blastx_gbnr_files/CcruzaQ_941_blastx.Z


BLASTX 2.0a19MP-WashU [05-Feb-1998] [Build sol2.5-ultra 01:47:30 05-Feb-1998]

Reference:  Gish, Warren (1994-1997).  unpublished.
Gish, Warren and David J. States (1993).  Identification of protein coding
regions by database similarity search.  Nat. Genet. 3:266-72.

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame in the query sequence codes for protein
and that significant alignments will involve only coding reading frames.

Query=  CcruzaQ_941
        (635 letters)

  Translating both strands of query sequence in all 6 reading frames

Database:  /usr/local/db/others/blast/nrdb
           322,836 sequences; 97,797,364 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
  Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N

A gnl|PID|d1010075     (D50806) elongation factor 2 [Try... +1  1019  4.0e-102  1
A gnl|PID|d1005333     (D21259) elongation factor 2 [Ent... +1   682  2.1e-66   1
A sp|P09445|EF2_CRIGR  ELONGATION FACTOR 2 (EF-2) >pir||... +1   676  8.9e-66   1
A sp|P05086|EF2_MESAU  ELONGATION FACTOR 2 (EF-2) >pir||... +1   676  8.9e-66   1
A sp|P05197|EF2_RAT    ELONGATION FACTOR 2 (EF-2) >pir||... +1   676  8.9e-66   1
A prf||1606211A        elongation factor 2 [Rattus norve... +1   676  8.9e-66   1
A gi|600159            (U17362) elongation factor 2 [Cri... +1   676  8.9e-66   1
A sp|P13639|EF2_HUMAN  ELONGATION FACTOR 2 (EF-2) >pir||... +1   674  1.5e-65   1
A sp|Q90705|EF2_CHICK  ELONGATION FACTOR 2 (EF-2) >gi|11... +1   672  2.4e-65   1
A sp|Q06193|EF2_ENTHI  ELONGATION FACTOR 2 (EF-2) >gi|15... +1   670  3.9e-65   1
A sp|O14460|EF2_SCHPO  ELONGATION FACTOR 2 (EF-2) >gnl|P... +1   648  8.3e-63   1
A sp|P28996|EF2_CHLKE  ELONGATION FACTOR 2 (EF-2) >pir||... +1   645  1.7e-62   1
A gnl|PID|d1014510     (D89151) similar to Saccharomyces... +1   644  2.2e-62   1
A gnl|PID|e323877      (Z97178) elongation factor 2 [Bet... +1   635  2.0e-61   1
A sp|P13060|EF2_DROME  ELONGATION FACTOR 2 (EF-2) >pir||... +1   629  8.5e-61   1
A sp|P29691|EF2_CAEEL  ELONGATION FACTOR 2 (EF-2) >gnl|P... +1   626  1.8e-60   1
A pir||A40411          translation elongation factor eEF... +1   606  2.3e-58   1
A gnl|PID|e1191382     (Y09664) translation elongation f... +1   602  6.2e-58   1
A sp|O13430|EF2_CANAL  ELONGATION FACTOR 2 (EF-2)           +1   602  6.2e-58   1
A sp|P32324|EF2_YEAST  ELONGATION FACTOR 2 (EF-2) >pir||... +1   598  1.6e-57   1
A gnl|PID|d1006779     (D29835) elongation factor 2 [Gia... +1   586  3.1e-56   1
A gnl|PID|d1024975     (D78481) elongation factor 2 [Tri... +1   583  6.4e-56   1
A gnl|PID|d1024974     (D78480) elongation factor 2 [Tri... +1   579  1.7e-55   1
A sp|Q17152|EF2_BLAHO  ELONGATION FACTOR 2 (EF-2) >gnl|P... +1   577  7.0e-55   1
A sp|Q23716|EF2_CRYPV  ELONGATION FACTOR 2 (EF-2) >gi|70... +1   570  2.7e-54   1
A sp|P15112|EF2_DICDI  ELONGATION FACTOR 2 (EF-2) >pir||... +1   504  1.2e-53   2
A pir||S07567          translation elongation factor 2 h... +1   559  2.2e-53   1
A gnl|PID|e301029      (Y10991) Elongation factor 2 [Nic... +1   493  2.2e-46   1
A gi|181969            (M19997) elongation factor 2 [Hom... +1   484  2.0e-45   1
A gi|203997            (K03502) elongation factor 2 [Rat... +1   418  2.0e-38   1
A gnl|PID|d1012136     (D79220) Peptide Elongation Facto... +1   384  7.7e-34   1
A gi|2105430           (U97079) U5-116kD [Mus musculus]     +1   351  3.6e-30   1
A gnl|PID|d1005229     (D21163) similar to human elongat... +1   351  3.7e-30   1
A sp|P29050|EF2_PYRWO  ELONGATION FACTOR 2 (EF-2) >pir||... +1   339  3.7e-29   1
A sp|O28385|EF2_ARCFU  ELONGATION FACTOR 2 (EF-2) >gi|26... +1   330  3.5e-28   1
A gi|549848            (M86958) putative [Caenorhabditis... +1   325  1.7e-27   1
A gnl|PID|d1028961     (AB009528) 735aa long hypothetica... +1   323  2.0e-27   1
A gi|1213536           (U50193) the above GenBank entry ... +1   325  2.2e-27   1
A sp|O27131|EF2_METTH  ELONGATION FACTOR 2 (EF-2) >gi|26... +1   305  1.8e-25   1
A sp|Q58448|EF2_METJA  ELONGATION FACTOR 2 (EF-2) >pir||... +1   301  4.6e-25   1
A sp|P33159|EF2_DESMO  ELONGATION FACTOR 2 (EF-2) >pir||... +1   297  1.3e-24   1
A gi|849206            (U28373) Etf1p: Elongation factor... +1   287  5.6e-24   1
A sp|P26752|EF2_THEAC  ELONGATION FACTOR 2 (EF-2) >pir||... +1   284  3.2e-23   1
A sp|P30925|EF2_SULSO  ELONGATION FACTOR 2 (EF-2) >pir||... +1   283  4.2e-23   1
A prf||2004270A        elongation factor 2 [Sulfolobus s... +1   283  4.2e-23   1
A gi|2130649           (AF000576) EF-2 [Rattus norvegicus]  +1   266  2.5e-22   1
A sp|P53893|YNQ3_YEAST HYPOTHETICAL 124.5 KD PROTEIN IN ... +1   271  1.6e-21   1
A gnl|PID|e212187      (X92971) translocation elongation... +1   271  1.6e-21   1
A sp|P14823|EF2_HALHA  ELONGATION FACTOR 2 (EF-2) >pir||... +1   267  2.1e-21   1
A gi|1184709           (U41261) elongation factor 2 [uni... +1   266  2.7e-21   1
A sp|P23112|EF2_SULAC  ELONGATION FACTOR 2 (EF-2) >pir||... +1   265  3.6e-21   1
A sp|P09604|EF2_METVA  ELONGATION FACTOR 2 (EF-2) >pir||... +1   262  7.4e-21   1
A gnl|PID|e1294522     (AL023704) translocation elongati... +1   252  1.5e-19   1
A gi|1675353           (U75403) elongation factor 2 [Rat... +1   220  1.9e-17   1
A sp|P36048|GI10_YEAST GIN10 PROTEIN >pir||S38003 transl... +1   192  3.9e-13   1
A sp|P29541|EFG_STRRA  ELONGATION FACTOR G (EF-G) >pir||... +1   181  7.2e-13   1
A sp|P13551|EFG_THETH  ELONGATION FACTOR G (EF-G) >pir||... +1   186  9.9e-13   1
A pdb|1EFG|A           Thermus thermophilus                 +1   186  9.9e-13   1
A sp|P02996|EFG_ECOLI  ELONGATION FACTOR G (EF-G) >gi|41... +1   176  1.2e-11   1
A sp|P26229|EFG_SALTY  ELONGATION FACTOR G (EF-G) >pir||... +1   174  2.0e-11   1
A pir||S20656          translation elongation factor G -... +1   173  2.5e-11   1
A sp|P28371|EFG1_SYNY3 ELONGATION FACTOR G 1 (EF-G 1) >g... +1   173  2.5e-11   1
A sp|P75544|EFG_MYCPN  ELONGATION FACTOR G (EF-G) >pir||... +1   172  3.1e-11   1
A gi|3328868           (AE001317) Elongation Factor G [C... +1   171  4.0e-11   1
A sp|P43925|EFG_HAEIN  ELONGATION FACTOR G (EF-G) >pir||... +1   171  4.1e-11   1
A sp|P47335|EFG_MYCGE  ELONGATION FACTOR G (EF-G) >pir||... +1   170  5.1e-11   1
A sp|P41084|EFG_RICPR  ELONGATION FACTOR G (EF-G) >gi|98... +1   170  5.2e-11   1
A prf||0905186A        elongation factor G [Escherichia ... +1   170  5.2e-11   1
A pir||EFECG           translation elongation factor EF-... +1   170  5.3e-11   1
A sp|P38525|EFG_THEMA  ELONGATION FACTOR G (EF-G)           +1   169  6.4e-11   1
A gi|2654448           (U78300) elongation factor G [Thi... +1   169  6.7e-11   1
A bbs|57690            (S57688) EF-G=elongation factor G... +1   166  1.4e-10   1
A gi|402753            (X71439) translation elongation f... +1   166  1.4e-10   1
A pir||S35701          translation elongation factor G, ... +1   166  1.7e-10   1
A sp|P34811|EFGC_SOYBN ELONGATION FACTOR G, CHLOROPLAST ... +1   166  1.7e-10   1
A sp|P56002|EFG_HELPY  ELONGATION FACTOR G (EF-G) >gi|23... +1   164  2.3e-10   1
A gi|2982776           (AE000669) elongation factor EF-G... +1   164  2.3e-10   1
A sp|P18667|EFG_ANANI  ELONGATION FACTOR G (EF-G) >pir||... +1   160  6.1e-10   1
A sp|P13550|EFG_SPIPL  ELONGATION FACTOR G (EF-G) >pir||... +1   159  7.9e-10   1
A sp|P74228|EFG2_SYNY3 ELONGATION FACTOR G 2 (EF-G 2) >g... +1   157  1.3e-09   1
A sp|P70782|EFG_AGRTU  ELONGATION FACTOR G (EF-G) >gnl|P... +1   157  1.3e-09   1
A gi|3322737           (AE001222) translation elongation... +1   155  2.0e-09   1
A pir||S38928          elongation factor G - Aquifex pyr... +1   154  2.6e-09   1
A sp|P46211|EFG_AQUPY  ELONGATION FACTOR G (EF-G) >gi|64... +1   154  2.7e-09   1
A gnl|PID|e1309416     (AL031013) elongation factor G [S... +1   151  1.1e-08   1
A gi|414451            (U01722) unknown [Mycoplasma geni... +1   142  5.2e-08   1
A gi|192989            (M76131) elongation factor 2 [Mus... +1   143  7.8e-08   1
A gi|2688449           (AE001155) translation elongation... +1   145  2.5e-07   1
A sp|P30767|EFG_MYCLE  ELONGATION FACTOR G (EF-G) >pir||... +1   144  3.5e-07   1
A sp|O30913|EFG_BORBU  ELONGATION FACTOR G (EF-G) >gi|24... +1   143  5.3e-07   1
A gi|1127771           (U40242) elongation factor 2 [uni... +1   121  7.3e-07   1
A gnl|PID|e1299745     (AL021943) fusA [Mycobacterium tu... +1   142  7.4e-07   1
A sp|P09952|EFG_MICLU  ELONGATION FACTOR G (EF-G) >pir||... +1   138  2.7e-06   1
A sp|P80868|EFG_BACSU  ELONGATION FACTOR G (EF-G) (VEGET... +1   137  3.7e-06   1
A gi|3918              (X58378) mitochondrial elongation... +1   133  1.4e-05   1
A sp|P25039|EFG1_YEAST ELONGATION FACTOR G, MITOCHONDRIA... +1   132  1.9e-05   1
A gi|2688636           (AE001170) translation elongation... +1   128  5.1e-05   1
A gi|3323075           (AE001248) translation elongation... +1   128  5.4e-05   1
A gnl|PID|e304406      (Z83235) K10C3.5 [Caenorhabditis ... +1   127  0.00010   1
A bbs|134292           (S62928) PRB1M precursor protein=... -2   120  0.00012   1
A sp|P04280|PRP1_HUMAN SALIVARY PROLINE-RICH PROTEIN PRE... -2   120  0.00016   1
A pir||PIHUB6          salivary proline-rich protein pre... -2   120  0.00021   1
A bbs|134294           (S62941) Ps 2=basic proline-rich ... -2   119  0.00024   1
A bbs|134296           (S62929) PRB1L precursor protein=... -2   118  0.00032   1
A sp|P02812|PRP2_HUMAN SALIVARY PROLINE-RICH PROTEIN PRE... -2   115  0.00035   1
A bbs|134298           (S62936) PRB1S precursor protein=... -2   113  0.00051   1
A bbs|175466           (S80905) Con1=salivary concanaval... -2   115  0.00083   1
A sp|P39677|EFG2_YEAST ELONGATION FACTOR G, MITOCHONDRIA... +1   117  0.0015    1
A sp|Q07803|EFGM_RAT   ELONGATION FACTOR G, MITOCHONDRIA... +1   108  0.015     1
A sp|P26651|TTP_HUMAN  TRISTETRAPROLINE (TTP) (TIS11A) (... -2   103  0.017     1
A sp|P03181|YHL1_EBV   HYPOTHETICAL BHLF1 PROTEIN >pir||... -2   106  0.021     1
A pir||B61510          translation elongation factor eEF... +1    79  0.047     1
A gi|190504            (K03205) salivary proline-rich pr... -2    95  0.051     1
A gi|190506            (K03206) salivary proline-rich pr... -2    90  0.14      1
A gi|2589188           (AF005080) skin-specific protein ... +3    78  0.22      1
A sp|P10162|PRPL_HUMAN SALIVARY PROLINE-RICH PROTEIN PO ... -2    91  0.28      1
A gnl|PID|e1216611     (AL021006) hypothetical protein R... -3    71  0.32      1
A pir||PIHUSD          salivary proline-rich glycoprotei... -2    91  0.33      1
A gi|3044086           (AF055904) unknown [Myxococcus xa... -2    94  0.33      1
A sp|P13983|EXTN_TOBAC EXTENSIN PRECURSOR (CELL WALL HYD... -2    94  0.38      1
A pir||D38355          basic proline-rich peptide IB-8a ... -2    81  0.40      1
A pir||B60328          translation elongation factor G h... +1    84  0.75      1
A sp|P34810|CD68_HUMAN MACROSIALIN PRECURSOR (GP110) (CD... -2    87  0.76      1
A bbs|175469           (S80916) parotid "o" protein, Po=... -2    84  0.79      1
A pir||A27307          proline-rich phosphoprotein (gene... -2    81  0.83      1
A gi|158442            (J01134) glue protein (partial) [... +2    65  0.83      1
A pir||S51892          probable membrane protein YOL105c... -1    88  0.87      1
A gi|190475            (K02576) salivary proline-rich pr... -2    67  0.88      1
A pir||S20590          exo-alpha-sialidase (EC 3.2.1.18)... -2    89  0.89      2
A prf||1001181A        peptide PH,basic Pro rich [Homo s... -2    64  0.89      1
A gi|553623            (K02578) salivary proline-rich pr... -2    64  0.89      1
A gi|190474            (K02576) salivary proline-rich pr... -2    80  0.91      1
A gi|158434            (J01130) glue protein (partial) [... +2    62  0.98      1
A gi|552134            (J01136) glue protein (partial) [... +2    62  0.98      1
A gi|2853297           (AF007192) intestinal mucin [Homo... -1    82  0.993     1
A sp|P11131|TET5_ENTFA TETRACYCLINE RESISTANCE PROTEIN T... +1    85  0.995     1
A gi|975710            (X90939) tetM protein [Streptococ... +1    85  0.995     1
A bbs|137280           PRP II-1=secreted proline-rich pr... -2    77  0.996     1
A pir||A49016          Gag-JunD fusion protein - JDV vir... -2    60  0.998     1
A pir||S37283          tetracycline resistance protein t... +1    84  0.9992    1
A gnl|PID|e276445      (Z81264) nuclear protein [Sus scr... -2    72  0.9995    1
A gi|3153821           (AF062655) plenty-of-prolines-101... -2    85  0.9996    1
A sp|P53781|TTP_BOVIN  TRISTETRAPROLINE (TTP) (TIS11A) (... -2    80  0.9996    1
A sp|P32323|AGA1_YEAST A-AGGLUTININ ATTACHMENT SUBUNIT P... -1    84  0.9997    1
A sp|P09757|TETM_UREUR TETRACYCLINE RESISTANCE PROTEIN T... +1    83  0.9999    1
A sp|P21598|TET9_ENTFA TETRACYCLINE RESISTANCE PROTEIN T... +1    83  0.9999    1
A gi|3005587           (AF048977) Ser/Arg-related nuclea... -2    84  0.99991   1



>gnl|PID|d1010075 (D50806) elongation factor 2 [Trypanosoma cruzi]
            Length = 776

  Plus Strand HSPs:

 Score = 1019 (358.7 bits), Expect = 4.0e-102, P = 4.0e-102
 Identities = 201/211 (95%), Positives = 203/211 (96%), Frame = +1

Query:     1 DKPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVS 180
             DKPVQRTVLMMGRYQEAVED PCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVS
Sbjct:   400 DKPVQRTVLMMGRYQEAVEDMPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVS 459

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 360
             PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ
Sbjct:   460 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 519

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             ED +   GAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCV MEE
Sbjct:   520 EDFM--NGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVEMEE 577

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             GLNAGSEADPKVRARFLAD FDWDVA+AR I
Sbjct:   578 GLNAGSEADPKVRARFLADKFDWDVAEARKI 608


>gnl|PID|d1005333 (D21259) elongation factor 2 [Entamoeba histolytica]
            Length = 762

  Plus Strand HSPs:

 Score = 682 (240.1 bits), Expect = 2.1e-66, P = 2.1e-66
 Identities = 135/210 (64%), Positives = 164/210 (78%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRT+LMMGRY + +++ PCGNV+GLVGVD+Y++KS TITD  ++ H ++DMK+SVSP
Sbjct:   398 KNIQRTMLMMGRYTDPIDECPCGNVIGLVGVDQYLLKSGTITDS-DTAHIIKDMKFSVSP 456

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVE KNPSDLPKLVEG+KRLS+SDPL +C  EESGEHIVAGAGELHLE+CLKDLQE
Sbjct:   457 VVRVAVETKNPSDLPKLVEGMKRLSRSDPLCLCYTEESGEHIVAGAGELHLEVCLKDLQE 516

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G PL V+EPVVSFRET+T+ S IQCLSKSAN  NRLF R  P  E L   +E G
Sbjct:   517 DYCS--GVPLIVTEPVVSFRETITEPSRIQCLSKSANNQNRLFMRAFPFAEGLAEDIEAG 574

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                  + D K RA+FL++ + WDV +AR I
Sbjct:   575 -EIKPDTDFKERAKFLSEKYGWDVDEARKI 603


>sp|P09445|EF2_CRIGR ELONGATION FACTOR 2 (EF-2) >pir||A28660 translation
            elongation factor eEF-2 - hamster >gi|387049 (J03200) elongation
            factor 2 [Cricetus cricetus]
            Length = 858

  Plus Strand HSPs:

 Score = 676 (238.0 bits), Expect = 8.9e-66, P = 8.9e-66
 Identities = 132/210 (62%), Positives = 167/210 (79%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             KP+QRT+LMMGRY E +ED PCGN+VGLVGVD+++VK+ TIT   E  H +R MK+SVSP
Sbjct:   445 KPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTF-EHAHNMRVMKFSVSP 503

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+E
Sbjct:   504 VVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEE 563

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G
Sbjct:   564 DHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKG 620

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                 +  + K RAR+LA+ ++WDVA+AR I
Sbjct:   621 -EVSARQELKARARYLAEKYEWDVAEARKI 649


>sp|P05086|EF2_MESAU ELONGATION FACTOR 2 (EF-2) >pir||A25440 translation
            elongation factor eEF-2 - hamster >gi|304505 (M13708) elongation
            factor 2 [Cricetulus griseus]
            Length = 858

  Plus Strand HSPs:

 Score = 676 (238.0 bits), Expect = 8.9e-66, P = 8.9e-66
 Identities = 132/210 (62%), Positives = 167/210 (79%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             KP+QRT+LMMGRY E +ED PCGN+VGLVGVD+++VK+ TIT   E  H +R MK+SVSP
Sbjct:   445 KPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTF-EHAHNMRVMKFSVSP 503

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+E
Sbjct:   504 VVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEE 563

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G
Sbjct:   564 DHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKG 620

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                 +  + K RAR+LA+ ++WDVA+AR I
Sbjct:   621 -EVSARQELKARARYLAEKYEWDVAEARKI 649


>sp|P05197|EF2_RAT ELONGATION FACTOR 2 (EF-2) >pir||EFRT2 translation
            elongation factor eEF-2 - rat >gi|56082 (Y07504) EF-2 (AA 1-858)
            [Rattus norvegicus] >prf||1507204A elongation factor 2 [Rattus
            norvegicus]
            Length = 858

  Plus Strand HSPs:

 Score = 676 (238.0 bits), Expect = 8.9e-66, P = 8.9e-66
 Identities = 132/210 (62%), Positives = 167/210 (79%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             KP+QRT+LMMGRY E +ED PCGN+VGLVGVD+++VK+ TIT   E  H +R MK+SVSP
Sbjct:   445 KPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTF-EHAHNMRVMKFSVSP 503

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+E
Sbjct:   504 VVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEE 563

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G
Sbjct:   564 DHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKG 620

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                 +  + K RAR+LA+ ++WDVA+AR I
Sbjct:   621 -EVSARQELKARARYLAEKYEWDVAEARKI 649


>prf||1606211A elongation factor 2 [Rattus norvegicus]
            Length = 416

  Plus Strand HSPs:

 Score = 676 (238.0 bits), Expect = 8.9e-66, P = 8.9e-66
 Identities = 132/210 (62%), Positives = 167/210 (79%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             KP+QRT+LMMGRY E +ED PCGN+VGLVGVD+++VK+ TIT   E  H +R MK+SVSP
Sbjct:   190 KPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTF-EHAHNMRVMKFSVSP 248

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+E
Sbjct:   249 VVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEE 308

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G
Sbjct:   309 DHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKG 365

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                 +  + K RAR+LA+ ++WDVA+AR I
Sbjct:   366 -EVSARQELKARARYLAEKYEWDVAEARKI 394


>gi|600159 (U17362) elongation factor 2 [Cricetulus griseus]
           Length = 858

  Plus Strand HSPs:

 Score = 676 (238.0 bits), Expect = 8.9e-66, P = 8.9e-66
 Identities = 132/210 (62%), Positives = 167/210 (79%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             KP+QRT+LMMGRY E +ED PCGN+VGLVGVD+++VK+ TIT   E  H +R MK+SVSP
Sbjct:   445 KPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTF-EHAHNMRVMKFSVSP 503

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+E
Sbjct:   504 VVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEE 563

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G
Sbjct:   564 DHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKG 620

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                 +  + K RAR+LA+ ++WDVA+AR I
Sbjct:   621 -EVSARQELKARARYLAEKYEWDVAEARKI 649


>sp|P13639|EF2_HUMAN ELONGATION FACTOR 2 (EF-2) >pir||EFHU2 translation
            elongation factor eEF-2 - human >gi|31106 (X51466) elongation
            factor 2 [Homo sapiens] >gi|31108 (Z11692) human elongation factor
            2 [Homo sapiens]
            Length = 858

  Plus Strand HSPs:

 Score = 674 (237.3 bits), Expect = 1.5e-65, P = 1.5e-65
 Identities = 132/210 (62%), Positives = 167/210 (79%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             KP+QRT+LMMGRY E +ED PCGN+VGLVGVD+++VK+ TIT   E  H +R MK+SVSP
Sbjct:   445 KPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTF-EHAHNMRVMKFSVSP 503

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+E
Sbjct:   504 VVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEE 563

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G
Sbjct:   564 DHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKG 620

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                 +  + K RAR+LA+ ++WDVA+AR I
Sbjct:   621 -EVSARQELKQRARYLAEKYEWDVAEARKI 649


>sp|Q90705|EF2_CHICK ELONGATION FACTOR 2 (EF-2) >gi|1184958 (U46663) elongation
            factor 2 [Gallus gallus]
            Length = 858

  Plus Strand HSPs:

 Score = 672 (236.6 bits), Expect = 2.4e-65, P = 2.4e-65
 Identities = 131/210 (62%), Positives = 166/210 (79%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             KP+QRT+LMMGRY E +ED PCGN+VGLVGVD+++VK+ TIT   E  H +R MK+SVSP
Sbjct:   445 KPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTF-EHAHNMRVMKFSVSP 503

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+E
Sbjct:   504 VVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEE 563

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G
Sbjct:   564 DHACI---PIKKSDPVVSYRETVSEESNVMCLSKSPNKHNRLYMKARPFPDGLAEDIDKG 620

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                 +  + K RAR+LA+ ++WDV +AR I
Sbjct:   621 -EVSARQELKQRARYLAEKYEWDVTEARKI 649


>sp|Q06193|EF2_ENTHI ELONGATION FACTOR 2 (EF-2) >gi|158941 (L02417) translation
            elongation factor 2 [Entamoeba histolytica]
            Length = 840

  Plus Strand HSPs:

 Score = 670 (235.9 bits), Expect = 3.9e-65, P = 3.9e-65
 Identities = 134/210 (63%), Positives = 162/210 (77%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRT+LMMGRY + +++ PCGNV+GLVGVD+Y++KS TITD     H ++DMK+SVSP
Sbjct:   427 KNIQRTMLMMGRYTDPIDECPCGNVIGLVGVDQYLLKSGTITDS--VAHIIKDMKFSVSP 484

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVE KNPSDLPKLVEG+KRLS+SDPL +C  EESGEHIVAGAGELHLE+CLK+LQE
Sbjct:   485 VVRVAVETKNPSDLPKLVEGMKRLSRSDPLCLCYTEESGEHIVAGAGELHLEVCLKELQE 544

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G PL V+EPVVSFRET+T+ S IQCLSKSAN  NRLF R  P  E L   +E G
Sbjct:   545 DYCS--GVPLIVTEPVVSFRETITEPSRIQCLSKSANNQNRLFMRAFPFPEGLAEDIEAG 602

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                  + D K RA+FL++ + WDV +AR I
Sbjct:   603 -EIKPDTDFKERAKFLSEKYGWDVDEARKI 631


>sp|O14460|EF2_SCHPO ELONGATION FACTOR 2 (EF-2) >gnl|PID|d1024469 (D83975)
            elongation factor 2 [Schizosaccharomyces pombe] >gnl|PID|d1024470
            (D83976) elongation factor 2 [Schizosaccharomyces pombe]
            Length = 842

  Plus Strand HSPs:

 Score = 648 (228.1 bits), Expect = 8.3e-63, P = 8.3e-63
 Identities = 133/210 (63%), Positives = 159/210 (75%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTVLMMG   E +ED P GN++GLVGVD+++VKS T+T   E  H ++ MK+SVSP
Sbjct:   429 KAIQRTVLMMGSRIEPIEDCPAGNIIGLVGVDQFLVKSGTLTTS-EVAHNMKVMKFSVSP 487

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VV+VAVE KN +DLPKLVEGLKRLSKSDP V+CT  ESGEHIVAGAGELHLEICLKDLQE
Sbjct:   488 VVQVAVEVKNGNDLPKLVEGLKRLSKSDPCVLCTTSESGEHIVAGAGELHLEICLKDLQE 547

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G PLK+S PVVS+RE+V++ SS+  LSKS NKHNR+F    P++EEL V +E G
Sbjct:   548 D---HAGIPLKISPPVVSYRESVSEPSSMTALSKSPNKHNRIFMTAEPMSEELSVAIETG 604

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
              +     D KVRAR +AD F WDV  AR I
Sbjct:   605 -HVNPRDDFKVRARIMADEFGWDVTDARKI 633


>sp|P28996|EF2_CHLKE ELONGATION FACTOR 2 (EF-2) >pir||S32819 translation
            elongation factor eEF-2 - Chlorella kessleri >gi|167245 (M68064)
            elongation factor 2 [Chlorella kessleri] >prf||1808323A elongation
            factor 2 [Chlorella kessleri]
            Length = 845

  Plus Strand HSPs:

 Score = 645 (227.1 bits), Expect = 1.7e-62, P = 1.7e-62
 Identities = 131/210 (62%), Positives = 160/210 (76%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDG-ESPHPLRDMKYSVS 180
             K VQRTVL MGR QEAVED PCGN V LVG+D++I K+AT+TD+  E  H ++ MK+SVS
Sbjct:   429 KTVQRTVLCMGRRQEAVEDVPCGNTVALVGLDQFITKNATLTDEKCEDAHTIKAMKFSVS 488

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 360
             PVVRVAVE K  SDLPKLVEGLKRL+KSDP+V CTIEE+GEHI+AGAGELHLEICLKDLQ
Sbjct:   489 PVVRVAVEPKVASDLPKLVEGLKRLAKSDPMVQCTIEETGEHIIAGAGELHLEICLKDLQ 548

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             +D +   GA ++VSEPVVSFRETV   S    +SKS NKHNRL+ +  P+ + L   ++E
Sbjct:   549 DDFMG--GAEIRVSEPVVSFRETVIGTSDHVVMSKSPNKHNRLYMQARPMEDGLAEAIDE 606

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             G   G   DPKVR++ L++ F WD   A+ I
Sbjct:   607 G-KIGPRDDPKVRSKILSEEFGWDKELAKKI 636


>gnl|PID|d1014510 (D89151) similar to Saccharomyces serevisiae elongation
            factor 2, SWISS-PROT Accession Number P32324 [Schizosaccharomyces
            pombe]
            Length = 571

  Plus Strand HSPs:

 Score = 644 (226.7 bits), Expect = 2.2e-62, P = 2.2e-62
 Identities = 132/210 (62%), Positives = 158/210 (75%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTVLMMG   E +ED P GN++GLVGVD+++ KS T+T   E  H ++ MK+SVSP
Sbjct:   253 KAIQRTVLMMGSRIEPIEDCPAGNIIGLVGVDQFLAKSGTLTTS-EVAHNMKVMKFSVSP 311

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VV+VAVE KN +DLPKLVEGLKRLSKSDP V+CT  ESGEHIVAGAGELHLEICLKDLQE
Sbjct:   312 VVQVAVEVKNGNDLPKLVEGLKRLSKSDPCVLCTTSESGEHIVAGAGELHLEICLKDLQE 371

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G PLK+S PVVS+RE+V++ SS+  LSKS NKHNR+F    P++EEL V +E G
Sbjct:   372 D---HAGIPLKISPPVVSYRESVSEPSSMTALSKSPNKHNRIFMTAEPMSEELSVAIETG 428

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
              +     D KVRAR +AD F WDV  AR I
Sbjct:   429 -HVNPRDDFKVRARIMADEFGWDVTDARKI 457


>gnl|PID|e323877 (Z97178) elongation factor 2 [Beta vulgaris]
            Length = 843

  Plus Strand HSPs:

 Score = 635 (223.5 bits), Expect = 2.0e-61, P = 2.0e-61
 Identities = 130/210 (61%), Positives = 159/210 (75%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESP-HPLRDMKYSVS 180
             K VQRTV+ MG+ QE VED PCGN V LVG+D+YI K+AT+T++ ES  HP+R MK+SVS
Sbjct:   427 KNVQRTVIWMGKKQETVEDVPCGNTVALVGLDQYITKNATLTNEKESDAHPIRAMKFSVS 486

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 360
             PVVRVAV+ K  SDLPKLVEGLKRL+KSDP+VVC+IEESGEHI+AGAGELHLEICLKDLQ
Sbjct:   487 PVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSIEESGEHIIAGAGELHLEICLKDLQ 546

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             +D +   GA +  S+PVVSFRETV D S    +SKS NKHNRL+    P+ E L   ++E
Sbjct:   547 DDFMG--GAEIIKSDPVVSFRETVLDRSVRTVMSKSPNKHNRLYMEARPMEEGLAEAIDE 604

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             G   G   DPK R++ LA+ + WD   A+ I
Sbjct:   605 G-RIGPRDDPKNRSKILAEEYGWDKDLAKKI 634


>sp|P13060|EF2_DROME ELONGATION FACTOR 2 (EF-2) >pir||S05988 translation
            elongation factor eEF-2 - fruit fly (Drosophila melanogaster)
            >gi|7919 (X15805) translation elongation factor 2 (AA 1-844)
            [Drosophila melanogaster]
            Length = 844

  Plus Strand HSPs:

 Score = 629 (221.4 bits), Expect = 8.5e-61, P = 8.5e-61
 Identities = 126/211 (59%), Positives = 163/211 (77%), Frame = +1

Query:     1 DKPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVS 180
             +K +QRT+LMMGRY EA+ED P GN+ GLVGVD+++VK+ TIT   ++ H ++ MK+SVS
Sbjct:   430 EKAIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKDA-HNMKVMKFSVS 488

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 360
             PVVRVAVE KNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+
Sbjct:   489 PVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLE 548

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             ED       PLK S+PVVS+RETV++ S   CLSKS NKHNRL  +  P+ + L   ++ 
Sbjct:   549 EDHACI---PLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLLMKALPMPDGLPEDIDN 605

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             G    ++ + K RAR+L++ +D+DV +AR I
Sbjct:   606 G-EVSAKDEFKARARYLSEKYDYDVTEARKI 635


>sp|P29691|EF2_CAEEL ELONGATION FACTOR 2 (EF-2) >gnl|PID|e1187916 (Z81068)
            F25H5.4 [Caenorhabditis elegans]
            Length = 852

  Plus Strand HSPs:

 Score = 626 (220.4 bits), Expect = 1.8e-60, P = 1.8e-60
 Identities = 130/211 (61%), Positives = 160/211 (75%), Frame = +1

Query:     1 DKPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVS 180
             +K +QRT+LMMGR+ E +ED P GN+ GLVGVD+Y+VK  TIT   ++ H +R MK+SVS
Sbjct:   438 EKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDA-HNMRVMKFSVS 496

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 360
             PVVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C  EESGEHI+AGAGELHLEICLKDL+
Sbjct:   497 PVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLE 556

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             ED       PLK S+PVVS+RETV   S+  CLSKS NKHNRL C   P+ + L   +E 
Sbjct:   557 EDHACI---PLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEG 613

Query:   541 G-LNAGSEADPKVRARFLADXFDWDVAKARXI 633
             G +NA  E   K RA+ LA+ +++DV +AR I
Sbjct:   614 GTVNARDEF--KARAKILAEKYEYDVTEARKI 643


>pir||A40411 translation elongation factor eEF-2 - Caenorhabditis elegans
            >gi|156279 (M86959) elongation factor [Caenorhabditis elegans]
            Length = 852

  Plus Strand HSPs:

 Score = 606 (213.3 bits), Expect = 2.3e-58, P = 2.3e-58
 Identities = 124/211 (58%), Positives = 156/211 (73%), Frame = +1

Query:     1 DKPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVS 180
             +K +QRT+LMMGR+ E +ED P GN+ GLVGVD+Y+VK  TIT   ++ H +R MK+SVS
Sbjct:   438 EKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDA-HNMRVMKFSVS 496

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 360
             PVVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C  EESGEHI+AGAGELHLEICLKDL+
Sbjct:   497 PVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLE 556

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             ED       PLK S+PVVS+RETV   S+  CLSKS NKHNRL C   P+ + L   +E 
Sbjct:   557 EDHACI---PLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEG 613

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             G    +  + K RA++  + +++ V +AR I
Sbjct:   614 G-TVSARDEFKARAKYPGEKYEYAVTEARKI 643


>gnl|PID|e1191382 (Y09664) translation elongation factor 2 [Candida albicans]
            Length = 841

  Plus Strand HSPs:

 Score = 602 (211.9 bits), Expect = 6.2e-58, P = 6.2e-58
 Identities = 122/210 (58%), Positives = 155/210 (73%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTVLMMGR  E ++D P GN++GLVG+D++++KS TIT + E+ H ++ MK+SVSP
Sbjct:   428 KSIQRTVLMMGRSVEQIDDCPAGNIIGLVGIDQFLLKSGTITTN-EAAHNMKVMKFSVSP 486

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VV+VAVE KN +DLPKLVEGLKRLSKSDP V+  + ESGEHIVAG GELHLEICL+DL+ 
Sbjct:   487 VVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEN 546

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G PL++S PVVS+RETV   SS+  LSKS NKHNR++ +  P+ EE+ + +E G
Sbjct:   547 D---HAGVPLRISPPVVSYRETVEGESSMVALSKSPNKHNRIYVKAQPIDEEVSLDIENG 603

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
             +      D K RAR LAD   WDV  AR I
Sbjct:   604 V-INPRDDFKARARILADKHGWDVVDARKI 632


>sp|O13430|EF2_CANAL ELONGATION FACTOR 2 (EF-2)
            Length = 842

  Plus Strand HSPs:

 Score = 602 (211.9 bits), Expect = 6.2e-58, P = 6.2e-58
 Identities = 122/210 (58%), Positives = 155/210 (73%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTVLMMGR  E ++D P GN++GLVG+D++++KS TIT + E+ H ++ MK+SVSP
Sbjct:   429 KSIQRTVLMMGRSVEQIDDCPAGNIIGLVGIDQFLLKSGTITTN-EAAHNMKVMKFSVSP 487

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VV+VAVE KN +DLPKLVEGLKRLSKSDP V+  + ESGEHIVAG GELHLEICL+DL+ 
Sbjct:   488 VVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEN 547

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G PL++S PVVS+RETV   SS+  LSKS NKHNR++ +  P+ EE+ + +E G
Sbjct:   548 D---HAGVPLRISPPVVSYRETVEGESSMVALSKSPNKHNRIYVKAQPIDEEVSLDIENG 604

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
             +      D K RAR LAD   WDV  AR I
Sbjct:   605 V-INPRDDFKARARILADKHGWDVVDARKI 633


>sp|P32324|EF2_YEAST ELONGATION FACTOR 2 (EF-2) >pir||A41778 translation
            elongation factor eEF-2 - yeast (Saccharomyces cerevisiae)
            >gi|171442 (M59370) translation elongation factor 2 [Saccharomyces
            cerevisiae] >gi|549849 (M59369) translation elongation factor 2
            [Saccharomyces cerevisiae] >gi|927318 (U32274) Eft2p: translation
            elongation factor 2 (EF-2); CAI: 0.80 [Saccharomyces cerevisiae]
            >gi|1050821 (X90518) pid:e194982 [Saccharomyces cerevisiae]
            >gnl|PID|e217838 (X94335) YOR3317w [Saccharomyces cerevisiae]
            >gnl|PID|e252025 (Z75041) ORF YOR133w [Saccharomyces cerevisiae]
            Length = 842

  Plus Strand HSPs:

 Score = 598 (210.5 bits), Expect = 1.6e-57, P = 1.6e-57
 Identities = 118/210 (56%), Positives = 154/210 (73%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QR VLMMGR+ E ++D P GN++GLVG+D++++K+ T+T   E+ H ++ MK+SVSP
Sbjct:   429 KAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTS-ETAHNMKVMKFSVSP 487

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VV+VAVE KN +DLPKLVEGLKRLSKSDP V+  + ESGEHIVAG GELHLEICL+DL+ 
Sbjct:   488 VVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEH 547

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G PLK+S PVV++RETV   SS   LSKS NKHNR++ +  P+ EE+ + +E G
Sbjct:   548 D---HAGVPLKISPPVVAYRETVESESSQTALSKSPNKHNRIYLKAEPIDEEVSLAIENG 604

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
             +      D K RAR +AD + WDV  AR I
Sbjct:   605 I-INPRDDFKARARIMADDYGWDVTDARKI 633


>gnl|PID|d1006779 (D29835) elongation factor 2 [Giardia intestinalis]
            >prf||2122347A elongation factor 2 [Giardia intestinalis]
            Length = 819

  Plus Strand HSPs:

 Score = 586 (206.3 bits), Expect = 3.1e-56, P = 3.1e-56
 Identities = 117/210 (55%), Positives = 155/210 (73%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRT+LMMG   E ++D PCGN VGLVG+D+Y+VKS TI+   E  H ++ MK+SVSP
Sbjct:   450 KNIQRTILMMGSRIEQIDDVPCGNTVGLVGIDQYLVKSGTISTY-EQAHSIKPMKFSVSP 508

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQ 360
             VVRVAVE  NP DLPKL+EG+KRL KSDP V+C  + +  ++I+AGAGELHLEICLKDL+
Sbjct:   509 VVRVAVEPANPKDLPKLLEGMKRLDKSDPCVMCICDKDENQNIIAGAGELHLEICLKDLR 568

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             ED     G  ++VS+PVVS+RETVT+ S+   ++KSANKHNRL+    P++EE+   +++
Sbjct:   569 EDFCG--GMDIRVSDPVVSYRETVTEKSTKVVMAKSANKHNRLYFEAEPISEEVIEAIKD 626

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             G    SE D KVRAR L D + WD  +A+ I
Sbjct:   627 G-EITSEQDSKVRARILTDKYGWDSDEAKQI 656


>gnl|PID|d1024975 (D78481) elongation factor 2 [Trichomonas tenax]
            Length = 762

  Plus Strand HSPs:

 Score = 583 (205.2 bits), Expect = 6.4e-56, P = 6.4e-56
 Identities = 121/208 (58%), Positives = 149/208 (71%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             +QRTVLMMGR  E + D PCGN +GLVG+D+Y+VKS TI+D+ E+  P++ MK+SVSPVV
Sbjct:   401 IQRTVLMMGRKVENLRDCPCGNTIGLVGIDQYLVKSGTISDNDEAC-PIKAMKFSVSPVV 459

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQEDL 369
             RVAVE K   DLPKLVEGL RL+KSDP V  + EE+GEHI+AGAGELHLEICLKDL+ED 
Sbjct:   460 RVAVEPKVAQDLPKLVEGLNRLAKSDPCVQVSHEETGEHIIAGAGELHLEICLKDLEEDY 519

Query:   370 IXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGLN 549
                 G P+  S PVVSFRETV ++SS  C+SKSANK NRL C+  PL + L   +E G  
Sbjct:   520 A---GVPIIRSPPVVSFRETVQNLSSCVCMSKSANKLNRLMCQAEPLADGLLKAIESG-E 575

Query:   550 AGSEADPKVRARFLADXFDWDVAKARXI 633
                  D K RA+ L + F W+   AR +
Sbjct:   576 INPRMDVKTRAKILQNDFGWEQNDARRV 603


>gnl|PID|d1024974 (D78480) elongation factor 2 [Trichomonas tenax]
            Length = 761

  Plus Strand HSPs:

 Score = 579 (203.8 bits), Expect = 1.7e-55, P = 1.7e-55
 Identities = 119/208 (57%), Positives = 149/208 (71%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             +QRTVLMMGR  E ++D PCGN +GLVG+D+Y+VKS TI+D  ++  P++ MK+SVSPVV
Sbjct:   400 IQRTVLMMGRKVENLQDCPCGNTIGLVGIDQYLVKSGTISDRDDAC-PIKAMKFSVSPVV 458

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQEDL 369
             RVAVE K   DLPKLVEGL RL+KSDP V  + EE+GEHI+AGAGELHLE+CLKDL+ED 
Sbjct:   459 RVAVEPKLAQDLPKLVEGLNRLAKSDPCVQVSHEETGEHIIAGAGELHLEVCLKDLEEDF 518

Query:   370 IXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGLN 549
                 G P+  S PVVSFRETV ++SS  C+SKSANK NRL C+  PL + L   +E G  
Sbjct:   519 A---GVPIIRSPPVVSFRETVQNLSSCVCMSKSANKLNRLMCQAEPLADGLLKAIESG-E 574

Query:   550 AGSEADPKVRARFLADXFDWDVAKARXI 633
                  D K RA+ L + F W+   AR +
Sbjct:   575 INPRMDVKTRAKILQNDFGWEQNDARRV 602


>sp|Q17152|EF2_BLAHO ELONGATION FACTOR 2 (EF-2) >gnl|PID|d1012135 (D79219)
            Peptide Elongation Factor 2 [Blastocystis hominis]
            Length = 867

  Plus Strand HSPs:

 Score = 577 (203.1 bits), Expect = 7.0e-55, P = 7.0e-55
 Identities = 122/210 (58%), Positives = 152/210 (72%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K VQRTV+MMGRY E V D PCGN  GLVGVD+YI+K AT+TD  ES   ++ MK+SVSP
Sbjct:   451 KSVQRTVIMMGRYVEQVADIPCGNTCGLVGVDQYILKQATLTDC-ESAMTIKMMKFSVSP 509

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVC-TIEESGEHIVAGAGELHLEICLKDLQ 360
             VVRVAVE KNP DLP+LVEGLKRLSKSDP+VV  T  E+GEHI+AGAGELHLEICLKDLQ
Sbjct:   510 VVRVAVEPKNPGDLPRLVEGLKRLSKSDPMVVVITNTEAGEHIIAGAGELHLEICLKDLQ 569

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEE 540
             +D +  +G P+K+S PVV FRE+V   ++   L+KS NKHNRL+    P+ + L   +E+
Sbjct:   570 DDFM--KGTPIKISPPVVEFRESVNQATTEPGLAKSPNKHNRLYVNVEPMPDGLAQEIED 627

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
                   E + K RAR+++  +  DV   R I
Sbjct:   628 Q-KVTPEQEFKERARYMSTTYGMDVELMRKI 657


>sp|Q23716|EF2_CRYPV ELONGATION FACTOR 2 (EF-2) >gi|706975 (U21667)
            Cryptosporidium parvum elongation factor-2 (EF-2) gene, complete
            cds. [Cryptosporidium parvum]
            Length = 832

  Plus Strand HSPs:

 Score = 570 (200.7 bits), Expect = 2.7e-54, P = 2.7e-54
 Identities = 117/210 (55%), Positives = 148/210 (70%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTVLMMGRY E + D P GN VGLVG+D+Y++KS TIT   E+ H +  MKYSVSP
Sbjct:   419 KNIQRTVLMMGRYVEQIPDVPAGNTVGLVGIDQYLLKSGTITTS-ETAHNIASMKYSVSP 477

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAV  K+  +LPKLVEGLK+LSKSDPLVVC+ EE+GEHI+AG GELH+EICL+DLQ+
Sbjct:   478 VVRVAVRPKDNKELPKLVEGLKKLSKSDPLVVCSKEETGEHIIAGCGELHVEICLQDLQQ 537

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             +        +  S+P+VS+RETV ++S+  CLSKS NKHNRL+    PL + L   +EEG
Sbjct:   538 EYAQIE---IVASDPIVSYRETVVNLSNQTCLSKSPNKHNRLYMTAEPLPDGLTDDIEEG 594

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
                    DPK R+  L D + +D   A  I
Sbjct:   595 -KVSPRDDPKERSNLLHDKYGFDKNAAMKI 623


>sp|P15112|EF2_DICDI ELONGATION FACTOR 2 (EF-2) >pir||A34347 translation
            elongation factor eEF-2 - slime mold (Dictyostelium discoideum)
            >gi|167788 (M26017) elongation factor 2 [Dictyostelium discoideum]
            Length = 830

  Plus Strand HSPs:

 Score = 504 (177.4 bits), Expect = 1.2e-53, Sum P(2) = 1.2e-53
 Identities = 103/143 (72%), Positives = 117/143 (81%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTVLMMGR  E +ED PCGN+VGLVGVD+++VKS TIT   E  H +R MK+SVSP
Sbjct:   427 KSIQRTVLMMGRKTEQIEDCPCGNIVGLVGVDQFLVKSGTITTS-EVAHNIRVMKFSVSP 485

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAVE KNPSDLPKLVEGLKRL+KSDP V+C  EESGEHIVAGAGELHLEICLKDL E
Sbjct:   486 VVRVAVEPKNPSDLPKLVEGLKRLAKSDPCVLCYSEESGEHIVAGAGELHLEICLKDLAE 545

Query:   364 DLIXTRGAPLKVSEPVVSFRETV 432
             D     G  +K ++PVVSFRE+V
Sbjct:   546 D---HAGIEIKTTDPVVSFRESV 565

 Score = 87 (30.6 bits), Expect = 1.2e-53, Sum P(2) = 1.2e-53
 Identities = 18/46 (39%), Positives = 27/46 (58%), Frame = +1

Query:   496 RGAPLTEELCVXMEEGLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             + +P++ EL   +E G +  S+ DPK RA +LAD  +WD   A  I
Sbjct:   566 KASPISMELQDLIEAGSDISSKDDPKARANYLADNHEWDKNDAMNI 611


>pir||S07567 translation elongation factor 2 homolog - slime mold
            (Dictyostelium discoideum) (fragment)
            Length = 361

  Plus Strand HSPs:

 Score = 559 (196.8 bits), Expect = 2.2e-53, P = 2.2e-53
 Identities = 116/203 (57%), Positives = 150/203 (73%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTVLMMGR  E ++D PCGN++GLVGVD+++VKS TI+ + E+ H +R MK+SVSP
Sbjct:   149 KSIQRTVLMMGRKIELLDDCPCGNIIGLVGVDQFLVKSGTISTE-ETAHNIRVMKFSVSP 207

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VVRVAV+ KNPS+LPKL+EGLK L+K DP V+C  E S EHIVAGAGELHLEICLKDL+E
Sbjct:   208 VVRVAVQPKNPSELPKLIEGLKILAKPDPCVLCITETSREHIVAGAGELHLEICLKDLEE 267

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCL-SKSANKHNRLFCRGAPLTEELCVXMEE 540
             D     G  +  S+PVVSF E+V++ S I C+  KS NKHNR++ +  PL+  L   ++ 
Sbjct:   268 D---HAGIEIITSDPVVSFCESVSEESKIPCVFPKSPNKHNRIYMKSEPLSSGLTDDIDN 324

Query:   541 GLNAGSEADPKVRARFLADXFDWD 612
             GL A ++A  K RA +L D   WD
Sbjct:   325 GLVAFNQA-VKSRANYLYDKHSWD 347


>gnl|PID|e301029 (Y10991) Elongation factor 2 [Nicotiana tabacum]
            Length = 179

  Plus Strand HSPs:

 Score = 493 (173.5 bits), Expect = 2.2e-46, P = 2.2e-46
 Identities = 99/162 (61%), Positives = 123/162 (75%), Frame = +1

Query:   148 HPLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGE 327
             HP+R MK+SVSPVVRVAV+ K  SDLPKLVEGLKRL+KSDP+V+C+IEESGEHI+AGAGE
Sbjct:     8 HPIRAMKFSVSPVVRVAVQCKLASDLPKLVEGLKRLAKSDPMVLCSIEESGEHIIAGAGE 67

Query:   328 LHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAP 507
             LHLEICLKDLQ+D +   GA + VS+PVVSFRETV + S    +SKS NKHNRL+    P
Sbjct:    68 LHLEICLKDLQDDFMG--GAEIIVSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARP 125

Query:   508 LTEELCVXMEEGLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             + E L   +++G   G   DPKVR++ L++ F WD   A+ I
Sbjct:   126 MEEGLAEAIDDG-RIGPRDDPKVRSKILSEEFGWDKDLAKKI 166


>gi|181969 (M19997) elongation factor 2 [Homo sapiens]
           Length = 358

  Plus Strand HSPs:

 Score = 484 (170.4 bits), Expect = 2.0e-45, P = 2.0e-45
 Identities = 96/153 (62%), Positives = 121/153 (79%), Frame = +1

Query:   175 VSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKD 354
             VSPVVRVAVEAKNP+DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKD
Sbjct:     1 VSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKD 60

Query:   355 LQEDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXM 534
             L+ED       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +
Sbjct:    61 LEEDHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDI 117

Query:   535 EEGLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             ++G    +  + K RAR+LA+ ++WDVA+AR I
Sbjct:   118 DKG-EVSARQELKQRARYLAEKYEWDVAEARKI 149


>gi|203997 (K03502) elongation factor 2 [Rattus norvegicus]
           Length = 343

  Plus Strand HSPs:

 Score = 418 (147.1 bits), Expect = 2.0e-38, P = 2.0e-38
 Identities = 82/138 (59%), Positives = 106/138 (76%), Frame = +1

Query:   220 DLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXTRGAPLKV 399
             DLPKLVEGLKRL+KSDP+V C IEESGEHI+AGAGELHLEICLKDL+ED       P+K 
Sbjct:     1 DLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACI---PIKK 57

Query:   400 SEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGLNAGSEADPKVR 579
             S+PVVS+RETV++ S++ CLSKS NKHNRL+ +  P  + L   +++G    +  + K R
Sbjct:    58 SDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKG-EVSARQELKAR 116

Query:   580 ARFLADXFDWDVAKARXI 633
             AR+LA+ ++WDVA+AR I
Sbjct:   117 ARYLAEKYEWDVAEARKI 134


>gnl|PID|d1012136 (D79220) Peptide Elongation Factor 2 [Glugea plecoglossi]
            Length = 848

  Plus Strand HSPs:

 Score = 384 (135.2 bits), Expect = 7.7e-34, P = 7.7e-34
 Identities = 85/201 (42%), Positives = 123/201 (61%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QRTV++MGR+ + +   P GN+VGL+G+D  + K+ TIT+  E  + +R MK+SVSP
Sbjct:   438 KTIQRTVVLMGRHVKDIARCPAGNIVGLIGIDNELKKTGTITNWDEC-YNIRSMKFSVSP 496

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             VV+ A+  KN SDLPKL  GL +LSKSDPL      ++GE  +AGAGELHLEI + DL++
Sbjct:   497 VVKYAIRPKNSSDLPKLKAGLLKLSKSDPLTQVNFSDNGELTLAGAGELHLEISINDLKK 556

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             +        +   EP V++ E +++      +SKS NKHNR+F    P+ + L   +E+G
Sbjct:   557 EYA---NCEIITGEPQVTYIEGISETVVSPKMSKSPNKHNRIFMCVEPMEDRLIKGIEDG 613

Query:   544 LNAGSEADPKVRARFLADXFD 606
                    DPK RA    +  D
Sbjct:   614 HLCVK--DPKERATKFREMLD 632


>gi|2105430 (U97079) U5-116kD [Mus musculus]
            Length = 971

  Plus Strand HSPs:

 Score = 351 (123.6 bits), Expect = 3.6e-30, P = 3.6e-30
 Identities = 77/208 (37%), Positives = 127/208 (61%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDD--GESPHPLRDMKYSVSP 183
             V R  + + RY   V   P GN V + GVD+ IVK+ATIT+    E     R +K++ + 
Sbjct:   526 VGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTS 585

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             V+++AVE  NPS+LPK+++GL++++KS P +   +EESGEH++ G GEL+L+  + DL++
Sbjct:   586 VIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRK 645

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
               + +    +KV++PVV+F ETV + SS++C +++ NK N++     PL + L   +E  
Sbjct:   646 --MYSE-IDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENE 702

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
             +      + K    F    +DWD+  AR I
Sbjct:   703 V-VQITWNRKKLGEFFQTKYDWDLLAARSI 731


>gnl|PID|d1005229 (D21163) similar to human elongation factor 2 mRNA (HSEF2).
            [Homo sapiens]
            Length = 972

  Plus Strand HSPs:

 Score = 351 (123.6 bits), Expect = 3.7e-30, P = 3.7e-30
 Identities = 77/208 (37%), Positives = 127/208 (61%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDD--GESPHPLRDMKYSVSP 183
             V R  + + RY   V   P GN V + GVD+ IVK+ATIT+    E     R +K++ + 
Sbjct:   527 VGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTS 586

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
             V+++AVE  NPS+LPK+++GL++++KS P +   +EESGEH++ G GEL+L+  + DL++
Sbjct:   587 VIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRK 646

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
               + +    +KV++PVV+F ETV + SS++C +++ NK N++     PL + L   +E  
Sbjct:   647 --MYSE-IDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENE 703

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
             +      + K    F    +DWD+  AR I
Sbjct:   704 V-VQITWNRKKLGEFFQTKYDWDLLAARSI 732


>sp|P29050|EF2_PYRWO ELONGATION FACTOR 2 (EF-2) >pir||S23864 translation
            elongation factor aEF-2 - Pyrococcus woesei >gi|45950 (X67205)
            translation elongation factor 2 [Pyrococcus woesei]
            Length = 732

  Plus Strand HSPs:

 Score = 339 (119.3 bits), Expect = 3.7e-29, P = 3.7e-29
 Identities = 80/204 (39%), Positives = 124/204 (60%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             +Q+  + MG  +  +E  P GN+V + G+ +  +   T+ +  E   P   + Y   PVV
Sbjct:   335 IQQVGIYMGPERINMEAVPAGNIVAVTGL-RDAMAGETVAE--EQIEPFEALHYVSEPVV 391

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
              VA+EAKN  DLP+L+E L++L+K DP +   I EE+G+H+++G GELHLE+ L  LQ+D
Sbjct:   392 TVAIEAKNVKDLPRLIEALRQLAKEDPTLHVKIDEETGQHLLSGMGELHLEVKLYKLQKD 451

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGL 546
                  G  + VSEP+V +RE++T  S I    KS NKHNR +    P+ +E+   ++EG+
Sbjct:   452 W----GIEVDVSEPIVVYRESITKPSPI-VEGKSPNKHNRFYVVVEPMPDEIYQAIKEGI 506

Query:   547 -NAGSEADPKVRARFLADX-FDWDVAK 621
                G   DPK  A+ LA+   D+D+A+
Sbjct:   507 IPEGRVKDPKAVAKKLAELGMDYDIAR 533


>sp|O28385|EF2_ARCFU ELONGATION FACTOR 2 (EF-2) >gi|2648651 (AE000972)
            translation elongation factor EF-2 (fus) [Archaeoglobus fulgidus]
            Length = 728

  Plus Strand HSPs:

 Score = 330 (116.2 bits), Expect = 3.5e-28, P = 3.5e-28
 Identities = 78/196 (39%), Positives = 117/196 (59%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             +Q   L MG  +  V++ P GN+V ++G+ K  V  +T T   E+  P   +K+   PVV
Sbjct:   333 IQTVGLYMGPRRVEVDEIPAGNIVAVIGL-KDAVAGSTCTTV-ENLTPFESIKHYSEPVV 390

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
              +A+EAKNP DLPKL+E L++L+K DP +  T+ EE+GEH+++G GELHLE+ ++ ++ D
Sbjct:   391 TMAIEAKNPRDLPKLIEVLRKLAKEDPTLHITLNEETGEHLISGMGELHLEVKVEKIRRD 450

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGL 546
                     +  S P+V FRETVT  S +    KS NKHNR +    PL E++    +EG+
Sbjct:   451 Y----KLDVITSPPIVVFRETVTGTSPV-VEGKSPNKHNRFYIVVEPLPEKVIQMFKEGV 505

Query:   547 NAGSEADPKVRARFLAD 597
                 + D K R R L +
Sbjct:   506 -VDMKMDKKERRRLLQE 521


>gi|549848 (M86958) putative [Caenorhabditis elegans]
           Length = 849

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 1.7e-27, P = 1.7e-27
 Identities = 72/208 (34%), Positives = 127/208 (61%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDG--ESPHPLRDMKYSVSP 183
             V R  + +  YQ  V   P G  V + G+D+ IVK+ATI + G  E  +  R +K++   
Sbjct:   406 VGRLFVRVASYQIEVSRVPAGCWVLIEGIDQPIVKTATIAELGYEEDVYIFRPLKFNTRS 465

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
              V++AVE  NPS+LPK+++GL++++KS PL+   +EESGEH++ G GE +++  + D+++
Sbjct:   466 CVKLAVEPINPSELPKMLDGLRKVNKSYPLLTTRVEESGEHVLLGTGEFYMDCVMHDMRK 525

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXME-E 540
               + +    +KV++PVV+F ETV + S+++C +++ NK N++     PL ++L   +E E
Sbjct:   526 --VFSE-IDIKVADPVVTFNETVIETSTLKCFAETPNKKNKITMMAEPLEKQLDEDIENE 582

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
              +  G     +    F    ++WD+  AR I
Sbjct:   583 VVQIGWNR--RRLGEFFQTKYNWDLLAARSI 611


>gnl|PID|d1028961 (AB009528) 735aa long hypothetical elongation factor 2
            [Pyrococcus horikoshii] >gnl|PID|d1031965 (AP000007) 735aa long
            hypothetical elongation factor 2 [Pyrococcus horikoshii]
            Length = 735

  Plus Strand HSPs:

 Score = 323 (113.7 bits), Expect = 2.0e-27, P = 2.0e-27
 Identities = 76/204 (37%), Positives = 125/204 (61%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             +Q+  + MG  +  +E  P GN+V + G+ +  +   T+ +  E   P   + Y   PVV
Sbjct:   338 IQQVGIYMGPERINMEAVPAGNIVAVTGL-RDAMAGETVAE--EQIEPFEALHYVSEPVV 394

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
              VA+EAKN  DLP+L+E L++L+K DP +   I EE+G+H+++G GELHLE+ L  L++D
Sbjct:   395 TVAIEAKNVKDLPRLIEALRQLAKEDPTLHVKIDEETGQHLLSGMGELHLEVKLYKLKKD 454

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGL 546
                  G  ++VSEP+V +RE++T  SS     KS N+HNR +    P+ +E+   ++EG+
Sbjct:   455 W----GIDIEVSEPIVVYRESITK-SSPMVEGKSPNRHNRFYIVVEPMPDEIYNAIKEGI 509

Query:   547 -NAGSEADPKVRARFLADX-FDWDVAK 621
                G   +PK  A+ LA+   D+++A+
Sbjct:   510 IPEGRVKNPKEVAKKLAELGMDYEIAR 536


>gi|1213536 (U50193) the above GenBank entry begins at aa 120 [Caenorhabditis
            elegans]
            Length = 974

  Plus Strand HSPs:

 Score = 325 (114.4 bits), Expect = 2.2e-27, P = 2.2e-27
 Identities = 72/208 (34%), Positives = 127/208 (61%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDG--ESPHPLRDMKYSVSP 183
             V R  + +  YQ  V   P G  V + G+D+ IVK+ATI + G  E  +  R +K++   
Sbjct:   531 VGRLFVRVASYQIEVSRVPAGCWVLIEGIDQPIVKTATIAELGYEEDVYIFRPLKFNTRS 590

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQE 363
              V++AVE  NPS+LPK+++GL++++KS PL+   +EESGEH++ G GE +++  + D+++
Sbjct:   591 CVKLAVEPINPSELPKMLDGLRKVNKSYPLLTTRVEESGEHVLLGTGEFYMDCVMHDMRK 650

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXME-E 540
               + +    +KV++PVV+F ETV + S+++C +++ NK N++     PL ++L   +E E
Sbjct:   651 --VFSE-IDIKVADPVVTFNETVIETSTLKCFAETPNKKNKITMMAEPLEKQLDEDIENE 707

Query:   541 GLNAGSEADPKVRARFLADXFDWDVAKARXI 633
              +  G     +    F    ++WD+  AR I
Sbjct:   708 VVQIGWNR--RRLGEFFQTKYNWDLLAARSI 736


>sp|O27131|EF2_METTH ELONGATION FACTOR 2 (EF-2) >gi|2622156 (AE000876)
            translation elongation factor, EF-2  [Methanobacterium
            thermoautotrophicum]
            Length = 733

  Plus Strand HSPs:

 Score = 305 (107.4 bits), Expect = 1.8e-25, P = 1.8e-25
 Identities = 74/204 (36%), Positives = 109/204 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             VQ+  + MG  +   +  P GN+V + G  K  V   TI D G        +++   PVV
Sbjct:   338 VQQVGVYMGPERVNTDKVPAGNIVAITGA-KNAVAGETICDTGRKIKAFEGLEHISEPVV 396

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
              VAVEAKN  DLPKL+E L+++ K DP V   I EE+GEH+++G GELHLEI    + E 
Sbjct:   397 TVAVEAKNTKDLPKLIEVLRQVGKEDPTVRVEINEETGEHLISGMGELHLEIIAYRINE- 455

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG- 543
                 +G  ++ SEP+V +RETV   +      KS NKHNR +    P+   +   ++EG 
Sbjct:   456 ----KGVEIETSEPIVVYRETVAGTAG-PVEGKSPNKHNRFYIEIEPVEASVMQAIQEGK 510

Query:   544 LNAGSEADPKVRARFLADXFDWDVAK 621
             +  G     ++   F+    D + A+
Sbjct:   511 IKEGRVKGKEMAKNFIEAGMDKEEAR 536


>sp|Q58448|EF2_METJA ELONGATION FACTOR 2 (EF-2) >pir||G64430 translation
            elongation factor aEF-2 - Methanococcus jannaschii >gi|1591702
            (U67547) translation elongation factor EF-2 [Methanococcus
            jannaschii]
            Length = 726

  Plus Strand HSPs:

 Score = 301 (106.0 bits), Expect = 4.6e-25, P = 4.6e-25
 Identities = 75/204 (36%), Positives = 116/204 (56%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             +Q+  + MG  +  V+    GN+  LVG+ K      TI    +   P   + +   PV+
Sbjct:   335 IQQVSVFMGPERIPVDSISAGNICALVGL-KEASAGETICSPDKIIEPFEAITHISEPVI 393

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLK-DLQE 363
              VA+EAKN  DLPKL+E L+++++ DP V   I EE+GEH+++G GELH+EI  K  ++ 
Sbjct:   394 TVAIEAKNTKDLPKLIEVLRQVAREDPTVKVEINEETGEHLLSGMGELHIEIITKLKIER 453

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             D     G P++V +P+V +RETVT  S +   SKS NKHN+L+    PL E +    +EG
Sbjct:   454 DA----GIPVEVGQPIVVYRETVTGQSPV-VESKSPNKHNKLYFVVEPLEESVLQAYKEG 508

Query:   544 ----LNAGSEADPKVRARFLADXFDWDVAK 621
                 ++   + D K+    +    D + AK
Sbjct:   509 RIPDVDTKRKLDDKIVQELIKAGMDPEEAK 538


>sp|P33159|EF2_DESMO ELONGATION FACTOR 2 (EF-2) >pir||S25166 translation
            elongation factor aEF-2 - Desulfurococcus mobilis >gi|40807
            (X68014) elongation factor 2 [Desulfurococcus mobilis]
            Length = 734

  Plus Strand HSPs:

 Score = 297 (104.5 bits), Expect = 1.3e-24, P = 1.3e-24
 Identities = 74/208 (35%), Positives = 111/208 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDD-GESPHPLRDMKYSVSPV 186
             V +  L MG Y+E  ++   GN+   + ++K       +     +S  P   ++     V
Sbjct:   334 VLQVSLYMGPYRELADEITAGNIAAALALEKARSGETVVAMKYKDSMTPFEKLRMITESV 393

Query:   187 VRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQE 363
             V VA+E KNP  L KLV+ L +L   DP ++  I EE+GE++++G G LH+EI L  L +
Sbjct:   394 VTVAIEPKNPQQLTKLVDALYKLHLEDPSLIVKINEETGEYLLSGVGTLHIEIALT-LLK 452

Query:   364 DLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             DL    G  +  S PV+ +RETV + S +    KS NKHN+ +   APL EE    M EG
Sbjct:   453 DLY---GLEVVASPPVIVYRETVRESSQV-FEGKSPNKHNKFYISVAPLNEETLRLMSEG 508

Query:   544 LNAGSEADPKVRARFLADXFDWDVAKARXI 633
             +    + D + RA+ L +   WD  +AR I
Sbjct:   509 IIV-EDMDARERAKILREQAGWDADEARRI 537


>gi|849206 (U28373) Etf1p: Elongation factor 2 (Swiss Prot. accession number
           P32324).  Note that the entire gene is not included in this cosmid.
           [Saccharomyces cerevisiae]
           Length = 515

  Plus Strand HSPs:

 Score = 287 (101.0 bits), Expect = 5.6e-24, P = 5.6e-24
 Identities = 54/88 (61%), Positives = 73/88 (82%), Frame = +1

Query:     4 KPVQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSP 183
             K +QR VLMMGR+ E ++D P GN++GLVG+D++++K+ T+T   E+ H ++ MK+SVSP
Sbjct:   429 KAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTS-ETAHNMKVMKFSVSP 487

Query:   184 VVRVAVEAKNPSDLPKLVEGLKRLSKSD 267
             VV+VAVE KN +DLPKLVEGLKRLSKSD
Sbjct:   488 VVQVAVEVKNANDLPKLVEGLKRLSKSD 515


>sp|P26752|EF2_THEAC ELONGATION FACTOR 2 (EF-2) >pir||S36089 translation
            elongation factor aEF-2 - Thermoplasma acidophilum >gi|48076
            (X56840) elongation factor 2 [Thermoplasma acidophilum]
            Length = 732

  Plus Strand HSPs:

 Score = 284 (100.0 bits), Expect = 3.2e-23, P = 3.2e-23
 Identities = 73/204 (35%), Positives = 116/204 (56%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             VQ   +M+G  +  V++   GN+  +VG+ K  +  AT++   E+  P   M +   PVV
Sbjct:   334 VQTLAMMVGPDRIPVDEITAGNIAAIVGL-KGAIAGATVSSL-ENMVPFEPMIHYSEPVV 391

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
              +A+EAK+ +DLP+L+E L+ +SK+DP +   I +E+GEH+++G GELHL++ L  ++ D
Sbjct:   392 TLAIEAKHTADLPRLIEVLRDISKADPSIQVDINQETGEHLISGMGELHLDVTLYRIKND 451

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG- 543
                     ++ S+P+V +RETV          KS NKHNR +    PL  E+   +E+G 
Sbjct:   452 Y----KVEVETSDPIVVYRETVEKKGG-PFEGKSPNKHNRFYFEVEPLKPEVIQAIEDGD 506

Query:   544 LNAGSE-ADPKVRARFLADX-FDWDVAK 621
             +  GS+  D K     L     D D AK
Sbjct:   507 IPQGSKFKDKKALVELLVSKGIDRDEAK 534


>sp|P30925|EF2_SULSO ELONGATION FACTOR 2 (EF-2) >pir||S31809 translation
            elongation factor aEF-2 - Sulfolobus solfataricus >gi|809767
            (X69297) elongation factor 2 [Sulfolobus solfataricus]
            Length = 736

  Plus Strand HSPs:

 Score = 283 (99.6 bits), Expect = 4.2e-23, P = 4.2e-23
 Identities = 69/203 (33%), Positives = 110/203 (54%), Frame = +1

Query:    25 LMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPH-PLRDMKYSVSPVVRVAV 201
             L MG  +E  E+ P GN+  ++G+D+       I+    +       + Y   PVV +AV
Sbjct:   342 LYMGPTRELAEEIPAGNIAAVLGLDRARSGETAISVGFSNVQGSFERLHYISEPVVTIAV 401

Query:   202 EAKNPSDLPKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXT 378
             E KNP DL K+++ L++LS  DP LVV   EE+GE++++G G LHLE+ L+ L+E+    
Sbjct:   402 EPKNPKDLTKMIDALRKLSIEDPNLVVKINEETGEYLLSGMGFLHLEVSLQLLRENY--- 458

Query:   379 RGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGLNAGS 558
              G  +  + P+V +RE++   S +    KS NKHN+ +    PL ++    +  G     
Sbjct:   459 -GIDVVTTPPIVVYRESIRAKSQV-FEGKSPNKHNKFYLSVEPLNDKTIELISNG-TIRE 515

Query:   559 EADPKVRARFLADXFDWDVAKARXI 633
             + D K  A+ L D   WD  +A+ I
Sbjct:   516 DMDSKEMAKILRDEASWDYDEAKRI 540


>prf||2004270A elongation factor 2 [Sulfolobus solfataricus]
            Length = 736

  Plus Strand HSPs:

 Score = 283 (99.6 bits), Expect = 4.2e-23, P = 4.2e-23
 Identities = 69/203 (33%), Positives = 110/203 (54%), Frame = +1

Query:    25 LMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPH-PLRDMKYSVSPVVRVAV 201
             L MG  +E  E+ P GN+  ++G+D+       I+    +       + Y   PVV +AV
Sbjct:   342 LYMGPTRELAEEIPAGNIAAVLGLDRARSGETAISVGFSNVQGSFERLHYISEPVVTIAV 401

Query:   202 EAKNPSDLPKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXT 378
             E KNP DL K+++ L++LS  DP LVV   EE+GE++++G G LHLE+ L+ L+E+    
Sbjct:   402 EPKNPKDLTKMIDALRKLSIEDPNLVVKINEETGEYLLSGMGFLHLEVSLQLLRENY--- 458

Query:   379 RGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGLNAGS 558
              G  +  + P+V +RE++   S +    KS NKHN+ +    PL ++    +  G     
Sbjct:   459 -GIDVVTTPPIVVYRESIRAKSQV-FEGKSPNKHNKFYLSVEPLNDKTIELISNG-TIRE 515

Query:   559 EADPKVRARFLADXFDWDVAKARXI 633
             + D K  A+ L D   WD  +A+ I
Sbjct:   516 DMDSKEMAKILRDEASWDYDEAKRI 540


>gi|2130649 (AF000576) EF-2 [Rattus norvegicus]
            Length = 309

  Plus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.5e-22, P = 2.5e-22
 Identities = 53/104 (50%), Positives = 74/104 (71%), Frame = +1

Query:   322 GELHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRG 501
             GELHLEICLKDL+ED       P+K S+PVVS+RETV++ S++ CLSKS NKHNRL+ + 
Sbjct:     1 GELHLEICLKDLEEDHACI---PIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKA 57

Query:   502 APLTEELCVXMEEGLNAGSEADPKVRARFLADXFDWDVAKARXI 633
              P  + L   +++G    +  + K RAR+LA+ ++WDVA+AR I
Sbjct:    58 RPFPDGLAEDIDKG-EVSARQELKARARYLAEKYEWDVAEARKI 100


>sp|P53893|YNQ3_YEAST HYPOTHETICAL 124.5 KD PROTEIN IN SKO1-RPL44A INTERGENIC
            REGION >pir||S60964 probable membrane protein YNL163c - yeast
            (Saccharomyces cerevisiae) >gi|1050790 (X92517) N1718 gene product
            [Saccharomyces cerevisiae] >gnl|PID|e239817 (Z71439) ORF YNL163c
            [Saccharomyces cerevisiae]
            Length = 1110

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 1.6e-21, P = 1.6e-21
 Identities = 59/142 (41%), Positives = 84/142 (59%), Frame = +1

Query:    25 LMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVE 204
             L MG+    ++  P GN+VG+ G+   ++KS T+ + G     L  + +  +P+VRVAVE
Sbjct:   625 LFMGKELVPLDVCPSGNIVGIRGLAGKVLKSGTLIEKGVQGVNLAGVNFHFTPIVRVAVE 684

Query:   205 AKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXTRG 384
               NP ++ KLV GLK L ++DP V   +E +GEHI+  AGELHLE CLKDL E      G
Sbjct:   685 PANPVEMSKLVRGLKLLDQADPCVHTYVENTGEHILCTAGELHLERCLKDLTERFA---G 741

Query:   385 APLKVSEPVVSFRETVTDVSSI 450
               +  SEP + +RET    S +
Sbjct:   742 IEITHSEPAIPYRETFLSASDM 763


>gnl|PID|e212187 (X92971) translocation elongation factor [Saccharomyces
            cerevisiae]
            Length = 1110

  Plus Strand HSPs:

 Score = 271 (95.4 bits), Expect = 1.6e-21, P = 1.6e-21
 Identities = 59/142 (41%), Positives = 84/142 (59%), Frame = +1

Query:    25 LMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVE 204
             L MG+    ++  P GN+VG+ G+   ++KS T+ + G     L  + +  +P+VRVAVE
Sbjct:   625 LFMGKELVPLDVCPSGNIVGIRGLAGKVLKSGTLIEKGVQGVNLAGVNFHFTPIVRVAVE 684

Query:   205 AKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXTRG 384
               NP ++ KLV GLK L ++DP V   +E +GEHI+  AGELHLE CLKDL E      G
Sbjct:   685 PANPVEMSKLVRGLKLLDQADPCVHTYVENTGEHILCTAGELHLERCLKDLTERFA---G 741

Query:   385 APLKVSEPVVSFRETVTDVSSI 450
               +  SEP + +RET    S +
Sbjct:   742 IEITHSEPAIPYRETFLSASDM 763


>sp|P14823|EF2_HALHA ELONGATION FACTOR 2 (EF-2) >pir||S07558 translation
            elongation factor aEF-2 - Halobacterium halobium >gi|43496 (X17148)
            EF-2 (AA 1-728) [Halobacterium halobium] >prf||1604196B elongation
            factor 2 [Halobacterium halobium]
            Length = 728

  Plus Strand HSPs:

 Score = 267 (94.0 bits), Expect = 2.1e-21, P = 2.1e-21
 Identities = 57/171 (33%), Positives = 102/171 (59%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             VQ   + MG  +E V++ P GN+  + G+ K  +  +T+++  E   P   + +   PV+
Sbjct:   336 VQSVGIYMGGEREEVDEVPAGNIAAVTGL-KDAIAGSTVSN--EEMTPFESIDHISEPVI 392

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
               ++EA+N  DLPKL+E L+++SK DP +   I E++GEH+++G GELHLE+  + ++ +
Sbjct:   393 TKSIEAQNMDDLPKLIETLRQVSKEDPTISIEINEDTGEHLISGQGELHLEVQTQRIERN 452

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEEL 522
                 +G P+   EP+V +RET T  S  +    S N+HN+ +     L++++
Sbjct:   453 ----QGIPVTTGEPIVVYRETPTSDSQ-EVEGVSPNRHNKFYITVEQLSDDV 499


>gi|1184709 (U41261) elongation factor 2 [unidentified archaeon 4B7]
            Length = 725

  Plus Strand HSPs:

 Score = 266 (93.6 bits), Expect = 2.7e-21, P = 2.7e-21
 Identities = 74/204 (36%), Positives = 108/204 (52%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             VQ     M   +E V +   GN+  L+G+ +        T  G  P      KY   PVV
Sbjct:   335 VQSVNFFMSNVREQVGELGAGNIPALLGLTEVRAGQTLSTVKG-IP-VFEASKYVSEPVV 392

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
             ++A+E K+P DLPKLVE L++L+  DP +V  I EE+GE I+AG G LHL++ +     +
Sbjct:   393 QMAIEPKHPKDLPKLVECLRKLTIEDPNLVIKIDEETGETIMAGMGVLHLDVAV-----N 447

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGL 546
             LI      +  SEP++++RET+T       ++KS N+HN++F +  PL  E+      G 
Sbjct:   448 LIKDAKIEIITSEPLINYRETITGGCE-PVMAKSPNRHNKIFMKVEPLEPEIAEMCRNG- 505

Query:   547 NAGSEADPKVRARFLADXFDW--DVAK 621
                   D K  A+ L D   W  DVAK
Sbjct:   506 TLSEMKDKKETAQILRDK-GWEPDVAK 531


>sp|P23112|EF2_SULAC ELONGATION FACTOR 2 (EF-2) >pir||S14408 translation
            elongation factor aEF-2 - Sulfolobus acidocaldarius >gi|581563
            (X54972) elongation factor 2 [Sulfolobus acidocaldarius]
            Length = 737

  Plus Strand HSPs:

 Score = 265 (93.3 bits), Expect = 3.6e-21, P = 3.6e-21
 Identities = 70/203 (34%), Positives = 111/203 (54%), Frame = +1

Query:    25 LMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSA-TITDDGESPHPL---RDMKYSVSPVVR 192
             L MG  +E  E+ P GN+   +G+D    +S  T  D       L     + Y   PVV 
Sbjct:   342 LYMGAIRELAEEIPVGNIAAALGMDA--ARSGETGVDIRFKDSVLGSFEKLHYISEPVVT 399

Query:   193 VAVEAKNPSDLPKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDLQEDL 369
             ++VE +NP DL K+++ L++LS  D  LVV   EE+GE++++G G LHLE+ L+ L+E+ 
Sbjct:   400 ISVEPRNPKDLTKMIDALRKLSIEDSNLVVKINEETGEYLLSGMGFLHLEVSLQLLKENY 459

Query:   370 IXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEGLN 549
                 G  +  + P+V +RE++ + S +    KS NKHN+L+    PL  +    +  G  
Sbjct:   460 ----GLDVVTTPPIVVYRESIRNKSQV-FEGKSPNKHNKLYISVEPLNNQTIDLIANG-T 513

Query:   550 AGSEADPKVRARFLADXFDWDVAKARXI 633
                + D K  A+ L D  +WD  +A+ I
Sbjct:   514 IKEDMDNKEMAKILRDQAEWDYDEAKKI 541


>sp|P09604|EF2_METVA ELONGATION FACTOR 2 (EF-2) >pir||S01289 translation
            elongation factor aEF-2 - Methanococcus vannielii >gi|44710
            (X12384) elongation factor 2 (AA 1 - 727) [Methanococcus vannielii]
            Length = 727

  Plus Strand HSPs:

 Score = 262 (92.2 bits), Expect = 7.4e-21, P = 7.4e-21
 Identities = 60/177 (33%), Positives = 97/177 (54%), Frame = +1

Query:    13 QRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHP-LRDMKYSVSPVV 189
             Q+  + MG  +  V     GN+  L G+ +      T+    +   P    + ++  PV+
Sbjct:   336 QQVAIFMGAERVQVPSISAGNICALTGL-REATAGETVCSPSKILEPGFESLTHTSEPVI 394

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQED 366
              VA+EAKN  DLPKL+E L+++ + D  V   I EE+GEH+++G GELH+E+ + D +  
Sbjct:   395 TVAIEAKNTKDLPKLIEILRQIGREDNTVRIEINEETGEHLISGMGELHIEV-ITDTK-- 451

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEELCVXMEEG 543
             +    G  + V EP++ +RET+T  S  +   KS NKHN+L+    P+ E +     EG
Sbjct:   452 IGRDGGIEVDVGEPIIVYRETITGTSP-EIEGKSPNKHNKLYMIAEPMEESVYAAYVEG 509


>gnl|PID|e1294522 (AL023704) translocation elongation factor
            [Schizosaccharomyces pombe]
            Length = 1000

  Plus Strand HSPs:

 Score = 252 (88.7 bits), Expect = 1.5e-19, P = 1.5e-19
 Identities = 56/153 (36%), Positives = 92/153 (60%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V+   LMMG+    +E  P GNV  + G+   ++++AT+      P+ L  +   + P+V
Sbjct:   506 VESLYLMMGQELVYLETVPAGNVFAIGGLAGTVLRTATLCSSPNGPN-LVGVTQQMEPIV 564

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQEDL 369
             RVA+E   P ++ KLV GL  L+++DP V   +EE+GEH++  AGE+HLE CLKDL+E  
Sbjct:   565 RVALEPVRPFEMNKLVTGLDMLNQADPCVQIAVEENGEHVIMCAGEIHLERCLKDLRERF 624

Query:   370 IXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKS 468
                    ++ S+P+V +RET   +++   L+K+
Sbjct:   625 AKIE---IQASQPLVPYRETT--IATPDLLAKN 652


>gi|1675353 (U75403) elongation factor 2 [Rattus norvegicus]
            Length = 51

  Plus Strand HSPs:

 Score = 220 (77.4 bits), Expect = 1.9e-17, P = 1.9e-17
 Identities = 43/51 (84%), Positives = 47/51 (92%), Frame = +1

Query:   196 AVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICL 348
             AVEAKNP+DLPKLVEGLKRL+KSDP+V   IEESG HI+AGAGELHLEICL
Sbjct:     1 AVEAKNPADLPKLVEGLKRLAKSDPMVQXIIEESGXHIIAGAGELHLEICL 51


>sp|P36048|GI10_YEAST GIN10 PROTEIN >pir||S38003 translation elongation factor
            eEF-2 homolog YKL173w - yeast (Saccharomyces cerevisiae) >gi|407509
            (Z26878) unknown [Saccharomyces cerevisiae] >gi|486304 (Z28173) ORF
            YKL173w [Saccharomyces cerevisiae] >prf||2118403E ORF
            [Saccharomyces cerevisiae]
            Length = 1008

  Plus Strand HSPs:

 Score = 192 (67.6 bits), Expect = 3.9e-13, P = 3.9e-13
 Identities = 47/147 (31%), Positives = 80/147 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATI--TDDGESPHPLRDMK---YS 174
             V+   L+ GRY   V +   G +V + G+    +KSAT+      E    L+  K   Y 
Sbjct:   539 VEEIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLYSVKSKEDMKQLKFFKPLDYI 598

Query:   175 VSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKD 354
                V ++ ++   P +LPKL++ L ++SK  P V+  +EESGEH++ G GEL+++  L D
Sbjct:   599 TEAVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGEHVILGNGELYMDCLLYD 658

Query:   355 LQEDLIXTRGAPLKVSEPVVSFRETVTDVS 444
             L+          +K+S+P+  F E+ ++ S
Sbjct:   659 LRASYAKIE---IKISDPLTVFSESCSNES 685


>sp|P29541|EFG_STRRA ELONGATION FACTOR G (EF-G) >pir||S23907 translation
            elongation factor G - Streptomyces ramocissimus (fragment)
            >gi|47483 (X67057) fus gene product [Streptomyces ramocissimus]
            Length = 341

  Plus Strand HSPs:

 Score = 181 (63.7 bits), Expect = 7.2e-13, P = 7.2e-13
 Identities = 48/157 (30%), Positives = 84/157 (53%), Frame = +1

Query:    28 MMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEA 207
             M    +E +E    G++V ++G+ K      T++D+ +SP  L  M +  +PV++VA+E 
Sbjct:     4 MHANKREEIESVGAGDIVAVMGL-KQTTTGETLSDE-KSPVILESMDFP-APVIQVAIEP 60

Query:   208 KNPSDLPKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXTRG 384
             K+  D  KL   ++RL++ DP   V + EE+G+ I+ G GELHLE+ +  ++ +      
Sbjct:    61 KSKGDQEKLGVAIQRLAEEDPSFQVHSDEETGQTIIGGMGELHLEVLVDRMRREF----K 116

Query:   385 APLKVSEPVVSFRETVTD-VSSIQCLSKSANKHNRLFCR 498
                 V +P V++RET+   V  ++   K        F R
Sbjct:   117 VEANVGKPQVAYRETIRQAVEKVEYTHKKQTGGTGQFAR 155


>sp|P13551|EFG_THETH ELONGATION FACTOR G (EF-G) >pir||EFTWG translation
            elongation factor G - Thermus aquaticus >pdb|1DAR|  Elongation
            Factor G In Complex With Gdp Ribosomal Translocase, Translational
            Gtpase Mol_id: 1; Molecule: Elongation Factor G; Chain: Null;
            Synonym: Ef-G >pdb|1ELO|  Elongation Factor G Without Nucleotide
            Ribosomal Translocase, Gtp Binding Protein, Hydrolase, Elongation
            Factor Mol_id: 1; Molecule: Elongation Factor G; Chain: Null;
            Synonym: Translocase >gi|48240 (X16278) elongation factor G (AA
            1-691) [Thermus aquaticus thermophilus]
            Length = 691

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 9.9e-13, P = 9.9e-13
 Identities = 47/142 (33%), Positives = 78/142 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M   ++E VE+   G++  +VG+ + I     + +D  +P  + +      PV+
Sbjct:   352 VARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGED--APRVILESIEVPEPVI 409

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              VA+E K  +D  KL + L RL++ DP   V T  E+G+ I++G GELHLEI +  L+ +
Sbjct:   410 DVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKRE 469

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                       V +P V++RET+T
Sbjct:   470 F----KVDANVGKPQVAYRETIT 488


>pdb|1EFG|A Thermus thermophilus
            Length = 691

  Plus Strand HSPs:

 Score = 186 (65.5 bits), Expect = 9.9e-13, P = 9.9e-13
 Identities = 47/142 (33%), Positives = 78/142 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M   ++E VE+   G++  +VG+ + I     + +D  +P  + +      PV+
Sbjct:   352 VARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGED--APRVILESIEVPEPVI 409

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              VA+E K  +D  KL + L RL++ DP   V T  E+G+ I++G GELHLEI +  L+ +
Sbjct:   410 DVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKRE 469

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                       V +P V++RET+T
Sbjct:   470 F----KVDANVGKPQVAYRETIT 488


>sp|P02996|EFG_ECOLI ELONGATION FACTOR G (EF-G) >gi|41517 (X00415) elongation
            factor G [Escherichia coli] >gi|606274 (U18997) CG Site No. 732;
            alternate name far [Escherichia coli] >gi|1789738 (AE000410) f704;
            CG Site No. 732; alternate name far; 100 pct identical amino acid
            sequence and equal length to EFG_ECOLI SW: P02996 [Escherichia
            coli]
            Length = 704

  Plus Strand HSPs:

 Score = 176 (62.0 bits), Expect = 1.2e-11, P = 1.2e-11
 Identities = 50/142 (35%), Positives = 79/142 (55%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R V M    +E +++   G++   +G+ K +    T+ D  ++P  L  M++   PV+ +
Sbjct:   362 RIVQMHANKREEIKEVRAGDIAAAIGL-KDVTTGDTLCDP-DAPIILERMEFP-EPVISI 418

Query:   196 AVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQEDLI 372
             AVE K  +D  K+   L RL+K DP   V T EES + I+AG GELHL+I +  ++ +  
Sbjct:   419 AVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREF- 477

Query:   373 XTRGAPLKVSEPVVSFRET----VTDV 441
                     V +P V++RET    VTDV
Sbjct:   478 ---NVEANVGKPQVAYRETIRQKVTDV 501


>sp|P26229|EFG_SALTY ELONGATION FACTOR G (EF-G) >pir||JC1424 translation
            elongation factor G - Salmonella typhimurium >gi|47923 (X64591)
            elongation factor G [Salmonella typhimurium]
            Length = 704

  Plus Strand HSPs:

 Score = 174 (61.3 bits), Expect = 2.0e-11, P = 2.0e-11
 Identities = 48/146 (32%), Positives = 79/146 (54%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R V M    +E +++   G++   +G+ K +    T+ D  E+P  L  M++   PV+ +
Sbjct:   362 RIVQMHANKREEIKEVRAGDIAAAIGL-KDVTTGDTLCDP-ENPIILERMEFP-EPVISI 418

Query:   196 AVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQEDLI 372
             AVE K  +D  K+   L RL+K DP   V T EES + I+AG GELHL+I +  ++ +  
Sbjct:   419 AVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREF- 477

Query:   373 XTRGAPLKVSEPVVSFRETV-TDVSSIQ 453
                     V +P V++RE +   V+ I+
Sbjct:   478 ---NVEANVGKPQVAYREAIRAKVTDIE 502


>pir||S20656 translation elongation factor G - Synechocystis sp >gi|46483
            (X65159) elongation factor G [Synechocystis sp. (PCC 6803)]
            Length = 695

  Plus Strand HSPs:

 Score = 173 (60.9 bits), Expect = 2.5e-11, P = 2.5e-11
 Identities = 47/142 (33%), Positives = 78/142 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R V M    +E +E    G++V +VG+ K +    T+ D  ++P  L  M +   PV+
Sbjct:   350 IGRLVEMHADSREEIESAQAGDIVAIVGM-KNVQTGHTLCDP-KNPATLEPMVFP-DPVI 406

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDLQED 366
              +A++ K      KL   L ++ + DP   V T EESGE I+ G GELHL+I +  L+  
Sbjct:   407 SIAIKPKKKGMDEKLGMALSKMVQEDPSFQVETDEESGETIIKGMGELHLDIKMDILKR- 465

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                T G  +++ +P V++RE++T
Sbjct:   466 ---THGVEVEMGKPQVAYRESIT 485


>sp|P28371|EFG1_SYNY3 ELONGATION FACTOR G 1 (EF-G 1) >gnl|PID|d1019396 (D90916)
            elongation factor EF-G [Synechocystis sp.]
            Length = 695

  Plus Strand HSPs:

 Score = 173 (60.9 bits), Expect = 2.5e-11, P = 2.5e-11
 Identities = 47/142 (33%), Positives = 78/142 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R V M    +E +E    G++V +VG+ K +    T+ D  ++P  L  M +   PV+
Sbjct:   350 IGRLVEMHADSREEIESAQAGDIVAIVGM-KNVQTGHTLCDP-KNPATLEPMVFP-DPVI 406

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDLQED 366
              +A++ K      KL   L ++ + DP   V T EESGE I+ G GELHL+I +  L+  
Sbjct:   407 SIAIKPKKKGMDEKLGMALSKMVQEDPSFQVETDEESGETIIKGMGELHLDIKMDILKR- 465

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                T G  +++ +P V++RE++T
Sbjct:   466 ---THGVEVEMGKPQVAYRESIT 485


>sp|P75544|EFG_MYCPN ELONGATION FACTOR G (EF-G) >pir||S73930 elongation factor
            G - Mycoplasma pneumoniae (SGC3) (ATCC 29342) >gi|1674306
            (AE000058) Mycoplasma pneumoniae, elongation factor G; similar to
            Swiss-Prot Accession Number P13551, from T. aquaticus [Mycoplasma
            pneumoniae]
            Length = 688

  Plus Strand HSPs:

 Score = 172 (60.5 bits), Expect = 3.1e-11, P = 3.1e-11
 Identities = 46/148 (31%), Positives = 78/148 (52%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R V M  + +  +E+   G++  ++G+ K      T+ DD +    L  M+++  PV+
Sbjct:   350 VSRLVKMHAQNRNEIEEIRAGDICAIIGL-KDTTTGETLVDD-KIDVQLEAMQFA-QPVI 406

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              +AVE K  +D  K+   L +L++ DP     T  E+G+ I+AG GELHL+I +  ++ +
Sbjct:   407 SLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRRE 466

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQ 453
                     + V  P VSFRET    S ++
Sbjct:   467 F----KVEVNVGAPQVSFRETFNKESEVE 491


>gi|3328868 (AE001317) Elongation Factor G [Chlamydia trachomatis]
            Length = 694

  Plus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 4.0e-11, P = 4.0e-11
 Identities = 46/146 (31%), Positives = 79/146 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R + M    +   ++   G++   VG+ K+ V   T+ D  E+   + +   +  PV+
Sbjct:   357 ISRLLEMHANERTDRDEFTVGDIGACVGL-KFSVTGDTLCD--ENQEIVLERIEAPEPVI 413

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              +A+E K+  D  KL + L  LS+ DP   V T EE+G+ I++G GELHL+I    L++ 
Sbjct:   414 DMAIEPKSKGDREKLAQALSALSEEDPTFRVSTNEETGQTIISGMGELHLDI----LRDR 469

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSS 447
             +I        V +P VS++ET+T  S+
Sbjct:   470 MIREFRVEANVGKPQVSYKETITKTSN 496


>sp|P43925|EFG_HAEIN ELONGATION FACTOR G (EF-G) >pir||F64078 translation
            elongation factor EF-G (fusA homolog) - Haemophilus influenzae
            (strain Rd KW20) >gi|1573567 (U32739) elongation factor G (fusA)
            [Haemophilus influenzae Rd]
            Length = 700

  Plus Strand HSPs:

 Score = 171 (60.2 bits), Expect = 4.1e-11, P = 4.1e-11
 Identities = 48/146 (32%), Positives = 81/146 (55%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R V M    +E +++   G++   +G+ K +    T+    ++P  L  M++   PV+ V
Sbjct:   360 RIVQMHANKREEIKEVRAGDIAAAIGL-KDVTTGDTLCAI-DAPIILERMEFP-EPVISV 416

Query:   196 AVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQEDLI 372
             AVE K  +D  K+   L RL++ DP   V T EESGE I++G GELHL+I +  ++ +  
Sbjct:   417 AVEPKTKADQEKMGLALGRLAQEDPSFRVHTDEESGETIISGMGELHLDIIVDRMKREF- 475

Query:   373 XTRGAPLKVSEPVVSFRETV-TDVSSIQ 453
                     + +P VS+RET+ T V+ ++
Sbjct:   476 ---KVEANIGKPQVSYRETIRTRVNDVE 500


>sp|P47335|EFG_MYCGE ELONGATION FACTOR G (EF-G) >pir||H64209 translation
            elongation factor G - Mycoplasma genitalium (SGC3) >gi|1045766
            (U39688) elongation factor G [Mycoplasma genitalium]
            Length = 688

  Plus Strand HSPs:

 Score = 170 (59.8 bits), Expect = 5.1e-11, P = 5.1e-11
 Identities = 44/148 (29%), Positives = 79/148 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R V M  + +  +++   G++  ++G+ K      T+TDD +    L  M+++  PV+
Sbjct:   350 VSRLVKMHAQNRNEIDEIRAGDICAVIGL-KDTTTGETLTDD-KLDVQLEAMQFA-EPVI 406

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              +AVE K  +D  K+   L +L++ DP      + E+G+ I+AG GELHL+I +  ++ +
Sbjct:   407 SLAVEPKTKADQEKMSIALSKLAEEDPTFKTFSDPETGQTIIAGMGELHLDILVDRMKRE 466

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQ 453
                     + +  P VSFRET    S ++
Sbjct:   467 F----KVEVNIGAPQVSFRETFKSTSEVE 491


>sp|P41084|EFG_RICPR ELONGATION FACTOR G (EF-G) >gi|987966 (Z54171) elongation
            factor EF-G [Rickettsia prowazekii]
            Length = 699

  Plus Strand HSPs:

 Score = 170 (59.8 bits), Expect = 5.2e-11, P = 5.2e-11
 Identities = 50/171 (29%), Positives = 84/171 (49%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R +LM    +E +++   G++V L G+ K      T++D  +    L  M++   PV+
Sbjct:   352 IGRMLLMHANNREDIKEASAGDIVALAGL-KDTSTGDTLSDIDKQV-VLERMEFP-EPVI 408

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              +AVE K+ +D  K+   L RL+  DP   V T  E+G+ ++ G GELHLEI +  ++ +
Sbjct:   409 ELAVEPKSTADQEKMGLALSRLAAEDPSFRVSTDHETGQTVIKGMGELHLEIIIDRMRRE 468

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEEL 522
                       +  P V++RET+T    I    K  +     F R   + E L
Sbjct:   469 F----KVEANIGAPQVAYRETITTACEIDYTHKKQSGGAGQFARVKIIFEPL 516


>prf||0905186A elongation factor G [Escherichia coli]
            Length = 701

  Plus Strand HSPs:

 Score = 170 (59.8 bits), Expect = 5.2e-11, P = 5.2e-11
 Identities = 49/142 (34%), Positives = 77/142 (54%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R V M    +E +++   G++   +G+    V +     D ++P  L  M++   PV+ +
Sbjct:   358 RIVQMHANKREEIKEVRAGDIAAAIGLKD--VTTGDCLCDPDAPIILERMEFP-EPVISI 414

Query:   196 AVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQEDLI 372
             AVE K  +D  K+   L RL+K DP   V T EES + I+AG GELHL+I +  ++ +  
Sbjct:   415 AVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREF- 473

Query:   373 XTRGAPLKVSEPVVSFRET----VTDV 441
                     V +P V++RET    VTDV
Sbjct:   474 ---NVEANVGKPQVAYRETIRQKVTDV 497


>pir||EFECG translation elongation factor EF-G - Escherichia coli
            Length = 702

  Plus Strand HSPs:

 Score = 170 (59.8 bits), Expect = 5.3e-11, P = 5.3e-11
 Identities = 49/142 (34%), Positives = 77/142 (54%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R V M    +E +++   G++   +G+    V +     D ++P  L  M++   PV+ +
Sbjct:   359 RIVQMHANKREEIKEVRAGDIAAAIGLKD--VTTGDCLCDPDAPIILERMEFP-EPVISI 415

Query:   196 AVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQEDLI 372
             AVE K  +D  K+   L RL+K DP   V T EES + I+AG GELHL+I +  ++ +  
Sbjct:   416 AVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREF- 474

Query:   373 XTRGAPLKVSEPVVSFRET----VTDV 441
                     V +P V++RET    VTDV
Sbjct:   475 ---NVEANVGKPQVAYRETIRQKVTDV 498


>sp|P38525|EFG_THEMA ELONGATION FACTOR G (EF-G)
            Length = 682

  Plus Strand HSPs:

 Score = 169 (59.5 bits), Expect = 6.4e-11, P = 6.4e-11
 Identities = 47/141 (33%), Positives = 78/141 (55%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R V M    +E V+    G++   VG+ K      T+  + E P  L  + +   PV+
Sbjct:   355 ISRIVFMHADKREEVDYFRPGDIAAGVGL-KVSQTGDTLWHEKE-PIILEKIDFP-EPVI 411

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              +AVE    +D  KLV+ L  LS+ DP +   ++ E+GE+I++G GELHLEI +  L+ +
Sbjct:   412 SLAVEPVTKADEEKLVKALLALSEEDPTLQVRVDKETGENIISGMGELHLEIVVDRLKRE 471

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
                  G  ++V +P V++RET+
Sbjct:   472 F----GVNVRVGQPQVAYRETI 489


>gi|2654448 (U78300) elongation factor G [Thiobacillus cuprinus]
            Length = 702

  Plus Strand HSPs:

 Score = 169 (59.5 bits), Expect = 6.7e-11, P = 6.7e-11
 Identities = 46/141 (32%), Positives = 77/141 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R V M    ++ +++   G++   +G+ + I    T+ D  ES   L  M +   PV+
Sbjct:   356 IGRFVQMHANQRDEIKEVRAGDIAPAIGL-REITTGETLCDP-ESIITLEKMVFP-EPVI 412

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
               AVE K  +D  K+   L+R+++ DP   V T EESG+ I++G GELHLEI +  ++ +
Sbjct:   413 SQAVEPKTKADQEKMGIALQRVAQEDPSFRVKTDEESGQTIISGMGELHLEILVDRMKRE 472

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
                  G    V +P V++RET+
Sbjct:   473 F----GVEANVGKPQVAYRETI 490


>bbs|57690 (S57688) EF-G=elongation factor G [Thermotoga maritima, Peptide, 682
           aa] [Thermotoga maritima]
           Length = 682

  Plus Strand HSPs:

 Score = 166 (58.4 bits), Expect = 1.4e-10, P = 1.4e-10
 Identities = 47/141 (33%), Positives = 77/141 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R V M    +E V+    G++   VG+ K      T+  + E P  L  + +   PV+
Sbjct:   355 ISRIVFMHADKREEVDYFRPGDIAAGVGL-KVSQTGDTLWHEKE-PIILEKIDFP-EPVI 411

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              +AVE    +D  KLV+ L  LS+ DP +   ++ E+GE I++G GELHLEI +  L+ +
Sbjct:   412 SLAVEPVTKADEEKLVKALLALSEEDPTLQVRVDKETGETIISGMGELHLEIVVDRLKRE 471

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
                  G  ++V +P V++RET+
Sbjct:   472 F----GVNVRVGQPQVAYRETI 489


>gi|402753 (X71439) translation elongation factor EF-G [Glycine max]
           Length = 703

  Plus Strand HSPs:

 Score = 166 (58.4 bits), Expect = 1.4e-10, P = 1.4e-10
 Identities = 43/152 (28%), Positives = 81/152 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R + M    ++ V+    G+++ L G+ K  +   T+ D  ++P  L  M +   PV+
Sbjct:   359 IGRLLEMHANSRDDVKVALAGDIIALAGL-KDTITGETLCDP-DNPIVLERMDFP-DPVI 415

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
             +VA+E K  +D+ K+  GL +L++ DP       EE  + ++ G GELHLEI +  L+ +
Sbjct:   416 KVAIEPKTKADVDKMATGLIKLAQEDPSFHFSRDEEINQTVIEGMGELHLEIIVDRLKRE 475

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSK 465
                       V  P V++RE+++ +S ++ + K
Sbjct:   476 F----KVEANVGAPQVNYRESISKISEVKYVHK 504


>pir||S35701 translation elongation factor G, chloroplast - soybean
            Length = 787

  Plus Strand HSPs:

 Score = 166 (58.4 bits), Expect = 1.7e-10, P = 1.7e-10
 Identities = 43/152 (28%), Positives = 81/152 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R + M    ++ V+    G+++ L G+ K  +   T+ D  ++P  L  M +   PV+
Sbjct:   443 IGRLLEMHANSRDDVKVALAGDIIALAGL-KDTITGETLCDP-DNPIVLERMDFP-DPVI 499

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
             +VA+E K  +D+ K+  GL +L++ DP       EE  + ++ G GELHLEI +  L+ +
Sbjct:   500 KVAIEPKTKADVDKMATGLIKLAQEDPSFHFSRDEEINQTVIEGMGELHLEIIVDRLKRE 559

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSK 465
                       V  P V++RE+++ +S ++ + K
Sbjct:   560 F----KVEANVGAPQVNYRESISKISEVKYVHK 588


>sp|P34811|EFGC_SOYBN ELONGATION FACTOR G, CHLOROPLAST PRECURSOR (EF-G)
            Length = 788

  Plus Strand HSPs:

 Score = 166 (58.4 bits), Expect = 1.7e-10, P = 1.7e-10
 Identities = 43/152 (28%), Positives = 81/152 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R + M    ++ V+    G+++ L G+ K  +   T+ D  ++P  L  M +   PV+
Sbjct:   444 IGRLLEMHANSRDDVKVALAGDIIALAGL-KDTITGETLCDP-DNPIVLERMDFP-DPVI 500

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
             +VA+E K  +D+ K+  GL +L++ DP       EE  + ++ G GELHLEI +  L+ +
Sbjct:   501 KVAIEPKTKADVDKMATGLIKLAQEDPSFHFSRDEEINQTVIEGMGELHLEIIVDRLKRE 560

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSK 465
                       V  P V++RE+++ +S ++ + K
Sbjct:   561 F----KVEANVGAPQVNYRESISKISEVKYVHK 589


>sp|P56002|EFG_HELPY ELONGATION FACTOR G (EF-G) >gi|2314354 (AE000625)
            translation elongation factor EF-G (fusA) [Helicobacter pylori]
            Length = 692

  Plus Strand HSPs:

 Score = 164 (57.7 bits), Expect = 2.3e-10, P = 2.3e-10
 Identities = 44/141 (31%), Positives = 77/141 (54%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M    +E +++   G +   VG+ K  +   T+ D+ ++   L  M++   PV+
Sbjct:   352 VGRLLKMHSNKREDIKEVYAGEICAFVGL-KDTLTGDTLCDE-KNAVVLERMEFP-EPVI 408

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              +AVE K  +D  K+   L +L++ DP   V T EE+G+ ++ G GELHLEI +  L+ +
Sbjct:   409 HIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKRE 468

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
                      ++ +P V+FRET+
Sbjct:   469 F----KVEAEIGQPQVAFRETI 486


>gi|2982776 (AE000669) elongation factor EF-G [Aquifex aeolicus]
            Length = 699

  Plus Strand HSPs:

 Score = 164 (57.7 bits), Expect = 2.3e-10, P = 2.3e-10
 Identities = 41/139 (29%), Positives = 74/139 (53%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R +LM    +E ++    G +  +VG+D       T+ D+ + P  L  +++   PV+ +
Sbjct:   358 RLLLMHANSREEIQQVSAGEICAVVGLDA--ATGDTLCDE-KHPIILEKLEFP-DPVISM 413

Query:   196 AVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQEDLI 372
             A+E K   D  KL + L +  K DP    T + E+G+ ++ G GELHLEI +  ++ +  
Sbjct:   414 AIEPKTKKDQEKLSQVLNKFMKEDPTFRATTDPETGQILIHGMGELHLEIMVDRMKREY- 472

Query:   373 XTRGAPLKVSEPVVSFRETV 432
                G  + V +P V+++ET+
Sbjct:   473 ---GIEVNVGKPQVAYKETI 489


>sp|P18667|EFG_ANANI ELONGATION FACTOR G (EF-G) >pir||S04429 translation
            elongation factor G - Synechococcus sp >gnl|PID|e249515 (X17442)
            fus gene product [Synechococcus PCC6301]
            Length = 694

  Plus Strand HSPs:

 Score = 160 (56.3 bits), Expect = 6.1e-10, P = 6.1e-10
 Identities = 43/141 (30%), Positives = 78/141 (55%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R +++    +  V++   G++  ++G+ K      T+ DD ++P  L  + +   PV+
Sbjct:   352 VSRLIILKADDRIEVDELRAGDLGAVLGL-KDTFTGDTLCDD-QNPIILESL-FIPEPVI 408

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              VAVE K  +D+ KL + L+ LS+ DP    +++ E+ + ++AG GELHLEI    L + 
Sbjct:   409 SVAVEPKTKNDMEKLSKALQALSEEDPTFRVSVDSETNQTVIAGMGELHLEI----LVDR 464

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
             ++        +  P V++RETV
Sbjct:   465 MLREYKVEANIGAPQVAYRETV 486


>sp|P13550|EFG_SPIPL ELONGATION FACTOR G (EF-G) >pir||S04390 translation
            elongation factor G - Spirulina platensis >gi|581727 (X15646)
            translation elongation factor EF-G (AA 1-697) [Spirulina platensis]
            Length = 697

  Plus Strand HSPs:

 Score = 159 (56.0 bits), Expect = 7.9e-10, P = 7.9e-10
 Identities = 43/141 (30%), Positives = 75/141 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R +++    +  VE+   G++   +G+ K  +   TI D+  S   + +  Y   PV+
Sbjct:   354 ISRLIVLKSDERIEVEELRAGDLGAALGL-KDTLTGDTICDEANSI--ILESLYIPEPVI 410

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              VAVE K   D+ KL + L+ LS+ DP    +I+ E+ + ++AG GELHLEI    L + 
Sbjct:   411 SVAVEPKTKQDMEKLSKALQSLSEEDPTFRVSIDSETNQTVIAGMGELHLEI----LVDR 466

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
             ++        +  P V++RET+
Sbjct:   467 MLREFKVEANIGAPQVAYRETI 488


>sp|P74228|EFG2_SYNY3 ELONGATION FACTOR G 2 (EF-G 2) >gnl|PID|d1019055 (D90913)
            elongation factor EF-G [Synechocystis sp.]
            Length = 691

  Plus Strand HSPs:

 Score = 157 (55.3 bits), Expect = 1.3e-09, P = 1.3e-09
 Identities = 43/141 (30%), Positives = 76/141 (53%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             + R +++    +  V+    G++  ++G+ K  +   T+ DD E P  L  + +   PV+
Sbjct:   349 ISRLIILKADDRIEVDQLNAGDLGAVLGL-KDTLTGDTLCDDQE-PIILESL-FVPQPVI 405

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              VAVE K   D+ KL + L+ LS+ DP    +++ E+ + ++AG GELHLEI    L + 
Sbjct:   406 SVAVEPKTKQDMDKLSKALQSLSEEDPTFRVSVDPETNQTVIAGMGELHLEI----LVDR 461

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
             ++        V  P V++RET+
Sbjct:   462 MLREFKVEANVGAPQVAYRETI 483


>sp|P70782|EFG_AGRTU ELONGATION FACTOR G (EF-G) >gnl|PID|e268257 (X99673)
            elongation factor EF-G [Agrobacterium tumefaciens]
            Length = 699

  Plus Strand HSPs:

 Score = 157 (55.3 bits), Expect = 1.3e-09, P = 1.3e-09
 Identities = 47/142 (33%), Positives = 72/142 (50%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M    +E +E+   G++V L G  K      T+ D  + P  L  M++   PV+
Sbjct:   357 VGRMLQMHSNSREDIEEAFAGDIVALAG-HKETTTGDTLCDPLK-PVILERMEFP-EPVI 413

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
             ++A+E K   D  K+   L R +  DP   V T EESG+   AG GELHL+I +  ++ +
Sbjct:   414 QIAIEPKTKGDQEKMGLALNRRAAEDPSFRVKTDEESGQTYYAGMGELHLDILVDRMRRE 473

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                       V  P V++RET+T
Sbjct:   474 F----KVEATVGAPQVAYRETIT 492


>gi|3322737 (AE001222) translation elongation factor G (fusA-1) [Treponema
            pallidum]
            Length = 683

  Plus Strand HSPs:

 Score = 155 (54.6 bits), Expect = 2.0e-09, P = 2.0e-09
 Identities = 43/141 (30%), Positives = 72/141 (51%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M     E VE    G++  +VG+     ++     DG  P  L  M +   PV+
Sbjct:   348 VYRILRMHSNKSETVECIQAGDIAVIVGLKS--AQTGDSVGDGSCPVVLESMHFP-EPVI 404

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              V++E  + S   KL E L  LS+ DP   V    E+G+ +++G GELHL++    ++ED
Sbjct:   405 SVSLEPMDASSRDKLQETLGILSREDPTFSVREDAETGQLLISGMGELHLDVLTTRMRED 464

Query:   367 LIXTRGAPLKVSEPVVSFRETV 432
                     ++V +P V++RE++
Sbjct:   465 F----NVQVRVGKPHVTYRESI 482


>pir||S38928 elongation factor G - Aquifex pyrophilus (fragment)
            Length = 684

  Plus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 2.6e-09, P = 2.6e-09
 Identities = 42/139 (30%), Positives = 74/139 (53%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R +LM    +E ++    G +  +VG+D       T+ D+ + P  L  +++   PV+ +
Sbjct:   356 RLLLMHANSREEIQQVSAGEICAVVGLDA--ATGDTLCDE-KHPIILEKLEFP-DPVISM 411

Query:   196 AVEAKNPSDLPKLVEGLKRLS-KSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQEDL 369
             A+E K   D  KL + L   S K DP    T + E+G+ ++ G GELHLEI +  ++ + 
Sbjct:   412 AIEPKTKKDQEKLSQVLNLSSLKEDPTFRATTDPETGQILIHGMGELHLEIMVDRMRREY 471

Query:   370 IXTRGAPLKVSEPVVSFRETV 432
                 G  + V +P V+++ET+
Sbjct:   472 ----GIEVNVGKPQVAYKETI 488


>sp|P46211|EFG_AQUPY ELONGATION FACTOR G (EF-G) >gi|642967 (X74277) elongation
            factor G [Aquifex pyrophilus]
            Length = 700

  Plus Strand HSPs:

 Score = 154 (54.2 bits), Expect = 2.7e-09, P = 2.7e-09
 Identities = 42/139 (30%), Positives = 74/139 (53%), Frame = +1

Query:    16 RTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRV 195
             R +LM    +E ++    G +  +VG+D       T+ D+ + P  L  +++   PV+ +
Sbjct:   357 RLLLMHANSREEIQQVSAGEICAVVGLDA--ATGDTLCDE-KHPIILEKLEFP-DPVISM 412

Query:   196 AVEAKNPSDLPKLVEGLKRLS-KSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQEDL 369
             A+E K   D  KL + L   S K DP    T + E+G+ ++ G GELHLEI +  ++ + 
Sbjct:   413 AIEPKTKKDQEKLSQVLNLSSLKEDPTFRATTDPETGQILIHGMGELHLEIMVDRMRREY 472

Query:   370 IXTRGAPLKVSEPVVSFRETV 432
                 G  + V +P V+++ET+
Sbjct:   473 ----GIEVNVGKPQVAYKETI 489


>gnl|PID|e1309416 (AL031013) elongation factor G [Streptomyces coelicolor]
            Length = 686

  Plus Strand HSPs:

 Score = 151 (53.2 bits), Expect = 1.1e-08, P = 1.1e-08
 Identities = 42/129 (32%), Positives = 73/129 (56%), Frame = +1

Query:    46 EAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDL 225
             + +E    G++V +VG+ K     +T+   G +P  L     +  PVV VAVEA+  ++ 
Sbjct:   358 DPLERAVAGDIVAVVGL-KTARAGSTLCAPG-APLLLEPPGVA-EPVVHVAVEARRSTET 414

Query:   226 PKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXTRGAPLKVS 402
              +L   L RL++ DP L + T  E+ + +++G GELHLE+ ++ ++ +     G  + V 
Sbjct:   415 DRLAAALARLTEEDPSLALRTDPETAQTVLSGMGELHLEVAVERVRREY----GLEVTVG 470

Query:   403 EPVVSFRETV 432
              P V++RETV
Sbjct:   471 RPGVAYRETV 480


>gi|414451 (U01722) unknown [Mycoplasma genitalium]
           Length = 229

  Plus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 5.2e-08, P = 5.2e-08
 Identities = 36/111 (32%), Positives = 63/111 (56%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R V M  + +  +++   G++  ++G+ K      T+TDD +    L  M+++  PV+
Sbjct:   121 VSRLVKMHAQNRNEIDEIRAGDICAVIGL-KDTTTGETLTDD-KLDVQLEAMQFA-EPVI 177

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEI 342
              +AVE K  +D  K+   L +L++ DP      + E+G+ I+AG GELHL+I
Sbjct:   178 SLAVEPKTKADQEKMSIALSKLAEEDPTFKTFSDPETGQTIIAGMGELHLDI 229


>gi|192989 (M76131) elongation factor 2 [Mus musculus]
           Length = 268

  Plus Strand HSPs:

 Score = 143 (50.3 bits), Expect = 7.8e-08, P = 7.8e-08
 Identities = 27/60 (45%), Positives = 40/60 (66%), Frame = +1

Query:   454 CLSKSANKHNRLFCRGAPLTEELCVXMEEGLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             CLSKS NKHNRL+ +  P  + L   +++G    +  + K RAR+LA+ ++WDVA+AR I
Sbjct:     1 CLSKSPNKHNRLYMKARPFPDGLAEDIDKG-EVSARQELKARARYLAEKYEWDVAEARKI 59


>gi|2688449 (AE001155) translation elongation factor G (fus-1) [Borrelia
            burgdorferi]
            Length = 693

  Plus Strand HSPs:

 Score = 145 (51.0 bits), Expect = 2.5e-07, P = 2.5e-07
 Identities = 45/171 (26%), Positives = 79/171 (46%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M     E +E    G++V L G++       T  D   + + +  M +   PV+
Sbjct:   349 VGRLIRMHANNTEDIEFGGSGDIVALFGIE--CASGDTFCDPSIN-YSMTSM-FIPDPVI 404

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              ++V+ K+      + + L R +K DP     ++ ES E I+ G GELHLE+ ++ ++ +
Sbjct:   405 SLSVKPKDKKSADNMAKALGRFTKEDPTFKTYVDIESNETIIQGMGELHLEVYIERMKRE 464

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEEL 522
                   A ++   P V++RET+T  +      K  +     F R A   E L
Sbjct:   465 F----KAEVETGMPQVAYRETITRKAEFNYTHKKQSGGAGQFGRVAGFMEPL 512


>sp|P30767|EFG_MYCLE ELONGATION FACTOR G (EF-G) >pir||S31150 translation
            elongation factor G - Mycobacterium leprae >gi|581337 (Z14314)
            elongation factor G [Mycobacterium leprae]
            Length = 701

  Plus Strand HSPs:

 Score = 144 (50.7 bits), Expect = 3.5e-07, P = 3.5e-07
 Identities = 38/138 (27%), Positives = 69/138 (50%), Frame = +1

Query:    28 MMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEA 207
             M    +  VE    G++  ++G+ K      T+ D       L  M +   PV+ VA+E 
Sbjct:   363 MHSNKENPVETASAGHIYAVIGL-KDTTTGDTLADPNNQI-VLESMTFP-DPVIEVAIEP 419

Query:   208 KNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQEDLIXTRG 384
             K  SD  KL   +++L++ DP     ++ E+G+ ++ G GELHL+I +  ++ +      
Sbjct:   420 KTKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGMGELHLDILVDRMRREF----K 475

Query:   385 APLKVSEPVVSFRETVTDV 441
                 V +P V+++ET+  V
Sbjct:   476 VEANVGKPQVAYKETIRRV 494


>sp|O30913|EFG_BORBU ELONGATION FACTOR G (EF-G) >gi|2460295 (AF021260)
            elongation factor G homolog [Borrelia burgdorferi]
            Length = 693

  Plus Strand HSPs:

 Score = 143 (50.3 bits), Expect = 5.3e-07, P = 5.3e-07
 Identities = 39/142 (27%), Positives = 71/142 (50%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M     E +E    G++V L G++       T  D   + + +  M +   PV+
Sbjct:   349 VGRLIRMHANNTEDIEFGGSGDIVALFGIE--CASGDTFCDPSIN-YSMTSM-FIPDPVI 404

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              ++V+ K+      + + L R +K DP     ++ ES E I+ G GELHLE+ ++ ++ +
Sbjct:   405 SLSVKPKDKKSADNMAKALGRFTKEDPTFKTYVDIESNETIIQGMGELHLEVYIERMKRE 464

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                   A ++   P V++RET+T
Sbjct:   465 F----KAEVETGMPQVAYRETIT 483


>gi|1127771 (U40242) elongation factor 2 [unidentified archaeon 4B7]
            Length = 90

  Plus Strand HSPs:

 Score = 121 (42.6 bits), Expect = 7.3e-07, P = 7.3e-07
 Identities = 29/84 (34%), Positives = 48/84 (57%), Frame = +1

Query:   271 LVVCTIEESGEHIVAGAGELHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRETVTDVSSI 450
             LV+   EE+GE I  G G  HL++ +     +LI      +  SEP++++RET+T     
Sbjct:     3 LVIKIDEETGETIXXGMGVGHLDVAV-----NLIKDAKIEIITSEPLINYRETITGGCE- 56

Query:   451 QCLSKSANKHNRLFCRGAPLTEEL 522
               ++KS N+HN++F +  PL  E+
Sbjct:    57 PVMAKSPNRHNKIFMKVEPLEPEI 80


>gnl|PID|e1299745 (AL021943) fusA [Mycobacterium tuberculosis]
            Length = 701

  Plus Strand HSPs:

 Score = 142 (50.0 bits), Expect = 7.4e-07, P = 7.4e-07
 Identities = 36/135 (26%), Positives = 70/135 (51%), Frame = +1

Query:    28 MMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEA 207
             M    +  V+    G++  ++G+ K      T++D  +    L  M +   PV+ VA+E 
Sbjct:   363 MHSNKENPVDRASAGHIYAVIGL-KDTTTGDTLSDPNQQI-VLESMTFP-DPVIEVAIEP 419

Query:   208 KNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQEDLIXTRG 384
             K  SD  KL   +++L++ DP     ++ E+G+ ++ G GELHL+I +  ++ +      
Sbjct:   420 KTKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGMGELHLDILVDRMRREF----K 475

Query:   385 APLKVSEPVVSFRETV 432
                 V +P V+++ET+
Sbjct:   476 VEANVGKPQVAYKETI 491


>sp|P09952|EFG_MICLU ELONGATION FACTOR G (EF-G) >pir||C26956 translation
            elongation factor G - Micrococcus luteus >gi|149853 (M17788)
            elongation factor G (gtg start codon) [Micrococcus luteus]
            Length = 701

  Plus Strand HSPs:

 Score = 138 (48.6 bits), Expect = 2.7e-06, P = 2.7e-06
 Identities = 37/135 (27%), Positives = 67/135 (49%), Frame = +1

Query:    28 MMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEA 207
             M    +  V++   G++  ++G+ K      T+ D   +P  L  M +   PV+ VA+E 
Sbjct:   361 MHANKENPVDEVVAGHIYAVIGL-KDTTTGDTLCDPA-NPIILESMTFP-EPVISVAIEP 417

Query:   208 KNPSDLPKLVEGLKRLSKSDPLVVCTI-EESGEHIVAGAGELHLEICLKDLQEDLIXTRG 384
             K   D  KL   +++L   DP     + EE+G+  + G GELHL++ +  ++ +      
Sbjct:   418 KTKGDQEKLSTAIQKLVAEDPTFRVNLNEETGQTEIGGMGELHLDVFVDRMKREF----K 473

Query:   385 APLKVSEPVVSFRETV 432
                 V +P V++RET+
Sbjct:   474 VEANVGKPQVAYRETI 489


>sp|P80868|EFG_BACSU ELONGATION FACTOR G (EF-G) (VEGETATIVE PROTEIN 19) (VEG19)
            >gnl|PID|d1011661 (D64127) elongation factor G [Bacillus subtilis]
            >gnl|PID|e1182045 (Z99104) elongation factor G [Bacillus subtilis]
            Length = 692

  Plus Strand HSPs:

 Score = 137 (48.2 bits), Expect = 3.7e-06, P = 3.7e-06
 Identities = 41/140 (29%), Positives = 71/140 (50%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R + M    +E +     G++   VG+ K      T+ D+ +    L  M++   PV+
Sbjct:   351 VGRILQMHANSREEISTVYAGDIAAAVGL-KDTTTGDTLCDEKDLVI-LESMEFP-EPVI 407

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLV-VCTIEESGEHIVAGAGELHLEICLKDLQED 366
              VA+E K+ +D  K+   L +L++ DP     T  E+G+ I++G GELHL+I +  ++ +
Sbjct:   408 DVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLDIIVDRMKRE 467

Query:   367 LIXTRGAPLKVSEPVVSFRET 429
                       V  P V++RET
Sbjct:   468 F----KVEANVGAPQVAYRET 484


>gi|3918 (X58378) mitochondrial elongation factor G [Saccharomyces cerevisiae]
         Length = 761

  Plus Strand HSPs:

 Score = 133 (46.8 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 42/142 (29%), Positives = 65/142 (45%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R V M     E V++   G +    G+D       T TD G   + +  M Y    VV
Sbjct:   417 VARLVRMHSSEMEDVDEVGSGEICATFGID--CASGDTFTD-GSVQYSMSSM-YVPDAVV 472

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              +++ + N  D     + L R  K DP      + ES E I++G GELHLEI ++ ++ +
Sbjct:   473 SLSITS-NSKDASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGELHLEIYVERMRRE 531

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                         +P VS+RE++T
Sbjct:   532 Y----NVDCVTGKPQVSYRESIT 550


>sp|P25039|EFG1_YEAST ELONGATION FACTOR G, MITOCHONDRIAL 1 PRECURSOR (MEF-G-1)
            >pir||S61642 translation elongation factor G, mitochondrial - yeast
            (Saccharomyces cerevisiae) >gnl|PID|e217778 (X94607) Mef1 protein
            [Saccharomyces cerevisiae] >gnl|PID|e245791 (Z73241) ORF YLR069c
            [Saccharomyces cerevisiae]
            Length = 761

  Plus Strand HSPs:

 Score = 132 (46.5 bits), Expect = 1.9e-05, P = 1.9e-05
 Identities = 42/142 (29%), Positives = 64/142 (45%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R V M     E V++   G +    G+D       T TD G   + +  M Y    VV
Sbjct:   417 VARLVRMHSSEMEDVDEVGSGEICATFGID--CASGDTFTD-GSVQYSMSSM-YVPDAVV 472

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              +++   N  D     + L R  K DP      + ES E I++G GELHLEI ++ ++ +
Sbjct:   473 SLSI-TPNSKDASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGELHLEIYVERMRRE 531

Query:   367 LIXTRGAPLKVSEPVVSFRETVT 435
                         +P VS+RE++T
Sbjct:   532 Y----NVDCVTGKPQVSYRESIT 550


>gi|2688636 (AE001170) translation elongation factor G (fus-2) [Borrelia
            burgdorferi]
            Length = 669

  Plus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 5.1e-05, P = 5.1e-05
 Identities = 38/128 (29%), Positives = 71/128 (55%), Frame = +1

Query:    46 EAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDL 225
             E ++    G++  ++G+ K+ V   T+ +  E+ + L +      PVV ++VE +  SD 
Sbjct:   357 EQIDFVKTGDIGAVLGL-KFSVTGDTLVE--ENNNVLLEAVMFPEPVVLMSVEPERSSDE 413

Query:   226 PKLVEGLKRLSKSDPLVVCT-IEESGEHIVAGAGELHLEICLKDLQEDLIXTRGAPLKVS 402
              +L E  + +SK DP    +  +E+G+ I++G GELHLEI L  ++++        +   
Sbjct:   414 VRLKEIFEIISKEDPTFSYSESKETGQLIISGMGELHLEIILTRIKDEF----NLNVYTG 469

Query:   403 EPVVSFRET 429
             +P VS+RE+
Sbjct:   470 KPQVSYRES 478


>gi|3323075 (AE001248) translation elongation factor G (fusA-2) [Treponema
            pallidum]
            Length = 695

  Plus Strand HSPs:

 Score = 128 (45.1 bits), Expect = 5.4e-05, P = 5.4e-05
 Identities = 40/171 (23%), Positives = 77/171 (45%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             V R V M     E + +   G++V L GVD     S      G+  + +  M +   PV+
Sbjct:   350 VGRLVRMNSNQMEDISEGTPGDIVALFGVD---CASGDTFCSGDLNYAMTSM-FVPEPVI 405

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIE-ESGEHIVAGAGELHLEICLKDLQED 366
              +++  K+     ++ + L R +K DP     ++ ES + I+ G GELHL++ ++ ++ +
Sbjct:   406 SLSITPKDKRSADQVSKALNRFTKEDPTFRSFVDPESNQTIIQGMGELHLDVYIERMRRE 465

Query:   367 LIXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANKHNRLFCRGAPLTEEL 522
                     ++   P V++RE ++  +      K     +  F R A   E +
Sbjct:   466 Y----KCEVETGMPQVAYREAISARADFNYTHKKQTGGSGQFGRVAGFIEPI 513


>gnl|PID|e304406 (Z83235) K10C3.5 [Caenorhabditis elegans]
            Length = 906

  Plus Strand HSPs:

 Score = 127 (44.7 bits), Expect = 0.00010, P = 0.00010
 Identities = 45/145 (31%), Positives = 76/145 (52%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVV-GLV-GVD-KYIVKSATITDDGESPHPLRDMKYSVS 180
             + R  ++ GR     +  P   V  G++  +D + ++++ T+ +  + P  L+    +  
Sbjct:   422 IDRISILRGR-----DSIPTDTVTSGMICTIDAEILLQNTTLCEKPDFPC-LKIGSQTGE 475

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEICLKDLQ 360
              +VRV++  +   D+  L E LK L+  D  +     E+GE  +  AGE+HL+ C+KDL 
Sbjct:   476 ALVRVSISTQQLDDMDDLREKLKLLALLDTSLKVMELENGELAMVTAGEVHLQKCIKDLN 535

Query:   361 EDLIXTRGAPLKVSEPVVSFRETVTDVS 444
              DL       L VSEP+V F ETV + S
Sbjct:   536 -DLGLV---DLDVSEPIVPFMETVIEDS 559


>bbs|134292 (S62928) PRB1M precursor protein=basic proline-rich proteins (Ps,
            PmF, PmS, and Pe) precursor(Ps 1=basic proline-rich protein)
            {C-terminal} [human, salivary, Peptide Partial, 297 aa] [Homo
            sapiens]
            Length = 297

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00012, P = 0.00012
 Identities = 60/203 (29%), Positives = 74/203 (36%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    83 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG---- 137

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     RP      P  P G  P   + R  Q     PQ    QG    
Sbjct:   138 PPPPPGKPQGPPQQGGNRPQ-GPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQP 196

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G +   PPP    +  P      A GGS+ +    R      Q
Sbjct:   197 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP------AQGGSKSQS--ARAPPGKPQ 248

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
              PP Q+     GPP P G +P   P A PA
Sbjct:   249 GPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 277

 Score = 91 (32.0 bits), Expect = 0.37, P = 0.31
 Identities = 54/198 (27%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    22 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG---- 76

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     +P      P  P G  P   + +  +     PQ    QG    
Sbjct:    77 PPPPPGKPQGPPPQGGNKPQ-GPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQP 135

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G R   PPP    +  P        G   R P   +      Q
Sbjct:   136 QGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQ------GDKSRSP---QSPPGKPQ 186

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVP 20
              PP Q   +  GPP PPG  P   P
Sbjct:   187 GPPPQGGNQPQGPPPPPGK-PQGPP 210


>sp|P04280|PRP1_HUMAN SALIVARY PROLINE-RICH PROTEIN PRECURSOR (CONTAINS: BASIC
            PEPTIDE IB-6, PEPTIDE P-H) (CLONES CP3, CP4 AND CP5) >gi|190486
            (K03204) salivary proline-rich protein precursor [Homo sapiens]
            >gi|1483622 (M97220) salivary proline-rich protein [Homo sapiens]
            Length = 331

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00016, P = 0.00016
 Identities = 60/203 (29%), Positives = 74/203 (36%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:   117 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG---- 171

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     RP      P  P G  P   + R  Q     PQ    QG    
Sbjct:   172 PPPPPGKPQGPPQQGGNRPQ-GPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQP 230

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G +   PPP    +  P      A GGS+ +    R      Q
Sbjct:   231 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP------AQGGSKSQS--ARAPPGKPQ 282

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
              PP Q+     GPP P G +P   P A PA
Sbjct:   283 GPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 311

 Score = 91 (32.0 bits), Expect = 0.44, P = 0.36
 Identities = 54/198 (27%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    56 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG---- 110

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     +P      P  P G  P   + +  +     PQ    QG    
Sbjct:   111 PPPPPGKPQGPPPQGGNKPQ-GPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQP 169

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G R   PPP    +  P        G   R P   +      Q
Sbjct:   170 QGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQ------GDKSRSP---QSPPGKPQ 220

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVP 20
              PP Q   +  GPP PPG  P   P
Sbjct:   221 GPPPQGGNQPQGPPPPPGK-PQGPP 244


>pir||PIHUB6 salivary proline-rich protein precursor PRB1 (large allele) -
            human
            Length = 392

  Minus Strand HSPs:

 Score = 120 (42.2 bits), Expect = 0.00021, P = 0.00021
 Identities = 60/203 (29%), Positives = 74/203 (36%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:   178 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG---- 232

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     RP      P  P G  P   + R  Q     PQ    QG    
Sbjct:   233 PPPPPGKPQGPPQQGGNRPQ-GPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQP 291

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G +   PPP    +  P      A GGS+ +    R      Q
Sbjct:   292 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP------AQGGSKSQS--ARAPPGKPQ 343

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
              PP Q+     GPP P G +P   P A PA
Sbjct:   344 GPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 372

 Score = 91 (32.0 bits), Expect = 0.57, P = 0.43
 Identities = 54/198 (27%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    56 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG---- 110

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     +P      P  P G  P   + +  +     PQ    QG    
Sbjct:   111 PPPPPGKPQGPPPQGGNKPQ-GPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQP 169

Query:   256 RGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*WWRISQCTCQH 92
             +G   P     G     PPPQ   +   P       G    G   + P   R      Q 
Sbjct:   170 QGPPPPPGKPQG-----PPPQGGNKPQGPPPPGKPQGPPPQGDKSQSP---RSPPGKPQG 221

Query:    91 PPDQQRCRTDGPPLPPGNDPSSVP 20
             PP Q   +  GPP PPG  P   P
Sbjct:   222 PPPQGGNQPQGPPPPPGK-PQGPP 244


>bbs|134294 (S62941) Ps 2=basic proline-rich protein(PRB1L precursor
            protein=basic proline-rich proteins (Ps, PmF, PmS, and Pe)
            precursor) {C-terminal} [human, salivary, Peptide Partial, 358 aa]
            [Homo sapiens]
            Length = 358

  Minus Strand HSPs:

 Score = 119 (41.9 bits), Expect = 0.00024, P = 0.00024
 Identities = 60/203 (29%), Positives = 73/203 (35%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:   144 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG---- 198

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     RP      P  P G  P   + R  Q     PQ    QG    
Sbjct:   199 PPPPPGKPQGPPQQGGNRPQ-GPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQP 257

Query:   256 RGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*WWRISQCTCQH 92
             +G   P     G     PPPQ   +   P       G    GGS+ +    R      Q 
Sbjct:   258 QGPPPPPGKPQG-----PPPQGGNKPQGPPPPGKPQGPPPQGGSKSQS--ARAPPGKPQG 310

Query:    91 PPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
             PP Q+     GPP P G +P   P A PA
Sbjct:   311 PPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 338

 Score = 92 (32.4 bits), Expect = 0.38, P = 0.32
 Identities = 54/198 (27%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    83 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG---- 137

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     +P      P  P G  P   + +  +     PQ    QG    
Sbjct:   138 PPPPPGKPQGPPPQGGNKPQ-GPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQP 196

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G R   PPP    +  P        G   R P   +      Q
Sbjct:   197 QGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQ------GDKSRSP---QSPPGKPQ 247

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVP 20
              PP Q   +  GPP PPG  P   P
Sbjct:   248 GPPPQGGNQPQGPPPPPGK-PQGPP 271

 Score = 91 (32.0 bits), Expect = 0.50, P = 0.39
 Identities = 54/198 (27%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    22 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG---- 76

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     +P      P  P G  P   + +  +     PQ    QG    
Sbjct:    77 PPPPPGKPQGPPPQGGNKPQ-GPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQP 135

Query:   256 RGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*WWRISQCTCQH 92
             +G   P     G     PPPQ   +   P       G    G   + P   R      Q 
Sbjct:   136 QGPPPPPGKPQG-----PPPQGGNKPQGPPPPGKPQGPPPQGDKSQSP---RSPPGKPQG 187

Query:    91 PPDQQRCRTDGPPLPPGNDPSSVP 20
             PP Q   +  GPP PPG  P   P
Sbjct:   188 PPPQGGNQPQGPPPPPGK-PQGPP 210


>bbs|134296 (S62929) PRB1L precursor protein=basic proline rich proteins (Ps,
            PmF, PmS, and Pe) precursor {C-terminal} [human, salivary, Peptide
            PartialMutant, 358 aa] [Homo sapiens]
            Length = 358

  Minus Strand HSPs:

 Score = 118 (41.5 bits), Expect = 0.00032, P = 0.00032
 Identities = 60/203 (29%), Positives = 73/203 (35%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G  P G PP  +  G PP    +       G+  G       +  G    
Sbjct:   144 KPQGPPPQG-GKKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG---- 198

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     RP      P  P G  P   + R  Q     PQ    QG    
Sbjct:   199 PPPPPGKPQGPPQQGGNRPQ-GPPPPGKPQGPPPQGDKSRSSQSPPGKPQGPPPQGGNQP 257

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G +   PPP    +  P      A GGS+ +    R      Q
Sbjct:   258 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP------AQGGSKSQS--ARSPPGKPQ 309

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
              PP Q+     GPP P G +P   P A PA
Sbjct:   310 GPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 338

 Score = 97 (34.1 bits), Expect = 0.10, P = 0.095
 Identities = 56/198 (28%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    22 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG---- 76

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     RP      P  P G  P   + R        PQ    QG    
Sbjct:    77 PPPPPGKPQGPPPQGGNRPQ-GPPPPGKPQGPPPQGDKSRSPXSPPGKPQGPPPQGGNQP 135

Query:   256 RGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*WWRISQCTCQH 92
             +G   P     G     PPPQ  ++   P       G    G   + P   R      Q 
Sbjct:   136 QGPPPPPGKPQG-----PPPQGGKKPQGPPPPGKPQGPPPQGDKSQSP---RSPPGKPQG 187

Query:    91 PPDQQRCRTDGPPLPPGNDPSSVP 20
             PP Q   +  GPP PPG  P   P
Sbjct:   188 PPPQGGNQPQGPPPPPGK-PQGPP 210

 Score = 88 (31.0 bits), Expect = 1.1, P = 0.67
 Identities = 54/198 (27%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    83 KPQGPPPQG-GNRPQGPPPPGKPQGPPPQGDKSRSPXSPPGKPQGPPPQGGNQPQG---- 137

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             P P  GK Q  P     +P      P  P G  P   + +  +     PQ    QG    
Sbjct:   138 PPPPPGKPQGPPPQGGKKPQ-GPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQP 196

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G R   PPP    +  P       G  SR      +      Q
Sbjct:   197 QGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQ-----GDKSRSS----QSPPGKPQ 247

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVP 20
              PP Q   +  GPP PPG  P   P
Sbjct:   248 GPPPQGGNQPQGPPPPPGK-PQGPP 271


>sp|P02812|PRP2_HUMAN SALIVARY PROLINE-RICH PROTEIN PRECURSOR (CONTAINS: BASIC
            PEPTIDE P-F) (CLONE CP7) >pir||PIHUPF salivary proline-rich
            glycoprotein precursor PRB2 - human (fragment) >gi|190510 (K03208)
            salivary proline-rich protein precursor [Homo sapiens]
            Length = 251

  Minus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00035, P = 0.00035
 Identities = 62/203 (30%), Positives = 74/203 (36%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHR-GRTNGYACSRTWKDTGSTT 440
             +P    PQG G+ P G PP  +  G PP        A    G+  G       +  G   
Sbjct:    35 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQPQG--- 90

Query:   439 HPSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSP-GEVRQRRQQCVRHSPQSCTRQGDQ 263
              P P  GK Q  P P     S     P  P G  P G  + R  +     PQ    QG  
Sbjct:    91 -PPPPPGKPQ-GPPPQGDNKSQGPPPPGKPQGPPPQGGSKSRSSRSPPGKPQGPPPQGGN 148

Query:   262 TSRGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*WWRISQCTC 98
               +G   P     G     PPPQ   +   P       G    GGS+ R    R      
Sbjct:   149 QPQGPPPPPGKPQG-----PPPQGGNKPQGPPPPGKPQGPPPQGGSKSRS--ARSPPGKP 201

Query:    97 QHPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
             Q PP Q+     GPP P G +P   P A PA
Sbjct:   202 QGPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 231


>bbs|134298 (S62936) PRB1S precursor protein=basic proline-rich proteins (Ps,
            PmF, PmS, and Pe) precursor {C-terminal} [human, salivary, Peptide
            PartialMutant, 236 aa] [Homo sapiens]
            Length = 236

  Minus Strand HSPs:

 Score = 113 (39.8 bits), Expect = 0.00051, P = 0.00051
 Identities = 60/203 (29%), Positives = 74/203 (36%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    22 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGP--- 77

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTS 257
             PSP  GK Q  P     RP      P  P G  P   + R        PQ    QG    
Sbjct:    78 PSP-PGKPQGPPPQGGNRPQ-GPPPPGKPQGPPPQGDKSRSPXSPPGKPQGPPPQGGNQP 135

Query:   256 RGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQ 95
             +G   P    Q      G +   PPP    +  P      A GGS+ +    R      Q
Sbjct:   136 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP------AQGGSKSQS--ARSPPGKPQ 187

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
              PP Q+     GPP P G +P   P A PA
Sbjct:   188 GPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 216


>bbs|175466 (S80905) Con1=salivary concanavalin-A binding protein {exon 3}
            [human, peripheral blood leukocytes, subject "R.S.", Peptide
            Partial Mutant, 382 aa] [Homo sapiens]
            Length = 382

  Minus Strand HSPs:

 Score = 115 (40.5 bits), Expect = 0.00083, P = 0.00083
 Identities = 62/203 (30%), Positives = 74/203 (36%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHR-GRTNGYACSRTWKDTGSTT 440
             +P    PQG G+ P G PP  +  G PP        A    G+  G       +  G   
Sbjct:   166 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQPQG--- 221

Query:   439 HPSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSP-GEVRQRRQQCVRHSPQSCTRQGDQ 263
              P P  GK Q  P P     S     P  P G  P G  + R  +     PQ    QG  
Sbjct:   222 -PPPPPGKPQ-GPPPQGGNKSQGPPPPGKPQGPPPQGGSKSRSSRSPPGKPQGPPPQGGN 279

Query:   262 TSRGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*WWRISQCTC 98
               +G   P     G     PPPQ   +   P       G    GGS+ R    R      
Sbjct:   280 QPQGPPPPPGKPQG-----PPPQGGNKPQGPPPPGKPQGPPPQGGSKSRS--ARSPPGKP 332

Query:    97 QHPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
             Q PP Q+     GPP P G +P   P A PA
Sbjct:   333 QGPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 362

 Score = 105 (37.0 bits), Expect = 0.013, P = 0.013
 Identities = 62/198 (31%), Positives = 79/198 (39%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPPSRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTHP 434
             +P    PQG G+ P G PP    G P   +  PP  +++ R+     SR+    G    P
Sbjct:   104 KPQGPPPQG-GNKPQGPPPP---GKP---QGPPPQGDNKSRS-----SRS--PPGKPQGP 149

Query:   433 SPFHGKTQQAPTPSVVRPSFXL----SLPVGP*--GRSPGEVRQ--RRQQCVRH---SPQ 287
              P  G   Q P P   +P        + P GP   G+  G   Q   + Q  R     PQ
Sbjct:   150 PPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQ 209

Query:   286 SCTRQGDQTSRGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*W 122
                 QG    +G   P     G     PPPQ   ++  P       G    GGS+ R   
Sbjct:   210 GPPPQGGNQPQGPPPPPGKPQG-----PPPQGGNKSQGPPPPGKPQGPPPQGGSKSRS-- 262

Query:   121 WRISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVP 20
              R      Q PP Q   +  GPP PPG  P   P
Sbjct:   263 SRSPPGKPQGPPPQGGNQPQGPPPPPGK-PQGPP 295

 Score = 94 (33.1 bits), Expect = 0.25, P = 0.22
 Identities = 55/198 (27%), Positives = 71/198 (35%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP-SRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTH 437
             +P    PQG G+ P G PP  +  G PP    +       G+  G       +  G    
Sbjct:    43 KPQGPPPQG-GNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG---- 97

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSP-GEVRQRRQQCVRHSPQSCTRQGDQT 260
             P P  GK Q  P     +P      P  P G  P G+ + R  +     PQ    QG   
Sbjct:    98 PPPPPGKPQGPPPQGGNKPQ-GPPPPGKPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQ 156

Query:   259 SRGASDPRQASAGRRGFSPPPQHAQRAT-PSTSCLAAG----GGSRRRP*WWRISQCTCQ 95
              +G   P     G     PPPQ   +   P       G    G ++ +    R      Q
Sbjct:   157 PQGPPPPPGKPQG-----PPPQGGNKPQGPPPPGKPQGPPPQGDNKSQS--ARSPPGKPQ 209

Query:    94 HPPDQQRCRTDGPPLPPGNDPSSVP 20
              PP Q   +  GPP PPG  P   P
Sbjct:   210 GPPPQGGNQPQGPPPPPGK-PQGPP 233


>sp|P39677|EFG2_YEAST ELONGATION FACTOR G, MITOCHONDRIAL 2 PRECURSOR (MEF-G-2)
            >pir||S43748 translation elongation factor G homolog MEF2,
            mitochondrial - yeast (Saccharomyces cerevisiae) >gi|439114
            (L25088) mitochondrial EF-G-like protein [Saccharomyces cerevisiae]
            >gi|728708 (X85021) pid:g728708 [Saccharomyces cerevisiae]
            >gi|1008284 (Z49377) ORF YJL102w [Saccharomyces cerevisiae]
            Length = 819

  Plus Strand HSPs:

 Score = 117 (41.2 bits), Expect = 0.0015, P = 0.0015
 Identities = 30/91 (32%), Positives = 51/91 (56%), Frame = +1

Query:   181 PVVRVAVEAKNPSDLPKLVEGLKRLSKSDP-LVVCTIEESGEHIVAGAGELHLEICLKDL 357
             PV  V++E +  S+   + E L  L   DP L +   +E+G+ ++ G GELHLEI    L
Sbjct:   472 PVFGVSIEPRTLSNKKSMEEALNTLITEDPSLSISQNDETGQTVLNGMGELHLEIAKDRL 531

Query:   358 QEDLIXTRGAPLKVSEPVVSFRETVTDVSSIQ 453
               DL     A ++  + +VS++ET+   ++I+
Sbjct:   532 VNDL----KADVEFGQLMVSYKETINSETNIE 559


>sp|Q07803|EFGM_RAT ELONGATION FACTOR G, MITOCHONDRIAL PRECURSOR (MEF-G)
            >pir||S40780 translation elongation factor G, mitochondrial - rat
            >gi|310102 (L14684) elongation factor G [Rattus norvegicus]
            Length = 752

  Plus Strand HSPs:

 Score = 108 (38.0 bits), Expect = 0.015, P = 0.015
 Identities = 39/158 (24%), Positives = 71/158 (44%), Frame = +1

Query:    10 VQRTVLMMGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVV 189
             VQR V M     E VE+   G++  L G+D       T T+   S   +  + +   PV+
Sbjct:   395 VQRLVRMHADMMEDVEEVYAGDICALFGID--CASGDTFTNKDNSDLSMESI-HVPDPVI 451

Query:   190 RVAVEAKNPSDLPKLVEGLKRLSKSDPL--VVCTIEESGEHIVAGAGELHLEICLKDLQE 363
              VA++  N +DL K  +G+ R ++ DP   V    E  G+  V   G +  EI  + ++ 
Sbjct:   452 SVAMKPSNKNDLEKFSKGIARFTREDPTFKVHFDTERQGDDCVWN-GRIAPEIYAQRMER 510

Query:   364 DL----IXTRGAPLKVSEPVVSFRETVTDVSSIQCLSKSANK 477
             +     I  +    ++ +P++     +  + S + +  S  K
Sbjct:   511 EYGCPCITGKTQSGRLEKPLLPLCHLILHIKSSRVVPASMGK 552


>sp|P26651|TTP_HUMAN TRISTETRAPROLINE (TTP) (TIS11A) (TIS11) (ZFP-36) (GROWTH
            FACTOR-INDUCIBLE NUCLEAR PROTEIN NUP475) >pir||S34427
            tristetraproline protein - human >gi|183443 (M92843) zinc finger
            transcriptional regulator [Homo sapiens] >gi|183445 (M92844) zinc
            finger transcriptional regulator [Homo sapiens] >gi|340013 (M63625)
            tristetraproline [Homo sapiens]
            Length = 326

  Minus Strand HSPs:

 Score = 103 (36.3 bits), Expect = 0.017, P = 0.017
 Identities = 49/156 (31%), Positives = 64/156 (41%), Frame = -2

Query:   628 CALLQRPSQXCPQGSGHAPXGRPPSRRSGLPPXXRTTPP---LAEHRGRTNGYACSRTWK 458
             C  +  PS+      GH P  R     SGLP   RT+PP   LA     ++ ++ S +  
Sbjct:   162 CHFIHNPSEDLA-APGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPP 220

Query:   457 DTGSTT-HPSPFHGK-----TQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRH 296
               G     PS F         ++ PTP V  PS   + P+   G   G VR    Q +  
Sbjct:   221 PPGDLPLSPSAFSAAPGTPLARRDPTP-VCCPSCRRATPISVWGPLGGLVRTPSVQSLGS 279

Query:   295 SPQSCTRQGDQTSRGASDPRQASAGRRGFSPP-PQHAQRATP 173
              P      G  +S G SD     AG   F+PP P  A R  P
Sbjct:   280 DPDEYASSG--SSLGGSDSPVFEAGV--FAPPQPVAAPRRLP 317


>sp|P03181|YHL1_EBV HYPOTHETICAL BHLF1 PROTEIN >pir||QQBE3 BHLF1 protein -
            human herpesvirus 4 (strain B95-8)
            Length = 660

  Minus Strand HSPs:

 Score = 106 (37.3 bits), Expect = 0.021, P = 0.021
 Identities = 65/217 (29%), Positives = 78/217 (35%), Frame = -2

Query:   616 QRPSQXCPQGSGHA---PXGRPPSRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKD-TG 449
             +R     PQ    A   P G PP+R           PP      R  G  C RTW+  +G
Sbjct:   232 ERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRRPPGCPRSARNPG--CPRTWRRRSG 289

Query:   448 STT-HPSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQ 272
             +   HP P  G+    PT    RP+     P  P    PG           H P+  +  
Sbjct:   290 AQRGHPPPGAGQRPSGPTGG--RPA-APGAPGTPAAPGPGGGAAVPSGATPH-PERGSGP 345

Query:   271 GDQTSRGASDP-RQ--------ASAGRRGFSPPPQHAQRATPSTSCLAAG-GGSRRRP*- 125
              D  +     P RQ        A+A R    PPP  +  A   T     G   S R P  
Sbjct:   346 ADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRRPPGCPRSARNPGC 405

Query:   124 ---WWRISQCTCQHPPDQQRCRTDGP----PLPPGNDPSSVPCAAP 8
                W R S     HPP     R  GP    P  PG  P + P AAP
Sbjct:   406 PRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAAPGA-PGT-P-AAP 448

 Score = 106 (37.3 bits), Expect = 0.021, P = 0.021
 Identities = 65/217 (29%), Positives = 78/217 (35%), Frame = -2

Query:   616 QRPSQXCPQGSGHA---PXGRPPSRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKD-TG 449
             +R     PQ    A   P G PP+R           PP      R  G  C RTW+  +G
Sbjct:   357 ERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRRPPGCPRSARNPG--CPRTWRRRSG 414

Query:   448 STT-HPSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQ 272
             +   HP P  G+    PT    RP+     P  P    PG           H P+  +  
Sbjct:   415 AQRGHPPPGAGQRPSGPTGG--RPA-APGAPGTPAAPGPGGGAAVPSGATPH-PERGSGP 470

Query:   271 GDQTSRGASDP-RQ--------ASAGRRGFSPPPQHAQRATPSTSCLAAG-GGSRRRP*- 125
              D  +     P RQ        A+A R    PPP  +  A   T     G   S R P  
Sbjct:   471 ADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRRPPGCPRSARNPGC 530

Query:   124 ---WWRISQCTCQHPPDQQRCRTDGP----PLPPGNDPSSVPCAAP 8
                W R S     HPP     R  GP    P  PG  P + P AAP
Sbjct:   531 PRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAAPGA-PGT-P-AAP 573

 Score = 89 (31.3 bits), Expect = 1.9, P = 0.86
 Identities = 42/163 (25%), Positives = 54/163 (33%), Frame = -2

Query:   616 QRPSQXCPQGSGHA---PXGRPPSRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKD-TG 449
             +R     PQ    A   P G PP+R           PP      R  G  C RTW+  +G
Sbjct:   482 ERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRRPPGCPRSARNPG--CPRTWRRRSG 539

Query:   448 STT-HPSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQ 272
             +   HP P  G+    PT    RP+     P  P    PG           H P+  +  
Sbjct:   540 AQRGHPPPGAGQRPSGPTGG--RPA-APGAPGTPAAPGPGGGAAVPSGATPH-PERGSGP 595

Query:   271 GDQTSRGASDPRQASAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP 128
              D  +     P +            Q      P T   AA   + RRP
Sbjct:   596 ADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRRP 643


>pir||B61510 translation elongation factor eEF-2 - African clawed frog
            (fragment)
            Length = 60

  Plus Strand HSPs:

 Score = 79 (27.8 bits), Expect = 0.049, P = 0.047
 Identities = 19/59 (32%), Positives = 32/59 (54%), Frame = +1

Query:   457 LSKSANKHNRLFCRGAPLTEELCVXMEEGLNAGSEADPKVRARFLADXFDWDVAKARXI 633
             LS + NKHN LF +  P  + L   +++G +  +  + K RA +LA+  +    +AR I
Sbjct:     1 LSXAPNKHNCLFMKARPSPDGLAEDIDKG-DVSARQELKTRAXYLAESSNGXCTEARKI 58


>gi|190504 (K03205) salivary proline-rich protein precursor [Homo sapiens]
           Length = 198

  Minus Strand HSPs:

 Score = 95 (33.4 bits), Expect = 0.052, P = 0.051
 Identities = 44/149 (29%), Positives = 55/149 (36%), Frame = -2

Query:   451 GSTTHPSPFHGKTQQAPTPSVVRPSFXL----SLPVGP*--GRSPGEVRQRRQQCVRHSP 290
             G+   PSP  G   Q P P   +P        + P GP   G+  G   Q  +     SP
Sbjct:    34 GNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSP 93

Query:   289 QSCTRQGDQTSRGASDPRQASAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRIS 110
                  QG     G         G +   PPP    +  P      A GGS+ +    R  
Sbjct:    94 PG-KPQGPPPQGGKPQGPPPQGGNKPQGPPPPGKPQGPP------AQGGSKSQS--ARAP 144

Query:   109 QCTCQHPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
                 Q PP Q+     GPP P G +P   P A PA
Sbjct:   145 PGKPQGPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 178


>gi|190506 (K03206) salivary proline-rich protein precursor [Homo sapiens]
           Length = 178

  Minus Strand HSPs:

 Score = 90 (31.7 bits), Expect = 0.16, P = 0.14
 Identities = 46/152 (30%), Positives = 58/152 (38%), Frame = -2

Query:   460 KDTGSTTHPSPFHGKTQQAPTPSVV-RPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQS 284
             +D      PS   G  Q  P+P    +P      P  P G  P    + +       PQ 
Sbjct:    21 EDVSQEESPSLIAGNPQ-GPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG 79

Query:   283 CTRQGDQTSRGASDPRQASAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQC 104
                QGD+ SR    PR      +G  PPPQ  +   P      A GGS+ +    R    
Sbjct:    80 PPPQGDK-SRS---PRSPPGKPQG--PPPQGGKPQGPP-----AQGGSKSQS--ARAPPG 126

Query:   103 TCQHPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
               Q PP Q+     GPP P G +P   P A PA
Sbjct:   127 KPQGPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 158


>gi|2589188 (AF005080) skin-specific protein [Homo sapiens]
            Length = 110

  Plus Strand HSPs:

 Score = 78 (27.5 bits), Expect = 0.25, P = 0.22
 Identities = 22/60 (36%), Positives = 25/60 (41%), Frame = +3

Query:    33 GSLPGGSGGPSVRQRCWSG--GC*QVHCEIRHHHGRRREPPPAARHEVLGVARCACCGGG 206
             G + GG  GPS    C SG  GC   H   R  H RR + P     E  G + C    GG
Sbjct:    49 GPISGGCCGPSSGGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGG 108


>sp|P10162|PRPL_HUMAN SALIVARY PROLINE-RICH PROTEIN PO (ALLELE K) (CONTAINS:
            PEPTIDE P-D)
            Length = 276

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.32, P = 0.28
 Identities = 56/198 (28%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP--SRRSGLPPXXRTT-----PPLAEHRGRT--NGYACSRTW 461
             +P    PQG G+ P   PP   +  G PP          PP  +  GR    G       
Sbjct:     1 KPQGRRPQG-GNQPQRPPPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPP 59

Query:   460 KDTGSTTHPSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSC 281
                G    P P  G   Q P P   +P    S P  P G   G   Q         P+  
Sbjct:    60 PHPGKPERPPPQGGNQSQGPPPHPGKPE---SRP--PQG---GHQSQGPPP-TPGKPEGP 110

Query:   280 TRQGDQTSRGASDP------RQASAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WW 119
               QG   S+G   P      R    G +   PPP   +   P       GG    RP   
Sbjct:   111 PPQGGNQSQGTPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQ----GGNQSHRP--- 163

Query:   118 RISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVP 20
                    + PP Q   ++ GPP  PG  P   P
Sbjct:   164 PPPPGKPERPPPQGGNQSQGPPPHPGK-PEGPP 195

 Score = 81 (28.5 bits), Expect = 4.7, P = 0.99
 Identities = 60/203 (29%), Positives = 76/203 (37%), Frame = -2

Query:   607 SQXCPQGSGHAPXGRPP---SRRSGLPPXX---RTTPPLAEHRGRTN----GYACSRTWK 458
             SQ  P   G  P GRPP   ++  G PP        PP   ++ +      G   SR  +
Sbjct:    34 SQGPPPPPGK-PEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQSQGPPPHPGKPESRPPQ 92

Query:   457 DTGSTTHPSPFHGKTQQAPTPSVVRPSFXLSLPVG-P*GRSPGEVRQRRQQCVRH--SPQ 287
                 +  P P  GK +  P P     S     P G P GR P    Q  Q    H   P+
Sbjct:    93 GGHQSQGPPPTPGKPE-GPPPQGGNQSQGTPPPPGKPEGRPPQGGNQS-QGPPPHPGKPE 150

Query:   286 SCTRQG-DQTSRGASDPRQAS-----AGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP* 125
                 QG +Q+ R    P +        G +   PPP   +   P       G  SR    
Sbjct:   151 RPPPQGGNQSHRPPPPPGKPERPPPQGGNQSQGPPPHPGKPEGPPPQ---EGNKSRSA-- 205

Query:   124 WWRISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVP 20
               R      Q PP Q+  +  GPP PPG  P   P
Sbjct:   206 --RSPPGKPQGPPQQEGNKPQGPP-PPGK-PQGPP 236


>gnl|PID|e1216611 (AL021006) hypothetical protein Rv1246c [Mycobacterium
            tuberculosis]
            Length = 97

  Minus Strand HSPs:

 Score = 71 (25.0 bits), Expect = 0.38, P = 0.32
 Identities = 20/52 (38%), Positives = 29/52 (55%), Frame = -3

Query:   306 VFATLLNRAHDKGIRLREALQTLDKLRQVGGVFRLHRNTHNGRHRV--LHVSQR 151
             VF  LLN  H  G  LR  L+ L   R+  G +R+     +G HRV  +H+++R
Sbjct:    34 VFGPLLNNPHRLGKPLRNDLEGLHSARR--GDYRVVYAIDDGHHRVEIIHIARR 85


>pir||PIHUSD salivary proline-rich glycoprotein precursor PRB4 (large allele) -
            human
            Length = 310

  Minus Strand HSPs:

 Score = 91 (32.0 bits), Expect = 0.40, P = 0.33
 Identities = 56/198 (28%), Positives = 68/198 (34%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP--SRRSGLPPXXRTT-----PPLAEHRGRT--NGYACSRTW 461
             +P    PQG G+ P   PP   +  G PP          PP  +  GR    G       
Sbjct:    35 KPQGRRPQG-GNQPQRPPPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPP 93

Query:   460 KDTGSTTHPSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSC 281
                G    P P  G   Q P P   +P    S P  P G   G   Q         P+  
Sbjct:    94 PHPGKPERPPPQGGNQSQGPPPHPGKPE---SRP--PQG---GHQSQGPPP-TPGKPEGP 144

Query:   280 TRQGDQTSRGASDP------RQASAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WW 119
               QG   S+G   P      R    G +   PPP   +   P       GG    RP   
Sbjct:   145 PPQGGNQSQGTPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQ----GGNQSHRP--- 197

Query:   118 RISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVP 20
                    + PP Q   ++ GPP  PG  P   P
Sbjct:   198 PPPPGKPERPPPQGGNQSQGPPPHPGK-PEGPP 229

 Score = 81 (28.5 bits), Expect = 5.7, P = 1.0
 Identities = 60/203 (29%), Positives = 76/203 (37%), Frame = -2

Query:   607 SQXCPQGSGHAPXGRPP---SRRSGLPPXX---RTTPPLAEHRGRTN----GYACSRTWK 458
             SQ  P   G  P GRPP   ++  G PP        PP   ++ +      G   SR  +
Sbjct:    68 SQGPPPPPGK-PEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQSQGPPPHPGKPESRPPQ 126

Query:   457 DTGSTTHPSPFHGKTQQAPTPSVVRPSFXLSLPVG-P*GRSPGEVRQRRQQCVRH--SPQ 287
                 +  P P  GK +  P P     S     P G P GR P    Q  Q    H   P+
Sbjct:   127 GGHQSQGPPPTPGKPE-GPPPQGGNQSQGTPPPPGKPEGRPPQGGNQS-QGPPPHPGKPE 184

Query:   286 SCTRQG-DQTSRGASDPRQAS-----AGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP* 125
                 QG +Q+ R    P +        G +   PPP   +   P       G  SR    
Sbjct:   185 RPPPQGGNQSHRPPPPPGKPERPPPQGGNQSQGPPPHPGKPEGPPPQ---EGNKSRSA-- 239

Query:   124 WWRISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVP 20
               R      Q PP Q+  +  GPP PPG  P   P
Sbjct:   240 --RSPPGKPQGPPQQEGNKPQGPP-PPGK-PQGPP 270


>gi|3044086 (AF055904) unknown [Myxococcus xanthus]
            Length = 542

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.40, P = 0.33
 Identities = 73/208 (35%), Positives = 90/208 (43%), Frame = -2

Query:   628 CALLQRPSQXCPQGSGHA---PXGRPPSRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWK 458
             CA  +R  + CP  S HA   P G  PSRR G PP  ++TP     R  T    C    +
Sbjct:    81 CA--RRSGRRCPAPSRHARRNPAG--PSRRCG-PPR-KSTPT----RCCT---PCPAPPR 127

Query:   457 DTGSTTHPSPFHGKTQQAPTPSVVRPSFXLS--LPVGP*GRSPGEVRQRRQQCVRHSPQS 284
                  + P+P  G+T   PT     PS   S   P G  G +PG      +     SP S
Sbjct:   128 CRARPSAPAPSAGRT--CPTAG---PSSCASGCCPTGRCGSAPGPTPHGAEP----SPPS 178

Query:   283 CTRQGDQTSRGA---SDPRQASAGRRGFS-----PPPQH--------AQRATPSTSCLAA 152
              +      S G    + PR A A   G +     PPP+         A+ A PSTS  A+
Sbjct:   179 QSPSPAPASSGGRRRTHPRPARASAAGATAPACLPPPRCCGRPGTGCARTAPPSTS--AS 236

Query:   151 GGGSRRRP*WW-RISQCTCQHP-PDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
                  R P    R S      P P    CR   PP PPG  P+    A PA
Sbjct:   237 HPPPPRSPGTPPRASGSPAAAPAPPSPACR---PP-PPGTTPAPRNAALPA 283


>sp|P13983|EXTN_TOBAC EXTENSIN PRECURSOR (CELL WALL HYDROXYPROLINE-RICH
            GLYCOPROTEIN) >pir||S06733 hydroxyproline-rich glycoprotein
            precursor - common tobacco >gi|19867 (X13885) extensin (AA 1-620)
            [Nicotiana tabacum]
            Length = 620

  Minus Strand HSPs:

 Score = 94 (33.1 bits), Expect = 0.48, P = 0.38
 Identities = 48/160 (30%), Positives = 57/160 (35%), Frame = -2

Query:   610 PSQXCP---QGSGHAPX-G-RPPSRRSG-LPPXXRTTPPLAEHR-GRTNGYACSRTWKD- 455
             PS   P    G GH P  G RPPS   G  PP    TPP  +H          SR     
Sbjct:   120 PSYGAPPPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPP 179

Query:   454 --TGSTTHPSPFHGKTQQA---PTPSVVRPSFXLSLPVGP*-GRSPGEVRQRRQQCV-RH 296
               T +   P+P +  + Q    PT S   P+     P  P  G  P     R      RH
Sbjct:   180 PPTYAQPPPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRH 239

Query:   295 SPQSCTRQGDQTSRGASDPRQASAGRRGFSPPPQHAQRATPS 170
             +P   T Q          PR+         PPP +AQ   PS
Sbjct:   240 APP--THQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPS 279

 Score = 89 (31.3 bits), Expect = 1.8, P = 0.83
 Identities = 40/132 (30%), Positives = 52/132 (39%), Frame = -2

Query:   577 APXGRPPSRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTHPSPFHG-KTQQAP 401
             AP   PPSR  G  P  R  PP   +   ++G+             H  P  G     +P
Sbjct:    54 APTTTPPSR--GHVPSPRHAPPRHAYPPPSHGHLPPSVGGPPPHRGHLPPSRGFNPPPSP 111

Query:   400 --TPSVVRPSFXLSLPV-GP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTSRGASDP--- 239
               +PS   PS+    P  GP G  P   ++       H+P S    G    RG   P   
Sbjct:   112 VISPSHPPPSYGAPPPSHGP-GHLPSHGQRPPSPSHGHAPPS---GGHTPPRGQHPPSHR 167

Query:   238 RQASAGRRGFSPPPQHAQ 185
             R +   R G  PPP +AQ
Sbjct:   168 RPSPPSRHGHPPPPTYAQ 185


>pir||D38355 basic proline-rich peptide IB-8a - human (fragments)
            Length = 128

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 0.51, P = 0.40
 Identities = 37/132 (28%), Positives = 45/132 (34%), Frame = -2

Query:   421 GKTQQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTSRGASD 242
             GK Q  P     +P      P  P G  P    + +       PQ    QGD  S+ A  
Sbjct:     4 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSAKP 63

Query:   241 PRQASAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQHPPDQQRCRTD 62
                   G +   PPPQ   +  P        G S R P          Q PP Q+     
Sbjct:    64 QGPPPQGGKPQGPPPQGGNK--PQGP--PPQGKSARSP------PGKPQGPPQQEGNNPQ 113

Query:    61 GPPLPPGNDPSS 26
             GPP P G +P S
Sbjct:   114 GPPPPAGGNPGS 125


>pir||B60328 translation elongation factor G homolog - Streptococcus mutans
            (strain OMZ175, serotype f) (fragment)
            Length = 218

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.4, P = 0.75
 Identities = 24/104 (23%), Positives = 52/104 (50%), Frame = +1

Query:    31 MGRYQEAVEDHPCGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAK 210
             M   +E VE+   G+++G+     Y V   T+T  G++      +  + +P + + V AK
Sbjct:    42 MAESRENVENAVAGDIIGVYDTGTYQVGD-TLTV-GKNKFEFEPLP-TFTPELFMKVSAK 98

Query:   211 NPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAGAGELHLEI 342
             N        +G+++L +   + + T  ++GE+++   G+L  E+
Sbjct:    99 NVMKQKSFHKGIEQLVQEGAIQLYTNYQTGEYMLGAVGQLQFEV 142


>sp|P34810|CD68_HUMAN MACROSIALIN PRECURSOR (GP110) (CD68) >pir||A48931
            transmembrane glycoprotein CD68, 110K - human >bbs|127493 (S57235)
            CD68=110kda transmembrane glycoprotein [human, promonocyte cell
            line U937, Peptide, 354 aa] [Homo sapiens]
            Length = 354

  Minus Strand HSPs:

 Score = 87 (30.6 bits), Expect = 1.4, P = 0.76
 Identities = 37/141 (26%), Positives = 55/141 (39%), Frame = -2

Query:   592 QGSGHAPXGRPPSRRSGLPPXXRTTPPLAEHRGRTNGYACSRTWKDTGSTTHPSPFHGKT 413
             QG+G+     P  + + L P    TP + E  G T+     RT K   +TTH +   G T
Sbjct:    18 QGTGN---DCPHKKSATLLPSFTVTPTVTESTGTTS----HRTTKSHKTTTHRTTTTGTT 70

Query:   412 QQAPTPSVVRPSFXL--SLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQGDQTSRGASDP 239
                PT +   P+     ++ V P   S      +      HSP + T  G+ T    S+ 
Sbjct:    71 SHGPTTATHNPTTTSHGNVTVHP--TSNSTATSQGPSTATHSPAT-TSHGNATVHPTSNS 127

Query:   238 RQASAGRRGFSPPPQHAQRATPS 170
                S G    + P       +PS
Sbjct:   128 TATSPGFTSSAHPEPPPPSPSPS 150


>bbs|175469 (S80916) parotid "o" protein, Po=salivary proline-rich protein
            {exon 3} [human, peripheral blood leukocytes, subject "J.J.",
            Peptide Partial Mutant, 234 aa] [Homo sapiens]
            Length = 234

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 1.6, P = 0.79
 Identities = 59/198 (29%), Positives = 75/198 (37%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP--SRRSGLPPXXRTT---PPLAEHRGRTNGYACSRTWKDTG 449
             +P    PQG G+ P   PP   +  G PP        PP     G+  G    R  +   
Sbjct:     1 KPEGRRPQG-GNQPQRPPPPPGKPQGPPPQGGNQSQGPPPPP--GKPEG----RPPQGGN 53

Query:   448 STTHPSPFHGKTQQAPTPSVVRPSFXLSLPVG-P*GRSPGEVRQRRQQCVRH--SPQSCT 278
              +  P P  GK ++ P P     S     P G P GR P    Q  Q    H   P+   
Sbjct:    54 QSQGPPPHPGKPERPP-PQGGNQSQGTPPPPGKPEGRPPQGGNQS-QGPPPHPGKPERPP 111

Query:   277 RQG-DQTSRGASDPRQAS-----AGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWR 116
              QG +Q+ R    P +        G +   PPP   +   P       G  SR      R
Sbjct:   112 PQGGNQSHRPPPPPGKPERPPPQGGNQSQGPPPHPGKPEGPPPQ---EGNKSRSA----R 164

Query:   115 ISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVP 20
                   Q PP Q+  +  GPP PPG  P   P
Sbjct:   165 SPPGKPQGPPQQEGNKPQGPP-PPGK-PQGPP 194

 Score = 81 (28.5 bits), Expect = 3.5, P = 0.97
 Identities = 62/208 (29%), Positives = 79/208 (37%), Frame = -2

Query:   613 RPSQXCPQGSGHAPXGRPP--SRRSGLPPXXRTT---PPLAEHRGRTNGYACSRTWKDTG 449
             +P    PQG G+ P   PP   +  G PP        PP     G+  G    R  +   
Sbjct:     1 KPEGRRPQG-GNQPQRPPPPPGKPQGPPPQGGNQSQGPPPPP--GKPEG----RPPQGGN 53

Query:   448 STTHPSPFHGKTQQAPTPSVVRPSFXLSLPVG-P*GRSPGEVRQRRQQCVRH--SPQSCT 278
              +  P P  GK ++ P P     S     P G P GR P    Q  Q    H   P+   
Sbjct:    54 QSQGPPPHPGKPERPP-PQGGNQSQGTPPPPGKPEGRPPQGGNQS-QGPPPHPGKPERPP 111

Query:   277 RQG-DQTSRGASDPRQAS-----AGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWR 116
              QG +Q+ R    P +        G +   PPP   +   P       G  SR      R
Sbjct:   112 PQGGNQSHRPPPPPGKPERPPPQGGNQSQGPPPHPGKPEGPPPQ---EGNKSRSA----R 164

Query:   115 ISQCTCQHPPDQQRCRTDGPPLP--------PGNDPSSVPCAAPA 5
                   Q PP Q+  +  GPP P        PG +P   P A PA
Sbjct:   165 SPPGKPQGPPQQEGNKPQGPPPPGKPQGPPPPGGNPQQ-PQAPPA 208


>pir||A27307 proline-rich phosphoprotein (gene PRH1, Db allele) - human
            Length = 171

  Minus Strand HSPs:

 Score = 81 (28.5 bits), Expect = 1.7, P = 0.83
 Identities = 30/91 (32%), Positives = 36/91 (39%), Frame = -2

Query:   292 PQSCTRQGDQTSRGASDPRQASAG---RRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*W 122
             PQ   +QG Q  +G   P+    G   + G  PPPQ   +  P        GG  R P  
Sbjct:    75 PQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQ------GGHPRPP-- 126

Query:   121 WRISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVP 20
                 +   Q PP QQ     GPP PP   P   P
Sbjct:   127 ----RGRPQGPP-QQGGHQQGPPPPPPGKPQGPP 155


>gi|158442 (J01134) glue protein (partial) [Drosophila melanogaster]
           Length = 78

  Plus Strand HSPs:

 Score = 65 (22.9 bits), Expect = 1.8, P = 0.83
 Identities = 19/41 (46%), Positives = 20/41 (48%), Frame = +2

Query:   119 PPSRTTARAPTRCET*STRCR---PLCVLRWRR--KTPPTCRS 232
             PP   T   P RCET   RC    P C     R   TPPTCR+
Sbjct:    28 PPRCETE--PPRCETEPPRCETEPPRCETTTPRCETTPPTCRT 68

 Score = 61 (21.5 bits), Expect = 4.9, P = 0.99
 Identities = 17/38 (44%), Positives = 20/38 (52%), Frame = +2

Query:   119 PPSRTTARAPTRCET*STRCR---PLCVLRWRRKTPPTCRS 232
             PP   T   P RCET + RC    P C     R  PPTC++
Sbjct:    42 PPRCETE--PPRCETTTPRCETTPPTC-----RTEPPTCKT 75


>pir||S51892 probable membrane protein YOL105c - yeast (Saccharomyces
            cerevisiae) >gi|663247 (Z48149) similarity with H. polymorpha
            hypothetical protein in LEU2 region [Saccharomyces cerevisiae]
            >gnl|PID|e252294 (Z74847) ORF YOL105c [Saccharomyces cerevisiae]
            Length = 556

  Minus Strand HSPs:

 Score = 88 (31.0 bits), Expect = 2.0, P = 0.87
 Identities = 50/204 (24%), Positives = 91/204 (44%), Frame = -1

Query:   629 LRAFATSQSXLSARKRARTXGSASEPAFRPSSXXTHNSS-VSGAPRQNKRLCLFADLERH 453
             +  +  +++ +S+ + + +    S  ++ PS+  + +S+ +S   R+       +++   
Sbjct:   126 MNVYVNAETFVSSVESSSSK-EGSSTSYMPSTTSSLSSAQISSTTRRTSTDMKSSEMIAT 184

Query:   452 WIDDTSVTVSRKDTTGSDTFSGAPLVXIKSSCRSLRQISR*SSPAPATMCSPLSSIVHTT 273
              +  TS T S   +T S T S        SS  S    S  SS   +T  S  SS   +T
Sbjct:   185 TVSTTSTTSSSTSSTTSSTTSSTTS-STTSSTTSSSTSSTTSSTTSSTTSSTTSSTTSST 243

Query:   272 RGSDFERRFRPSTSFGRSEGFFASTATRTTGDTEYFMSRSGWGLSPSSVMV--ADFTMYL 99
               S        +TS   S    +S+ T ++ +     SR+    SPSS +V  +  +  L
Sbjct:   244 TSSTTSSTTSSTTSIF-SVTSSSSSITLSSSEHTTVDSRTS---SPSSTLVPVSSSSSTL 299

Query:    98 STPTRPTTLPHGWSSTASW*RPIISTV 18
             STP + T++    SST     PI+++V
Sbjct:   300 STP-KVTSMTPSTSSTI----PIVTSV 321


>gi|190475 (K02576) salivary proline-rich protein 1 [Homo sapiens]
           Length = 93

  Minus Strand HSPs:

 Score = 67 (23.6 bits), Expect = 2.1, P = 0.88
 Identities = 23/75 (30%), Positives = 30/75 (40%), Frame = -2

Query:   229 SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQHPPDQQRCRTDGPPL 50
             + G +   PPP    +  P      A GG + +    R      Q PP Q+     GPP 
Sbjct:     8 TGGNKPQGPPPPGKPQGPP------AQGGCKSQS--ARAPPGKPQGPPQQEGNNPQGPPP 59

Query:    49 PPGNDPSSVPCAAPA 5
             P G +P   P A PA
Sbjct:    60 PAGGNPQQ-PQAPPA 73


>pir||S20590 exo-alpha-sialidase (EC 3.2.1.18) - Actinomyces viscosus >gi|39255
            (X62276) sialidase [Actinomyces viscosus]
            Length = 913

  Minus Strand HSPs:

 Score = 89 (31.3 bits), Expect = 2.2, Sum P(2) = 0.89
 Identities = 36/113 (31%), Positives = 48/113 (42%), Frame = -2

Query:   346 GRSPGEVRQRRQQCVRHSPQSCTRQGDQTSRGASDPRQASAGRRGFSPPPQHAQRATPST 167
             G+ P E    R++  R  PQ   R+    SR    PR+A + RR    PP+ ++   PS 
Sbjct:   662 GQKPAEPSPGRRR--RRHPQRHRRR----SRPRR-PRRALSPRRHRHHPPRPSRALRPSR 714

Query:   166 SCLAAGGGSRRRP*WWRISQCTCQHPPDQQRCRTDGPPLPPGNDPSSVPCAAP 8
             +   AG   R          C  Q  P+Q    TDGP   P  + SS P A P
Sbjct:   715 AGPGAGAHDRSEH-GAHTGSCA-QSAPEQ----TDGPTAAPAPETSSAPAAEP 761

 Score = 41 (14.4 bits), Expect = 2.2, Sum P(2) = 0.89
 Identities = 8/10 (80%), Positives = 8/10 (80%), Frame = -2

Query:   424 HGKTQQAPTP 395
             HGKT QA TP
Sbjct:   492 HGKTWQAGTP 501


>prf||1001181A peptide PH,basic Pro rich [Homo sapiens]
            Length = 56

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.2, P = 0.89
 Identities = 14/31 (45%), Positives = 16/31 (51%), Frame = -2

Query:    97 QHPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
             Q PP Q+     GPP P G +P   P A PA
Sbjct:     7 QGPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 36


>gi|553623 (K02578) salivary proline-rich protein 2 [Homo sapiens]
           Length = 46

  Minus Strand HSPs:

 Score = 64 (22.5 bits), Expect = 2.2, P = 0.89
 Identities = 14/31 (45%), Positives = 16/31 (51%), Frame = -2

Query:    97 QHPPDQQRCRTDGPPLPPGNDPSSVPCAAPA 5
             Q PP Q+     GPP P G +P   P A PA
Sbjct:    10 QGPPQQEGNNPQGPPPPAGGNPQQ-PQAPPA 39


>gi|190474 (K02576) salivary proline-rich protein 1 [Homo sapiens]
           Length = 173

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 2.4, P = 0.91
 Identities = 41/139 (29%), Positives = 49/139 (35%), Frame = -2

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVGP*GRSP-GEVRQRRQQCVRHSPQSCTRQGDQT 260
             P P  GK Q  P     +P      P  P G  P G  R R  +     PQ    QG   
Sbjct:    33 PPPPPGKPQGPPPQGGNKPQ-GPPPPGKPQGPPPQGGKRSRSPRSPPGKPQGPPPQGGNQ 91

Query:   259 SRGASDPR---QA---SAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTC 98
              +G   P    Q      G +   PPP    +  P     +    S R+P          
Sbjct:    92 PQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPRKP---------- 141

Query:    97 QHPPDQQRCRTDGPPLPPGNDPSSVP 20
             Q PP Q   +  GPP PPG  P   P
Sbjct:   142 QGPPPQGGNQPQGPPPPPGK-PQGPP 166


>gi|158434 (J01130) glue protein (partial) [Drosophila melanogaster]
           Length = 78

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 3.8, P = 0.98
 Identities = 18/38 (47%), Positives = 19/38 (50%), Frame = +2

Query:   119 PPSRTTARAPTRCET*STRCR---PLCVLRWRRKTPPTCRS 232
             PP   T   P RCET   RC    P C       TPPTCR+
Sbjct:    42 PPRCETE--PPRCETEPPRCETTTPKC-----ETTPPTCRT 75


>gi|552134 (J01136) glue protein (partial) [Drosophila melanogaster]
           Length = 72

  Plus Strand HSPs:

 Score = 62 (21.8 bits), Expect = 3.8, P = 0.98
 Identities = 22/61 (36%), Positives = 27/61 (44%), Frame = +2

Query:    62 IRAATLLVWWVLTSTL*NPPPSRTTARAPTRCET*STRCR---PLCVLRWRR--KTPPTC 226
             +R   L+V  V  + L  P  S      P RCET   RC    P C     R   TPPTC
Sbjct:     1 MRLELLVVLLVGLAAL-APSGSTCCKTEPPRCETEPPRCETEPPRCETEPPRCETTPPTC 59

Query:   227 RS 232
             ++
Sbjct:    60 KT 61


>gi|2853297 (AF007192) intestinal mucin [Homo sapiens]
            Length = 338

  Minus Strand HSPs:

 Score = 82 (28.9 bits), Expect = 5.0, P = 0.99
 Identities = 48/186 (25%), Positives = 78/186 (41%), Frame = -1

Query:   566 SASEPAFRPSSXXTHNSSVSGAPRQNKRLCLFADLERHWIDDTSVTVSRKDTTGSDTFSG 387
             SA+ P+ RP+   THN+  S          L       +   +S++ S   TT ++T + 
Sbjct:    29 SATIPSVRPTFTSTHNTLTSS---------LLTTFPGTYSFSSSMSASSDGTTHTETITS 79

Query:   386 APLVX--IKSSCRSLRQISR*SS-PAPATMCSPLSSIVHTTRG----SDFERRFRPSTSF 228
              P     + ++  S    +  +S     TM SP SS+  T+ G    S     F  +T+ 
Sbjct:    80 LPASTSTLHTTAESTTAHTTTTSFTTSTTMESPSSSVATTSTGQTTFSSSTATFTETTTL 139

Query:   227 GRSEGFFASTATRTTGDTEYFMSRSGWGLSPSSVMVADFTMYLSTPTRPTTLPHGWSSTA 48
               +  F   T T     T    S     ++P++ + +  TM  S PT   TL    ++  
Sbjct:   140 TPTTDFSEETLTTAMTSTPPITS----SITPTNTVTSMTTM-TSWPTATNTLSSLTTNIL 194

Query:    47 SW*RPIISTVRCT 9
             S   P+ ST R T
Sbjct:   195 SS-TPVPSTERTT 206


>sp|P11131|TET5_ENTFA TETRACYCLINE RESISTANCE PROTEIN TETM (TRANSPOSON TN1545)
            >pir||A24333 tetracycline resistance protein tetM - Enterococcus
            faecalis transposon Tn1545 >gi|48190 (X04388) tetM polypeptide (AA
            1-639) [Enterococcus faecalis]
            Length = 639

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 5.4, P = 1.0
 Identities = 23/92 (25%), Positives = 44/92 (47%), Frame = +1

Query:   151 PLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAG-AGE 327
             P R+   +  P+++  VE   P     L++ L  +S SDPL+   ++ +   I+    G+
Sbjct:   334 PQRERIENPLPLLQTTVEPSKPQQREMLLDALLEISDSDPLLRYYVDSATHEIILSFLGK 393

Query:   328 LHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRE 426
             + +E+    LQE         +++ EP V + E
Sbjct:   394 VQMEVTCALLQEKY----HVEIEIKEPTVIYME 422


>gi|975710 (X90939) tetM protein [Streptococcus pneumoniae]
           Length = 639

  Plus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 5.4, P = 1.0
 Identities = 23/92 (25%), Positives = 44/92 (47%), Frame = +1

Query:   151 PLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAG-AGE 327
             P R+   +  P+++  VE   P     L++ L  +S SDPL+   ++ +   I+    G+
Sbjct:   334 PQRERIENPLPLLQTTVEPSKPQQREMLLDALLEISDSDPLLRYYVDSATHEIILSFLGK 393

Query:   328 LHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRE 426
             + +E+    LQE         +++ EP V + E
Sbjct:   394 VQMEVTCALLQEKY----HVEIEIKEPTVIYME 422


>bbs|137280 PRP II-1=secreted proline-rich protein [human, donor D.K., parotid
            saliva, Peptide, 174 aa]
            Length = 174

  Minus Strand HSPs:

 Score = 77 (27.1 bits), Expect = 5.5, P = 1.0
 Identities = 42/139 (30%), Positives = 47/139 (33%), Frame = -2

Query:   436 PSPFHGKTQQAPTPSVVRPSFXLSLPVG-P*GRSP--GEVRQRRQQCVRHSPQSCTRQGD 266
             P P  GK Q  P P     S     P G P GR P  G   Q         P+    QG 
Sbjct:    33 PPPPPGKPQ-GPPPQGGDQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPPGKPEEPPPQGG 91

Query:   265 QTSRGASDPRQASAGRRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQHPP 86
               S+G   P     GR     PPQ      P       G  S R P          + PP
Sbjct:    92 NQSQGTPPPPGKPEGR-----PPQQGGPGKPERPPPQGGDQSHRPP----PPPGKPERPP 142

Query:    85 DQQRCRTDGPPLPPGNDPSSVP 20
              Q   ++ GPP  PG  P   P
Sbjct:   143 PQGGDQSQGPPPHPGK-PEGPP 163


>pir||A49016 Gag-JunD fusion protein - JDV virus (fragment) >bbs|121584
            (S51472) Gag-JunD fusion protein [JDV virus, chickens, Peptide
            Recombinant Partial, 32 aa, segment 1 of 2] [JDV virus]
            Length = 32

  Minus Strand HSPs:

 Score = 60 (21.1 bits), Expect = 6.2, P = 1.0
 Identities = 13/27 (48%), Positives = 15/27 (55%), Frame = -2

Query:   274 QGDQTSRGASDPRQASAGRRGFSPPPQ 194
             QGD TSRGA  PR+   G  G    P+
Sbjct:     5 QGDNTSRGAEQPRE-EPGHAGLLGSPE 30


>pir||S37283 tetracycline resistance protein tetM - Neisseria meningitidis
            >gi|404283 (X75073) Tet(M) [Neisseria meningitidis]
            Length = 639

  Plus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 7.1, P = 1.0
 Identities = 24/92 (26%), Positives = 43/92 (46%), Frame = +1

Query:   151 PLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAG-AGE 327
             P R    +  P++R  VE   P     L++ L  +S SDPL+   ++ +   I+    G+
Sbjct:   334 PQRKKIENPHPLLRTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGK 393

Query:   328 LHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRE 426
             + +E+    LQE         +++ EP V + E
Sbjct:   394 VQMEVISALLQEKY----HVEIELKEPTVIYME 422


>gnl|PID|e276445 (Z81264) nuclear protein [Sus scrofa]
            Length = 124

  Minus Strand HSPs:

 Score = 72 (25.3 bits), Expect = 7.5, P = 1.0
 Identities = 32/108 (29%), Positives = 45/108 (41%), Frame = -2

Query:   343 RSPGEVRQRRQQCVRHSPQSCTRQGDQTSRGASDPRQASAGRRGFSPPPQHAQRATP--- 173
             RSP   R RR+   R    S  R+   + R    PR+ +  RR   PPP+H +  +P   
Sbjct:    15 RSPSHTRPRRRHRSRSRSYSPRRR--PSPRRRPSPRRRTPPRR-MPPPPRHRRSRSPVRR 71

Query:   172 ---STSCLAAGGGSRRRP*WWRISQCTCQHPPDQQRCRTDGPPLPPGN-DPSSVP 20
                S++ L     S         S    + PP +   RT  PP       PS+ P
Sbjct:    72 RRRSSASLXXSSSSS--------SSXRSRSPPKKAPKRTSSPPRKTRRLSPSASP 118


>gi|3153821 (AF062655) plenty-of-prolines-101; POP101; SH3-philo-protein [Mus
            musculus]
            Length = 897

  Minus Strand HSPs:

 Score = 85 (29.9 bits), Expect = 7.9, P = 1.0
 Identities = 56/192 (29%), Positives = 78/192 (40%), Frame = -2

Query:   562 PPSRRSGLPPXXRTTP-PLAEHRGRTNGYACSRTWKDTGSTTHPSPFHGKTQQAPTPSVV 386
             PP RR+  PP  R +P P          Y+ S   K   ++  P P   K + +P+P   
Sbjct:   595 PPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPP---KRRASPSPP-- 649

Query:   385 RPSFXLSLPVGP*GRSPGEVRQRRQQCV--RH----SPQSCTRQG---DQTSRGASDPR- 236
              P   +S    P  RSP  V +RR   +  +H    SP   TR+        R +  PR 
Sbjct:   650 -PKRRVSHSPPPKQRSP-TVTKRRSPSLSSKHRKGSSPGRSTREARSPQPNKRHSPSPRP 707

Query:   235 ---QASAG---RRGFSPPPQHAQRATPSTSCLAAGGGSRRRP*WWRISQCTCQHPPDQQR 74
                Q S+    RRG S  PQ  Q  +PST  +       R P   +I +     P   +R
Sbjct:   708 RAPQTSSPPPVRRGASASPQGRQSPSPSTRPIRRVS---RTPEPKKIKKAASPSPQSVRR 764

Query:    73 CRTD----GPPLPPGNDPSSVP 20
               +     G P P    P + P
Sbjct:   765 VSSSRSVSGSPEPAAKKPPAPP 786


>sp|P53781|TTP_BOVIN TRISTETRAPROLINE (TTP) (TIS11A) (TIS11) (ZFP-36)
            >gi|1100071 (L42319) tristetraprolin [Bos taurus]
            Length = 324

  Minus Strand HSPs:

 Score = 80 (28.2 bits), Expect = 7.9, P = 1.0
 Identities = 46/156 (29%), Positives = 59/156 (37%), Frame = -2

Query:   628 CALLQRPSQXCPQGSGHAPXGRPPSRRSGLPPXXRTTPPLAEHRGRT-NGYACSRTWKDT 452
             C  +  PS+      GH    R     SGLP   RT+PP A   G + + ++ S +    
Sbjct:   160 CHFIHNPSEDLA-APGHPHVLRQSISFSGLPSGRRTSPPPASLAGPSVSSWSFSPSSSPP 218

Query:   451 ---GSTT-HPSPFHGKT----QQAPTPSVVRPSFXLSLPVGP*GRSPGEVRQRRQQCVRH 296
                G     PS F        ++ PTP+   PS   + P    G   G  R      +  
Sbjct:   219 PPPGDLLLSPSAFSAAPGHLCRRDPTPACC-PSCRRATPNSVWGPVGGLARSPSAHSLGS 277

Query:   295 SPQSCTRQGDQTSRGASDPRQASAGRRGFSPP-PQHAQRATP 173
              P      G  TS G SD     AG   F PP P  A R  P
Sbjct:   278 DPDEYASSG--TSLGGSDSPVFEAGV--FGPPQPPAAPRRLP 315


>sp|P32323|AGA1_YEAST A-AGGLUTININ ATTACHMENT SUBUNIT PRECURSOR >pir||A41258
            a-agglutinin core protein AGA1 - yeast (Saccharomyces cerevisiae)
            >gi|170964 (M60590) a-agglutinin core subunit [Saccharomyces
            cerevisiae] >gnl|PID|e239834 (Z71659) ORF YNR044w [Saccharomyces
            cerevisiae]
            Length = 725

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 8.1, P = 1.0
 Identities = 47/191 (24%), Positives = 74/191 (38%), Frame = -1

Query:   617 ATSQSXLSARKRARTXGSASEPAFRPSSXXTHNSSVSGAPRQNKRLCLFADLERHWIDDT 438
             +T+ S  +    + T  S S  +  PSS  T +SS S +                    T
Sbjct:   175 STTSSNPTTTSLSSTSTSPSSTSTSPSSTSTSSSSTSTSSSSTSTSSSSTSTSP---SST 231

Query:   437 SVTVSRKDTTGSDTFSGAPLVXIKSSCRSLRQISR*SSPAPATMCSPLSSIVHTTRGSDF 258
             S + S   T+ S T +        SS  S    S  S+ + +T  SP S     +  S  
Sbjct:   232 STSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSST-STSSSSTSTSPSSKSTSASSTSTS 290

Query:   257 ERRFRPSTSFGRSEGFFASTATRTTGDTEYFM-SRSGWGLSPSSVMVADFTMYLSTPTRP 81
                   S S   S    AST+  +T  +  F  S S  G   SS+  +  ++ L +P+ P
Sbjct:   291 SYSTSTSPSLTSSSPTLASTSPSSTSISSTFTDSTSSLG---SSIASSSTSVSLYSPSTP 347

Query:    80 T-TLPHGWSSTAS 45
               ++P   S+ A+
Sbjct:   348 VYSVPSTSSNVAT 360


>sp|P09757|TETM_UREUR TETRACYCLINE RESISTANCE PROTEIN TETM >pir||S03268
            tetracycline resistance protein tetM - Ureaplasma urealyticum
            (SGC3) >gi|475984 (U08812) tetracycline resistance determinant
            [Ureaplasma urealyticum]
            Length = 639

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 9.1, P = 1.0
 Identities = 23/92 (25%), Positives = 44/92 (47%), Frame = +1

Query:   151 PLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAG-AGE 327
             P R    +  P++++ VE   P     L++ L  +S SDPL+   ++ +   I+    G+
Sbjct:   334 PQRKRIENPHPLLQITVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGK 393

Query:   328 LHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRE 426
             + +E+    LQE         +++ EP V + E
Sbjct:   394 VQMEVISALLQEKY----HVEIELKEPTVIYME 422


>sp|P21598|TET9_ENTFA TETRACYCLINE RESISTANCE PROTEIN TETM (TRANSPOSON TN916)
            >pir||S13142 tetracycline resistance protein tetM - Enterococcus
            faecalis transposon Tn916 >gi|47062 (X56353) tetracycline (M)
            [Enterococcus faecalis] >gi|1277146 (U50983) tetracyclin-resistance
            protein [Cloning vector pFW16]
            Length = 639

  Plus Strand HSPs:

 Score = 83 (29.2 bits), Expect = 9.1, P = 1.0
 Identities = 23/92 (25%), Positives = 44/92 (47%), Frame = +1

Query:   151 PLRDMKYSVSPVVRVAVEAKNPSDLPKLVEGLKRLSKSDPLVVCTIEESGEHIVAG-AGE 327
             P R    +  P+++  VE   P     L++ L  +S SDPL+   ++ +   I+    G+
Sbjct:   334 PQRKKIENPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGK 393

Query:   328 LHLEICLKDLQEDLIXTRGAPLKVSEPVVSFRE 426
             + +E+    LQE         ++++EP V + E
Sbjct:   394 VQMEVISALLQEKY----HVEIEITEPTVIYME 422


>gi|3005587 (AF048977) Ser/Arg-related nuclear matrix protein [Homo sapiens]
            Length = 820

  Minus Strand HSPs:

 Score = 84 (29.6 bits), Expect = 9.3, P = 1.0
 Identities = 59/208 (28%), Positives = 79/208 (37%), Frame = -2

Query:   610 PSQXCPQGSGHAPXGRPPSRRSGLPPXXRTTP-PLAEHRGRTNGYACSRTWKDTGSTTHP 434
             PS   P      P   PP RR+  PP  R +P P          Y+ S   K   ++  P
Sbjct:   559 PSPAPPPRRRRTPTP-PPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPP 617

Query:   433 SPFHGKTQQAPTPSVVR------PSFXLSLPVGP*GRSPGEVRQRRQQCVRHSPQSCTRQ 272
              P   K + +P+P   R      P    S PV    RSP    + R+     SP   TR+
Sbjct:   618 PP---KRRASPSPPPKRRVSHSPPPKQRSSPVTK-RRSPSLSSKHRKGS---SPSRSTRE 670

Query:   271 G---DQTSRGASDPR----QASAG----RRGFSPPPQHAQRATPSTSCLAAGGGSRRRP* 125
                     R +  PR    Q S+     RRG S  PQ  Q  +PST  +       R P 
Sbjct:   671 ARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRPIRRVS---RTPE 727

Query:   124 WWRISQCTCQHPPDQQRCRTD----GPPLPPGNDPSSVP 20
               +I +     P   +R  +     G P P    P + P
Sbjct:   728 PKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPP 766


Parameters:
  matrix=/usr/local/src/bio/blast/blast2/matrix/aa/BLOSUM62
  W=3
  T=1000

  ctxfactor=5.96
  E=10

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   Std.    0   BLOSUM62                                 0.318   0.135   0.401  
   +3      0   BLOSUM62        0.318   0.135   0.401    0.334   0.151   0.559  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +2      0   BLOSUM62        0.318   0.135   0.401    0.352   0.145   0.540  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   +1      0   BLOSUM62        0.316   0.135   0.390    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -1      0   BLOSUM62        0.318   0.135   0.401    0.322   0.129   0.397  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -2      0   BLOSUM62        0.318   0.135   0.401    0.321   0.136   0.468  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a
   -3      0   BLOSUM62        0.318   0.135   0.401    0.337   0.144   0.449  
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W    T  X   E2     S2
   +3      0      211       205       10.  74 3 1000 22  0.097   35
                                                     31  0.11    38
   +2      0      211       207       10.  74 3 1000 22  0.098   35
                                                     31  0.11    38
   +1      0      211       207       10.  74 3 1000 22  0.10    35
                                                     31  0.11    38
   -1      0      211       205       10.  74 3 1000 22  0.097   35
                                                     31  0.11    38
   -2      0      211       205       10.  74 3 1000 22  0.097   35
                                                     31  0.11    38
   -3      0      211       207       10.  74 3 1000 22  0.098   35
                                                     31  0.11    38


Statistics:

  Database:  /usr/local/db/others/blast/nrdb
    Title:  /usr/local/db/others/blast/nrdb
    Release date:  unknown
    Posted date:  9:16 PM EDT Aug 19, 1998
    Format:  BLAST
  # of letters in database:  97,797,364
  # of sequences in database:  322,836
  # of database sequences satisfying E:  147
  No. of states in DFA:  369 (37 KB)
  Total size of DFA:  51 KB (64 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t  Elapsed: 00:00:00
  No. of threads or processors used:  6
  Search cpu time:  50.73u 1.21s 51.94t  Elapsed: 00:00:10
  Total cpu time:  50.98u 8.99s 59.97t  Elapsed: 00:00:19
  Start:  Thu Sep 24 11:31:20 1998   End:  Thu Sep 24 11:31:39 1998

Date: 17:18:14 on Mon 18 Dec 117.