52 (55%), Frame = -3

Query:   259 GRKREKAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQKNKKQ 104
             G+K+ K  G ++ R   + K  +  +K +  AT+   E++ KKQ++   KKQ
Sbjct:   964 GKKKCKKLGKKSKRAAEKKKCAEAAKKEKEAATKKKCEERAKKQKEAAEKKQ 1015


>sp|P53165|YGG6_YEAST HYPOTHETICAL 72.9 KD PROTEIN IN RPB9-ALG2 INTERGENIC
            REGION >pir||S64073 hypothetical protein YGL066w - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e243288 (Z72588) ORF YGL066w
            [Saccharomyces cerevisiae]
            Length = 657

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 4.9, P = 0.99
 Identities = 18/63 (28%), Positives = 36/63 (57%), Frame = -1

Query:   282 NRRRKS*AGGKEKKHGD*GQHEYLAKTNIKKKREKLSQQQREGRTSKKKKSNNNRRTRSN 103
             +R  ++  G   +K     + + L K  I+K+++K +QQQ++G+ SK++  N  +  + N
Sbjct:   275 HREHQTKIGAAAEKRAKQQELQKLQK-QIQKEQKKHTQQQKQGQRSKQRNVNGGKSAK-N 332

Query:   102 EGK 94
              GK
Sbjct:   333 GGK 335


>sp|Q28092|CYL2_BOVIN CYLICIN II (MULTIPLE-BAND POLYPEPTIDE II) >pir||I46014
            cylicin II - bovine >gi|757754 (Z46789) cylicin II [Bos taurus]
            Length = 488

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 5.2, P = 0.99
 Identities = 23/63 (36%), Positives = 33/63 (52%), Frame = -3

Query:   292 DAKKQEAEVLGGRKREKAWGLRATRIPGQDKHKKKTR--KAQPT-ATRGTNEQKKKKQQQ 122
             DAKK + +   G K+ K     AT   G+ K  KK +  K  PT A    +E K KK  +
Sbjct:   379 DAKKDDKKDKKGSKKGKE---SATESEGEKKDSKKDKAGKKDPTKAGEKGDESKDKKDAK 435

Query:   121 QKNKKQ 104
             +K+ K+
Sbjct:   436 KKDSKK 441


>pir||S40923 hypothetical protein ZK1098.1 - Caenorhabditis elegans
            Length = 695

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 5.3, P = 0.99
 Identities = 21/73 (28%), Positives = 34/73 (46%), Frame = -1

Query:   300 GSPTPRNRRRKS*AGGKEKKHGD*GQHEYLAKTNIKKKREKLSQQQR---EGRTSKKKKS 130
             GS     +++K     K K+  +  + E   +   KKK++K S++ R   E R  K KKS
Sbjct:   610 GSEILEKKKKKKDKKKKNKRSDNNSESEGEIREKEKKKKKKHSKEDRMDDEERGKKSKKS 669

Query:   129 NNNRRTRSNEGKH 91
                  +RS   +H
Sbjct:   670 RKRSPSRSESPRH 682


>sp|P34600|YO61_CAEEL HYPOTHETICAL 84.7 KD PROTEIN ZK1098.1 IN CHROMOSOME III
            >gi|1067083 (Z22176) ZK1098.1 [Caenorhabditis elegans]
            Length = 724

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 5.5, P = 1.0
 Identities = 21/73 (28%), Positives = 34/73 (46%), Frame = -1

Query:   300 GSPTPRNRRRKS*AGGKEKKHGD*GQHEYLAKTNIKKKREKLSQQQR---EGRTSKKKKS 130
             GS     +++K     K K+  +  + E   +   KKK++K S++ R   E R  K KKS
Sbjct:   639 GSEILEKKKKKKDKKKKNKRSDNNSESEGEIREKEKKKKKKHSKEDRMDDEERGKKSKKS 698

Query:   129 NNNRRTRSNEGKH 91
                  +RS   +H
Sbjct:   699 RKRSPSRSESPRH 711


>sp|P10431|YIM8_BPPH1 HYPOTHETICAL IMMUNITY REGION PROTEIN 8 >pir||IMBP8
            immunity region protein 8 - phage phi-105 >prf||1112178N ORF 8
            [Bacteriophage phi-105]
            Length = 44

  Plus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 5.7, P = 1.0
 Identities = 17/39 (43%), Positives = 22/39 (56%), Frame = +2

Query:   110 LVLLLLLLFFFLLVRPSRCCWLSFSRFFFMFVLARYSCC 226
             +V+LLLLL +F L    R   + F + FF F L  YS C
Sbjct:     4 IVVLLLLLRYFRLALKVRILHI-FYKCFFEFFLT-YSNC 40


>gi|954773 (L06351) This CDS feature is included to show the translation of the
           corresponding V_region. Presently translation qualifiers on V_region
           features are illegal. [Simian immunodeficiency virus]
           Length = 42

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 5.7, P = 1.0
 Identities = 14/40 (35%), Positives = 19/40 (47%), Frame = -2

Query:   170 NSNERDERAKKKKATTTEEQEAMRENIFCVSQLRGCC*HD 51
             N +E D+    K +TTT     + E I  VS+   C  HD
Sbjct:     2 NKSETDKWGLTKSSTTTTTTTPVAEPIDMVSENSSCITHD 41


>gi|954789 (L06359) This CDS feature is included to show the translation of the
           corresponding V_region. Presently translation qualifiers on V_region
           features are illegal. [Simian immunodeficiency virus]
           Length = 43

  Minus Strand HSPs:

 Score = 55 (19.4 bits), Expect = 5.7, P = 1.0
 Identities = 15/41 (36%), Positives = 20/41 (48%), Frame = -2

Query:   170 NSNERDERAKKKKATTTEEQEA-MRENIFCVSQLRGCC*HD 51
             N +E D+    K +TTT E    + E I  VS+   C  HD
Sbjct:     2 NKSETDKWGLTKSSTTTTEAPTPVSEKIDMVSENSSCITHD 42


>sp|P50565|H2B1_CHLRE HISTONE H2B-I >pir||S59125 histone H2B - Chlamydomonas
            reinhardtii >gi|790702 (L41841) histone H2B [Chlamydomonas
            reinhardtii]
            Length = 153

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 5.7, P = 1.0
 Identities = 17/56 (30%), Positives = 26/56 (46%), Frame = -2

Query:   287 QETGGGSPRREEKRKSMGTEGNTNTWPRQT*KKNAKSSANSNERDERAKKKKATTT 120
             QE G  +P + E++     E       ++  KK AK    S E+ ++ KKK A  T
Sbjct:    12 QEAGAEAPAKAERKPK--AEKAAKKAKKEPSKKAAKEPKGSGEKKDKKKKKSAVET 65


>gi|3253105 (AF000196) strong similarity to the SNF2/RAD54 family of helicases;
            partial CDS [Caenorhabditis elegans]
            Length = 1359

  Minus Strand HSPs:

 Score = 69 (24.3 bits), Expect = 7.1, P = 1.0
 Identities = 17/57 (29%), Positives = 32/57 (56%), Frame = -2

Query:   269 SPRREEK--RKSMGTEGNTNTWPRQT*KKNAKSSANSNERD-ERAKKKKATTTEEQE 108
             SPR+  K  RK   +E  ++    +  +K +KS    +++  E++KKK+ T++ E E
Sbjct:    74 SPRKSSKKSRKRAKSESESDESDEEEDRKKSKSKKKVDQKKKEKSKKKRTTSSSEDE 130


>sp|Q03525|YM8H_YEAST HYPOTHETICAL 16.2 KD PROTEIN IN PRP24-RRN9 INTERGENIC
            REGION >pir||S54481 hypothetical protein YMR269w - yeast
            (Saccharomyces cerevisiae) >gi|809092 (Z49260) unknown
            [Saccharomyces cerevisiae]
            Length = 142

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 7.1, P = 1.0
 Identities = 18/61 (29%), Positives = 32/61 (52%), Frame = -3

Query:   286 KKQEAEVLGGRKREKAWGLRATRIPGQDKHK-KKTRKAQPTATRGTNEQKKKKQQQQKNK 110
             KK+EA  +           R  R    +K K KK +K + T+    +++KKKK+ ++++K
Sbjct:    42 KKEEASFVVSSASSSKGKKRRRRDEDDNKVKRKKLKKDKKTSNDSESKKKKKKKSKKESK 101

Query:   109 K 107
             K
Sbjct:   102 K 102

 Score = 65 (22.9 bits), Expect = 7.1, P = 1.0
 Identities = 20/64 (31%), Positives = 34/64 (53%), Frame = -3

Query:   286 KKQEAEVLGGRKREKAWGLRATRIPGQDKHK-KKTRKAQPTATRGTNEQKKKKQQQQKNK 110
             KK+EA  +           R  R    +K K KK +K + T+    +++KKKK+ ++++K
Sbjct:    42 KKEEASFVVSSASSSKGKKRRRRDEDDNKVKRKKLKKDKKTSNDSESKKKKKKKSKKESK 101

Query:   109 KQ*GK 95
             K  GK
Sbjct:   102 K--GK 104


>pir||S60811 M protein precursor - Streptococcus pyogenes (serotype M36)
            (fragment)
            Length = 96

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 7.2, P = 1.0
 Identities = 16/42 (38%), Positives = 28/42 (66%), Frame = -1

Query:   222 HEYLAKT-NIKKKREKLSQQQREGRTSKKKK--SNNNRRTRSN 103
             ++Y  K  N+ ++ EKL++Q +E  TS+K+K  ++N R T  N
Sbjct:    44 NDYEIKNHNLTQENEKLTEQNKE-LTSEKEKLTTDNGRLTEQN 85


>sp|P36042|YKU2_YEAST HYPOTHETICAL 21.2 KD PROTEIN IN TOR2-PAS1 INTERGENIC
            REGION >pir||S38039 hypothetical protein YKL202w - yeast
            (Saccharomyces cerevisiae) >gi|486358 (Z28201) ORF YKL202w
            [Saccharomyces cerevisiae]
            Length = 193

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 7.2, P = 1.0
 Identities = 22/63 (34%), Positives = 32/63 (50%), Frame = +1

Query:   100 LIASCSSVVVAFFFFARSSLSLLLAELFAFFFYVCLGQVFVLPSVPMLFLFSSRLGLPPP 279
             L +SC S+  +FF   RSS  L L    ++F ++      +LP+   L L SS   LPP 
Sbjct:    67 LHSSCFSLPASFFPLLRSSSFLHLHS--SYFLHLHSSSFLLLPASSSLLLPSSFSPLPPA 124

Query:   280 VSW 288
              S+
Sbjct:   125 SSF 127


>pir||I49627 testosterone 16a-hydroxylase type c - mouse (fragment) >gi|192890
            (M60359) testosterone 16a-hydroxylase type c [Mus musculus]
            Length = 57

  Plus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 7.3, P = 1.0
 Identities = 12/19 (63%), Positives = 15/19 (78%), Frame = +2

Query:    98 PSLLLVLLLLLLFFFLLVR 154
             PS+LL+L +LL  F LLVR
Sbjct:     3 PSVLLLLAVLLSLFLLLVR 21


>bbs|164350 cytochrome P450HPB-1 {N-terminal} [hamsters, liver, microsomes,
            Peptide Partial, 28 aa]
            Length = 28

  Plus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 7.3, P = 1.0
 Identities = 13/19 (68%), Positives = 14/19 (73%), Frame = +2

Query:    98 PSLLLVLLLLLLFFFLLVR 154
             PS LL+L LLL F  LLVR
Sbjct:     3 PSTLLLLTLLLSFLVLLVR 21


>gnl|PID|e352081 (Y13586) parathymosin [Homo sapiens]
            Length = 63

  Minus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 7.3, P = 1.0
 Identities = 11/37 (29%), Positives = 21/37 (56%), Frame = -1

Query:   207 KTNIKKKREKLSQQQREGRTSKKKKSNNNRRTRSNEG 97
             +T +++K++KL + +R  R  K KK +       +EG
Sbjct:     3 RTGLRRKKKKLPRMER--RKMKGKKKDEEEEEEDDEG 37


>gi|2895190 (AF019049) 3-oxo-5-alpha-steroid 4-dehydrogenase 1; steroid
            5-alpha-reductase [Rattus norvegicus]
            Length = 71

  Plus Strand HSPs:

 Score = 54 (19.0 bits), Expect = 7.3, P = 1.0
 Identities = 17/43 (39%), Positives = 20/43 (46%), Frame = +3

Query:   132 FFFFCSFVPLVAVG*AFRVFFLCLSWPGIRVALSPHAFSLFLP 260
             F  F S V L +VG  +  +     WPGIRV   P  F   LP
Sbjct:    18 FMAFVSIVGLRSVGSPYGRY--SPQWPGIRVPARPAWFIQELP 58


>gi|533560 (U11941) emml gene product [Streptococcus pyogenes]
           Length = 97

  Minus Strand HSPs:

 Score = 61 (21.5 bits), Expect = 7.7, P = 1.0
 Identities = 16/42 (38%), Positives = 28/42 (66%), Frame = -1

Query:   222 HEYLAKT-NIKKKREKLSQQQREGRTSKKKK--SNNNRRTRSN 103
             ++Y  K  N+ ++ EKL++Q +E  TS+K+K  ++N R T  N
Sbjct:    44 NDYEIKNHNLTQENEKLTEQNKE-LTSEKEKLTTDNGRLTEQN 85


>sp|P36935|YSV_BPP2 HYPOTHETICAL 30.4 KD PROTEIN IN S-V INTERGENIC REGION
            (ORF-30) >gi|3139100 (AF063097) Orf30 [Bacteriophage P2]
            Length = 261

  Plus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 7.8, P = 1.0
 Identities = 17/41 (41%), Positives = 23/41 (56%), Frame = +1

Query:    73 SCETQNMFSLIAS--CSSVVVAFFFFARSSLSLLLAELFAF 189
             S    N++ LI    CS  V+AFF F +S+L  L+A  F F
Sbjct:     3 SYNVTNVWGLIVFFLCSFAVLAFFSFGKSNLMRLIAHYFNF 43


>sp|P36099|YKD0_YEAST HYPOTHETICAL 23.0 KD PROTEIN IN IXR1-TFA1 INTERGENIC
            REGION >pir||S37847 hypothetical protein YKL030w - yeast
            (Saccharomyces cerevisiae) >gi|486029 (Z28029) ORF YKL030w
            [Saccharomyces cerevisiae]
            Length = 201

  Plus Strand HSPs:

 Score = 66 (23.2 bits), Expect = 7.8, P = 1.0
 Identities = 10/20 (50%), Positives = 15/20 (75%), Frame = +3

Query:   108 FLFFCCCCF-FFFCSFVPLV 164
             FL +CCCC+ F++C  V L+
Sbjct:     2 FLCYCCCCYCFYYCIIVLLL 21


>gi|2565011 (AC002983) putative mudrA-like retrotransposon-associated protein
            [Arabidopsis thaliana]
            Length = 761

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 8.8, P = 1.0
 Identities = 17/56 (30%), Positives = 31/56 (55%), Frame = -3

Query:   250 REKAWGLRATRIPGQDKHKKKTRKAQPTATRGTNEQKKKKQQQQKNKKQ*GKTYFV 83
             +EK    R ++  G D+ +KK +KA+    + TNE+  KK+++ K +     T F+
Sbjct:   698 KEKVPRKRKSKNDGNDEIEKKAKKAK-NDKKDTNEKDSKKEKKSKKETHMPDTIFI 752


>gnl|PID|d1026409 (AB011125) KIAA0553 protein [Homo sapiens]
            Length = 1095

  Minus Strand HSPs:

 Score = 70 (24.6 bits), Expect = 8.8, P = 1.0
 Identities = 18/64 (28%), Positives = 32/64 (50%), Frame = -1

Query:   294 PTPRNRRRKS*AGGKEKKHGD*GQHEYLAKTNIKKKREKLSQQQREGRTSKKKKSNNNRR 115
             P+ + R  KS    K+KKH    +H+   K + ++K    S +   G  SKK+K    ++
Sbjct:   256 PSKKERSGKSHRHKKKKKHKKSSKHKRKHKADTEEK----SSKAESGEKSKKRKKRKRKK 311

Query:   114 TRSN 103
              +S+
Sbjct:   312 NKSS 315


>pir||A34259 cytochrome P450mt4, phenobarbital-inducible, mitochondrial,
            hepatic - rat (fragment)
            Length = 42

  Plus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 9.3, P = 1.0
 Identities = 12/19 (63%), Positives = 15/19 (78%), Frame = +2

Query:    98 PSLLLVLLLLLLFFFLLVR 154
             PS+LL+L LL+ F  LLVR
Sbjct:     3 PSILLLLALLVGFLLLLVR 21


>sp|Q26377|CORZ_DROME CORAZONIN PRECURSOR (CONTAINS:
            CORAZONIN-PRECURSOR-RELATED PEPTIDE (CPRP)) >pir||JC2384
            preprocorazonin - fruit fly (Drosophila melanogaster) >bbs|157387
            (S74038) preprocorazonin [Drosophila melanogaster, Peptide, 72 aa]
            [Drosophila melanogaster]
            Length = 72

  Plus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 9.3, P = 1.0
 Identities = 11/21 (52%), Positives = 13/21 (61%), Frame = +1

Query:   157 LSLLLAELFAFFFYVCLGQVF 219
             L LLL  LF F   +C+GQ F
Sbjct:     2 LRLLLLPLFLFTLSMCMGQTF 22


>pir||S58143 gene 14 protein - phage SPP1 >gi|1052812 (X89721) prodct required
            for head morphogenesis [Bacteriophage SPP1] >gnl|PID|e244711
            (X97918) gene 14 [Bacteriophage SPP1]
            Length = 58

  Minus Strand HSPs:

 Score = 53 (18.7 bits), Expect = 9.3, P = 1.0
 Identities = 10/40 (25%), Positives = 22/40 (55%), Frame = -1

Query:   213 LAKTNIKKKREKLSQQQREGRTSKKKKSNNNRRTRSNEGK 94
             +AK   K++ E   + + E + S+K++    +  + +EGK
Sbjct:    10 IAKQREKEREEAARKAEEEKKASEKRQKGAQKPKKDSEGK 49


>gi|3377809 (AF075597) contains similarity to SRF-type transcription factors
            (DNA-binding and dimerization domain) (PFam: transcript_fact.hmm,
            score: 15.85) [Arabidopsis thaliana]
            Length = 196

  Minus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 9.5, P = 1.0
 Identities = 15/46 (32%), Positives = 24/46 (52%), Frame = -2

Query:   236 GTEGNTNTWPRQT*KKNAKSSANSNERDERAKKKKATTTEEQEAMR 99
             G +G   TWP++  +   K  A S  ++   +KKK T +  QE +R
Sbjct:    46 GPDGELRTWPKE--RNTVKDMA-SRYKEATKRKKKRTLSTLQERLR 88


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.93
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.357   0.160   0.628  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.358   0.164   0.635  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.318   0.135   0.401    0.355   0.156   0.533  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.340   0.148   0.453  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.328   0.135   0.417  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.317   0.130   0.379    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      100        96       10.  64 3 1000 22  0.10    32
                                                     28  0.095   34
   +2      0      100        96       10.  64 3 1000 22  0.10    32
                                                     28  0.095   34
   +1      0      101        96       10.  64 3 1000 22  0.10    32
                                                     28  0.095   34
   -1      0      101        97       10.  64 3 1000 22  0.10    32
                                                     28  0.097   34
   -2      0      100        95       10.  64 3 1000 22  0.099   32
                                                     28  0.12    33
   -3      0      100        98       10.  65 3 1000 22  0.10    32
                                                     28  0.099   34


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  67
  No. of states in DFA:  279 (28 KB)
  Total size of DFA:  34 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  33.25u 1.09s 34.34t  Elapsed: 00:00:07
  Total cpu time:  33.32u 5.22s 38.54t  Elapsed: 00:00:11
  Start:  Thu Sep 24 17:10:00 1998   End:  Thu Sep 24 17:10:11 1998

Date: 17:29:32 on Mon 18 Dec 117.